4IREA

Crystal structure of glic with mutations at the loop c region
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
312
structure length
312
Chain Sequence
MVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVNISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALQNRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Signal transduction pathways in the pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 88
structure length 312
sequence length 312
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ireA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ireA01
3WTIA 4TNVA 2Y57A 5L4EA 4A98A 2XQ9A 5J5GA 3UU3A 4QACA 4ZK4A 3WTNA 2BG9E 4PIRA 5J5IA 3U8JA 2VL0A 5L4HA 3UU8A 4TWDA 2W8FA 5KE4A 5IUXA 2XQ5A 4HFHA 5J5FA 2Y58A 2QC1B 4ZZCA 4UM3S 5AFNA 4HFCA 5L47A 2YKSA 3JAEA 4ZK1A 2M6IA 2XQ4A 5BP0A 3UUBA 2ZJVA 3P50A 4ILBA 2BR8A 4IL4A 3WIPA 4QH4A 4LMLA 3GUAA 4B5DA 3WTHA 4NPPA 4HFIA 4A97A 3UU6A 3P4WA 2Y54A 3SQ9A 3RIFA 5CFBA 2WN9A 2XNVA 4ALXA 2YMDA 5HEHA 4TWHA 3RHWA 2WNJA 1OEDC 5CO5A 3ZDGA 4AFGA 5AFKA 2XNUA 2M6BA 5HCMA 3WTOA 5KZUA 4Z91A 5FJVA 4QABA 4AFTA 3TLWA 2UZ6A 3RQUA 3TLSA 5LXBA 2XZ5A 4XHEA 2WNLA 5AFHA 5AFJA 4HQPA 4ZJTA 2LKHA 3RIAA 4DBMA 4ILCA 2Y7YA 4UM1A 3SH1A 2LLYA 2BG9A 1I9BA 2BR7A 5LG3A 5BW2A 2KSRA 4TWFA 5SYOA 4COFA 4BFQA 4AFHA 2X00A 1UV6A 3PEOA 4NZBA 3WTKA 2BYQA 3RI5A 3EAMA 2BG9B 2XYTA 2Y56A 3U8KA 2XZ6A 3SQ6A 2MAWA 2YOEA 3C79A 3WTJA 3WTMA 3UU5A 4Z90A 3WTLA 5BRXA 2WZYA 5J5HA 3JAFA 5HCJA 4ZR6A 3ZDHA 3PMZA 2LKGA 2XQAA 4IL9A 4UM3P 2WNCA 3LSVA 2XNTA 2XQ3A 5AFMA 2LM2A 2BG9C 2W8GA 4WV9A 5TVCA 2BYNA 5HEUA 4UY2A 3U8MA 4ZJSA 4D01A 3EI0A 5HEJA 3EHZA 2XQ7A 3SIOA 5AINA 2ZJUA 5AFMB 1OEDE 4BQTA 2YN6A 3UQ7A 2XYSA 2X00D 2YMEA 4IREA 3IGQA 5JMEA 4QH5A 3U8NA 5J0ZA 1OEDA 4XK9A 3JADA 2BYRA 3RQWA 3T4MA 2BYSA 3ZKRA 4ILAA 3TLTA 2C9TA 4LMJA 2XQ8A 5AFLA 2BYPA 4QAAA 3UQ4A 4QH1A 4FRRA 4HFEA 2XQ6A 4X5TA 2PH9A 4HFBA 4UM3A 1UX2A 4EZ1A 1OEDB 3UU4A 4ZRUA 4TNWA 3TLVA 2PGZA 4UXUA 3U8LA 4LMKA 4HFDA 4ZZBA 1UW6A 5HEGA 4F8HA 3TLUA 3C84A 2BJ0A 5HEOA
chains in the Genus database with same CATH superfamily
3LK42 5FY0A 5LBQB 2X0YA 5HXSA 2XM2A 4TWDA 4JUYA 4P0BA 4PK5A 2X9YA 5LB7B 1D1BA 2V7MA 3JAEA 5JDGA 5AQPB 1QSDA 3EDUA 3AE1A 4B5DA 3DP7A 3OBVE 4NPPA 3AXJB 1HNZT 4AQFC 5CFBA 3QK6A 1T98A 2KLQA 3MKDA 4GKJT 2L3LA 2W4XA 5FL1A 4CXWA 5FJVA 3RKOA 2CXDA 3PUYF 5CB4E 2XZ5A 2VASA 1OXZA 3RIAA 3P7IA 4B6XA 2VURA 2JMHA 3AEDA 4COFA 3J7Yq 3GMIA 2BYQA 3K8PC 1WYBA 2XYTA 2EHOA 2WWUA 3FXEB 2WZYA 2CRBA 4DV4T 3QB5A 3HI2A 2UUAT 4KP3C 2XUEA 1KNPA 3ZSTA 2XYSA 1WLXA 1Z8UA 2BKOA 5LHHB 2OV9A 5CA0E 4PFOA 4WNKA 3I1AA 3UFGA 2WCAA 2XQ8A 5AFLA 3RPUA 2AE9A 3VHLA 4X62T 4ZZBA 5JTGA 1J5ET 5AQJB 3TLUA 2VKDA 1VOMA 2VL8A 2Y8DA 3AEGA 4HWHA 2QA7A 3IEEA 3IBPA 2RA1A 4NXMT 4DBRA 1NAFA 5JR9A 3CX8B 5DJQC 2NP9A 4ZK1A 4DR6T 5BP0A 4GKKT 3OYXA 4LF6T 4IIJE 2X67A 2X51A 2WNJA 4KHPT 2XHEB 3WTOA 1N32T 5J2TE 4IDPA 2VVNA 2V7JA 3L3PA 2IUBA 4L0RA 2BR7A 2KT9A 4BFQA 3BQKA 2BBJA 2X9XA 2YEVC 2GK9A 1HF8A 4UV8B 2ZMAA 1MMDA 3T1YT 2XNTA 5A1LA 1YD8G 3I9WA 4MBQA 3EHZA 3SIOA 2CM0A 2ACZA 3A7MA 3CVRA 4A5XA 3JADA 3RQWA 2Y48B 4ERRA 3WAJA 2QRXA 3KVAA 3JCFA 4H9OC 2NOXA 3LG7A 5L2LA 3A8YC 5JDLA 1HR0T 2WDVA 1Y64B 5HEGA 2LJLA 2CBJA 4H9SE 3AE6A 1B7TA 3ZN1B 1YXRA 2ZJVA 2K9AA 2L8KA 2DI4A 1SUMB 3UUNA 1AJ3A 2K5BB 4X1KE 2YMDA 3N9MA 5KX5E 3FBZA 2UXXB 2BBHA 3AXJA 4YSYA 1MMGA 5ABFA 3AEAA 4XHEA 3MXZA 3HA4A 4CI3B 2EHOC 3HKEE 1CHUA 3AEBA 3AEFA 3U3IA 3WTJA 5L3FB 3KV4A 4YHJA 2CEAA 5E0OA 3ZDHA 2K3WA 3KV5A 2WWVA 1I6ZA 5FKYA 1MMNA 4UY2A 1UCUA 4QX7B 1MNEA 5KXJA 2CWYA 3GA8A 3GWHA 2YN6A 2YMEA 2CLYC 2A3DA 4JI6T 3FB2A 2V7KA 2WB5A 3ZCIA 2DCFA 3MK7C 2BYPA 3U78A 4UM3A 1E1HB 4ZRUA 3CQCB 2E9XC 1YQ3A 2JQ9A 3U8LA 4AI6A 1UW6A 1NEKA 4TV9E 1N34T 3IHRA 4ZI3C 3Q5EA 5DQVA 3F2EA 4GIWA 3SFDA 3ZT5A 1KF6A 3RF1A 3ETUA 3ZT7A 4HE8A 1QLBA 3P50A 4AKRB 2NW7A 3AA7B 2BR8A 2WQYA 4B3TT 4HFIA 5L3BB 2RP4A 2W0GA 5AFKA 4L9IA 2LRLA 3F57A 1XNQT 4JI0T 1ZV4X 4QHOA 2KSRA 3Q5XA 1UK5A 2X00A 3Q5DA 5BMVE 5IYZE 1LKXA 2V6YB 1W0AA 1N33T 2FJEA 5LBMA 2JJ9A 3ABVA 2Y6XA 3WTMA 3RYFE 3WTLA 2LKGA 1J1JA 1M62A 4IHJE 2JMKA 2E5LT 5H6QB 5AQLB 2IAKA 1T8BA 1FMVA 5JRCB 2BVMA 3CQGB 3UUMA 4IREA 3KV6A 4HTEA 3CPZA 4CXYA 2LRKA 3AE8A 4TN7B 1UGOA 3MA9A 4FRRA 4YJ2E 3T1HT 3OVUA 4PK6A 3I0QA 1NENA 4UXUA 2QVAA 1IJ5A 4LF8T 2XAJB 3N2OA 4PNIA 1SA0E 4DR4T 4GYRA 4DMVA 2FJAA 2K48A 3PJAJ 3ZN0B 5AFNA 3ANWB 1OWAA 4IL4A 4LMLA 2WN9A 3SOLA 4F6RC 3S4UA 2I0MA 3H37A 5KZUA 3TLWA 1WYCA 4QWNB 5DQWA 3WI3A 1IJ6A 2XM1A 4PAGA 5AQHB 4DUZT 3KFWX 3B5MA 3AE7A 5LXTE 1IBKT 3ETVA 1JNZA 2LSGA 4EB6E 2Y56A 3U8KA 3SQ6A 2MAWA 2V26A 4IDQA 3N9LA 4XZCA 2QGSA 5J5HA 1YW0A 2LHNA 4PJLA 2LM2A 1VRBA 4O4HE 5LGUB 3H3MA 3IA3A 4EOZB 4YTNA 4UELA 3O1IA 2H7VC 2BS2A 5FNVE 4EXTA 2R6GF 5AINA 3AEEA 4I43B 2J4GA 4AQGA 2XSBA 3B57A 2X0HA 4AISA 3D0TA 4TX5A 4DIDB 1WR6A 2VKOA 3RYHE 4XBFB 4JI3T 2VVSA 4HFEA 4X5TA 5KMGP 4BJMA 3TLVA 3K3NA 2PGZA 5EK3A 1VCSA 4ZXLA 4I4TE 4LFCT 2Y57A 2LSKA 3UU3A 1XDOA 5KDMC 5IUXA 3IF8B 5ABHA 1KNZA 2V7IA 2LE8A 4ZI2C 2I6HA 5LP6E 2YU2A 4A97A 4WBOA 4UVBB 5L3CB 5AQOB 1OEDC 3ZDGA 1HCIA 4AXPA 3ONJA 2V5CA 2X0LB 4Z91A 4I55E 3PTRB 4YTPA 3FXDB 3RGLA 5LXBA 3LDQB 4DV5T 2W67A 5AQQB 2DWGA 3UFEA 2Y7YA 3N9PA 5BW2A 4WBNE 3RH3A 4EYUA 4HWCA 3BQIA 2BG9B 3B13A 4YSZA 4LF4T 2F4VT 4O2AE 1XMOT 5ABGA 1UX4A 4DR1T 4ISTA 3ZYKA 3NZQA 4QXBB 2JQQA 4X66T 3OTOT 3V5UA 2IC6A 1T7SA 4ILUA 1T72A 2UXDT 1LVKA 4QXHB 3QNUA 3N9OA 3I9YA 5AQSB 3EUHA 4FJOA 3QC9A 2E5VA 4IE5A 4UV9B 2LT3A 3MZKB 4ANJA 3UULA 3DTOA 4QACA 5L4HA 2W66A 1U4QA 2XQ5A 4TV8E 5L47A 1KK7A 4ILBA 5HXHA 3CK6A 3P4SA 2ES0A 5JR9C 4KX6A 4ALXA 4TWHA 4JI7T 4AFGA 4PJMA 4JI4T 4O8SA 2JPFA 3DJBA 3C4WA 4HQPA 2JIWA 4A56A 5LG3A 4AFHA 2E9XB 2CMRA 4NZBA 5J2UE 3O4XE 3ZMSB 2IIUA 1WR0A 4ZR6A 2DNXA 2BG9C 5C8YE 2KWHA 2D5UA 3PDYA 2N2NA 4BQTA 5EK4A 4EEBA 3ZMUB 3PUZF 3IGQA 2FJDA 5J0ZA 5HAXA 1BR1A 4AIUA 2C9TA 3K3QC 1IBLT 2IW5B 2EHOB 3O1HA 2KINB 3JC6D 4TUYE 2BS3A 4HFBA 1MIWA 2CA5A 4B3ST 2YK0A 4BAYB 3E22E 2DHRA 4NXNT 2XQYA 1FEWA 3WAKA 3KV9A 2NW8A 3WTNA 4EZHA 1J5WA 3LBXB 3CKDA 3VRAA 5LHIB 4OX9T 4CI2B 4N78D 5HXCA 2V6YA 2YKSA 3HKDE 3AVSA 4IT4A 4KUMB 5EZYE 4QH4A 3GUAA 5CJ5A 3P4WA 5CA1E 4NUUA 1WCRA 2XNUA 2M6BA 3NZPA 1E7PA 2WMNA 4B3MT 3N9NA 5IHYA 4EZ4A 2KXPB 2HPJA 4AQYT 2CE7A 4WYVA 3PUAA 2BG9A 2A72A 5FYMA 4HWFA 3BK9A 4I50E 2WAUA 4UR9A 4HKAA 2DLRA 5AFMA 4OYJA 3CX6B 1XMQT 4D01A 4JI8T 5LJMA 2ZJUA 1VCTA 3E08A 3UQ7A 5JQGE 1FJGT 2W00A 3AVRA 4HFVA 2BYRA 4P09A 2FBWA 2WBLA 1M7KA 3C50A 4DV6T 2HHHT 4H63H 2YU1A 3QUJA 3PUVF 3AE5A 2ZM8A 2I59A 2SPCA 4LMKA 2V5DA 2ZLYA 3UUXB 5TAOA 1UURA 2ODUA 1N36T 1BR2A 3NRXA 4Z8XA 5J5GA 2PBIA 2VQET 1IAPA 5C2TA 2X68A 2NR4A 5LMNT 2QC1B 2ODVA 3UTKA 4YTMA 3WTHA 3ZMTB 5JDNA 4HWDA 5HWYA 3ZJ1A 3NVOA 3VU7H 5FP3A 4YJ3E 4UIGA 5FXXA 3RC3A 2WNLA 1YQ4A 2JQHA 2MOZA 5SYOA 4YSXA 4AKGA 3RI5A 3ANWA 5J1GA 3Q5WA 4B3RT 2G0UA 4CN6A 4UM3P 4BJNA 2CWOA 2BKPA 4WW0A 5EK2A 2W8GA 4IE0A 5HEUA 4UXNB 3EI0A 5CGMA 4PK4A 2BDEA 4JEHB 5JMEA 2CHOA 5AFUL 3M3ZB 3O9XA 1OEDA 2XPKA 1D0XA 2VB6A 2V1DB 1XWMA 2KMFA 1W9RA 4K0KT 2WSSV 3TLTA 5AQTB 1HNXT 1S94A 4QH1A 4U3CA 4UF0B 3VKHA 2D0UA 4CN1A 3MJXA 3L8RA 2BZBA 4M1PA 5L4EA 1WRDA 2PTFA 3U8JA 2W63A 3F31A 3ONXA 3LFMA 2XAHB 4UM3S 2XQ4A 2VKJA 3VRBA 4EGWA 1LVFA 5ETWA 3UU6A 2Y54A 2V7LA 2XNVA 5C3JA 3PJAA 4H9NC 3RHWA 4DV1T 4X20E 4C91A 3NWIA 4HEAA 5FY7A 2PJQA 4U7YA 4AKIA 2UZ6A 2CHNA 4EYYR 4DVDA 4HN9A 4DR5T 3PUSA 2LKHA 2VKHA 3HL6A 4ILCA 3C98B 5HYAA 2LLYA 4IDOA 4PJNA 2FUPA 1EZ3A 4U31A 4H9RC 1SE7A 3PUWF 1FIOA 5ABEA 2H3RA 4DO0A 2XZ6A 2WU2A 4Z90A 5BRXA 4GYSA 3RKGA 5LMUT 4KBMB 1DU2A 2ACXA 2XASB 4WV9A 2BYNA 2PG8A 3K3OA 2X9HA 2X9WA 1HFAA 5AQKB 5JDQA 5LJNA 3JC6C 1S35A 4U7IA 2LM9A 3OPCA 4XK9A 2UXBT 2IC9A 3ZEFB 4NIQA 3SRZA 3RC8A 3P4QA 4KHZF 2EHOD 2XQ6A 2XAFB 4EZ1A 1HG5A 4X1YE 1D1AA 4K0UA 5JR9B 2C5JA 3PV0F 1FMWA 1UX5A 3O1JA 2HN2A 4X65T 5HXRA 2H89A 4TNVA 4ZI3D 2BG9E 4P0AA 1U5PA 4LF7T 1BR0A 4X64T 2W61A 3LK3B 4U72A 3LBXA 4G63A 4UVCB 5CO5A 3ZJ2A 1H7CA 3AAEB 3ZLIA 4P1NA 2NWBA 5LNKA 3RQUA 2D9DA 3RYCE 2HPLA 4AKLA 4DV2T 3AAIA 4DBMA 1HG2A 3CIRA 3E0ZA 1UV6A 2Q9QC 2FJBA 4UF0A 5AQIB 3PMZA 5FL0A 5JDFA 5FXWA 4OK0A 2WDQA 2VK9A 1SHZC 2VWAA 3CX7B 3NRYA 5JREA 4PFPA 3G06A 1ZKEA 2WM9A 2LOSA 4JYAT 2P9BA 4ILAA 2BS4A 2J47A 4LMJA 2PH9A 3EVYA 4HFDA 4LFBT 4F8HA 2BJ0A 2MTQA 4ZK4A 1HX8A 2ZM2A 2W8FA 4EV6A 5J5FA 3FZKB 3P4PA 1JNRA 3UUBA 5L3DB 1IZNB 3R84B 3J9X1 1US7B 4I0UA 3RIFA 4O4JE 3VR8A 5HEHA 3KINB 4IDNA 4DV0T 3AA6B 1D1CA 2B76A 2WZIA 4H9QC 2E8IA 4QABA 2CPTA 4IE7A 4DUYT 4O4LE 3HKBE 3ZMVB 3W15B 4MALA 2C5KT 2W62A 2MBGA 2CXLA 3BQLA 4GOUA 1XNRT 4KMCA 3PUQA 4QXCB 2L9QA 2CBIA 4LF9T 2X66A 5LGTB 4ZOLE 3ZSSA 2HH7A 4YXDA 4C90A 3ZT6A 4FI5A 4JLEA 5AFMB 4O4IE 1OEDE 1L0VA 4ADZA 1KEYA 1E2AA 3U8NA 3ZC0A 3VKGA 3N2KE 5LOVE 1X79A 3ONLC 3ZKRA 1R8IA 3RRCA 3EABA 2M67A 5DABA 2LHRA 3L09A 3AAAB 3OYZA 2UUBT 4TNWA 4GK5E 5LGNB 2B1EA 2N1GA 1O3XA 4JV5T 2VQFT 2LSYA 3GN5B 3FHNA 4EEDA 2CXFA 3Q2MA 5JDHA 3KBTA 4PIRA 1YKEB 3A5XA 3HKCE 2VL0A 5AQGB 4CZZB 2Y58A 4JBWF 1QUUA 3ZYMA 2UXNB 1IBMT 3WIPA 3X1DA 2KZ7B 4G2AA 4YFSA 5FY1A 2WY2A 5HCMA 3N9QA 4ZI7E 1ZEEA 2WMOA 5JDMA 5IWAT 2C0SA 4DR7T 1Z0PA 5AFHA 2E9XA 1UUSA 3GN5A 4L5GA 4UM1A 3SH1A 5F3JA 1HS7A 3RRWA 5GONE 2UU9T 1MMAA 3C4XA 1KNRA 2YOEA 3C79A 4EAHA 2WNCA 4DV7T 5AQFB 5AQVB 2CCQA 4ZHQE 3U8MA 5AQRB 5FMNA 5FVKA 3ZC1A 5H6RB 4U33A 4U2ZA 4JEUB 4CN4A 4HWIB 3PUGA 3PU8A 3CQXC 2Q9QA 4PW8A 3AE9A 2XSAA 3FZHB 2N9DA 3UQ4A 2UUCT 3RX6A 2H88A 1UX2A 2YDSA 1GQEA 3K1SA 3H3AA 2NTXA 2DL1A 1Y01A 3VR9A 3I0OA 4V1Av 2V6XA 4ISSA 4IE4A 2Z6EA 3LK2B 3AE2A 2HN1A 3N5LA 2D0TA 3PURA 4CQIA 3SFEA 2JQKA 3SQ9A 1X9BA 2WP9A 4OYKA 3C4ZA 3P4RA 4OHFA 2OA5A 3SS1A 4DNDA 4ZS3A 3TLSA 4ZJTA 3AECA 2QYWA 2WU5A 1I9BA 5LCYA 4JI2T 3ZMZB 3PEOA 5LHGB 3WTKA 3EAMA 2WZHA 4LFAT 2DWKA 4IL9A 2XQAA 4LF5T 4IDZA 2V8SV 5TVCA 2YINA 3AA1B 4U2YA 5M4YA 2XAGB 5LG4A 2J62A 2XZEA 5HWXA 2LEHA 3TKLB 4YT0A 2X00D 3QOFA 5AQNB 1W0BA 2KWIB 3T4MA 4H63V 3AE4A 4AKHA 2MPKA 1D0YA 4QX8B 1WFDA 3EDVA 4ZS2A 1I94T 1HNWT 3L39A 4CI1B 1NWMX 4J2CA 4QAAA 4TZ4C 4NUVA 3RYIE 4CXXA 4A98A 2LOPA 4KI0F 3SWHA 3V5SA 5L3EB 3UU8A 2YDQA 4HFHA 3FZLB 1MNDA 4HFCA 3QB5K 1HX1B 2M6IA 3HR0A 3NBXX 3ZCJA 4DMWA 5F5WA 5ADXL 2XTLA 2UXCT 2LSJA 4YY3T 4UEMA 3PUXF 3PE0A 2AXDS 4HGAA 3KVBA 4AFTA 3NKZA 5AQUB 2WS3A 2A2FX 4WZXA 5AFJA 4H9PC 4DV3T 3KBUA 2KNDA 3RIUC 5ABFB 4TWFA 3AB3B 3ZYLA 5JRCA 1G73A 3N2GE 2E9XD 2Q9QD 5HCJA 2LSIA 5FVLA 3LSVA 4PJJA 3OKQA 1LRZA 2WDRA 2BVLA 4ZJSA 4IGUA 5HEJA 4UVAB 3T8OA 4MLKA 3FZFB 2BKNA 2Q9QB 1MIYA 2ZM0A 2XAQB 4E7ZA 4GK0E 2BYSA 5BR8T 1ZOYA 3KDSE 4JI5T 3UT5E 3M65A 2ZM6T 1XZYA 3C51A 5HEOA 5LA6E 4DR3T 3WTIA 2XQ9A 5J5IA 2RPAA 4MFRA 5KE4A 4ASKA 2PFVA 1BR4A 2A9UA 4AQFA 4ZZCA 3AA0B 4BA9A 2XY8B 2NW9A 2YDRA 2W2UA 4DR2T 4DBQA 5FXVA 2CLYB 2MYSA 2OLTA 1ZP0A 1KFYA 1YKHB 4E7SA 2E2AA 4IE6A 2H7OA 3CWZB 5JH7E 4QKNA 3FZMB 1MIVA 4X1IE 5JVDE 3P8CD 2K24A 1G8XA 4JI1T 2JRKA 2IDOB 3MACA 4O2BE 2D2SA 3ESLA 3FBLA 3UU5A 5LYJE 3JAFA 2XQ3A 3RIUA 5L3GB 4XAXB 3ZPOA 1HTJF 4EIWA 5FXZA 5AQMB 2IMLA 2XQ7A 1D0ZA 4Q25A 2XJ7A 5F8PA 3PU3A 4OFZA 3C64A 4YHHT 4QH5A 1ZHCA 3R6NA 2J1DG 2NTYA 3Q9DA 4YLHA 1CUNA 5HXEA 1OEDB 3UU4A 1XDPA 3RLFF 3AE3A 3OJAA 3LJCA 1W09A 2C5IT 4ZEYA 2IHR1 3CMLA 1V9DA 4MHCA 4U74A 3C84A 4ZI2D
chains in the Genus database with same CATH topology
3WTIA 4TNVA 2Y57A 5L4EA 4A98A 2XQ9A 5J5GA 3UU3A 4QACA 4ZK4A 3WTNA 2BG9E 4PIRA 5J5IA 3U8JA 2VL0A 5L4HA 3UU8A 4TWDA 2W8FA 5KE4A 5IUXA 2XQ5A 4HFHA 5J5FA 2Y58A 2QC1B 4ZZCA 4UM3S 5AFNA 4HFCA 5L47A 2YKSA 3JAEA 4ZK1A 2M6IA 2XQ4A 5BP0A 3UUBA 2ZJVA 3P50A 4ILBA 2BR8A 4IL4A 3WIPA 4QH4A 4LMLA 3GUAA 4B5DA 3WTHA 4NPPA 4HFIA 4A97A 3UU6A 3P4WA 2Y54A 3SQ9A 3RIFA 5CFBA 2WN9A 2XNVA 4ALXA 2YMDA 5HEHA 4TWHA 3RHWA 2WNJA 1OEDC 5CO5A 3ZDGA 4AFGA 5AFKA 2XNUA 2M6BA 5HCMA 3WTOA 5KZUA 4Z91A 5FJVA 4QABA 4AFTA 3TLWA 2UZ6A 3RQUA 3TLSA 5LXBA 2XZ5A 4XHEA 2WNLA 5AFHA 5AFJA 4HQPA 4ZJTA 2LKHA 3RIAA 4DBMA 4ILCA 2Y7YA 4UM1A 3SH1A 2LLYA 2BG9A 1I9BA 2BR7A 5LG3A 5BW2A 2KSRA 4TWFA 5SYOA 4COFA 4BFQA 4AFHA 2X00A 1UV6A 3PEOA 4NZBA 3WTKA 2BYQA 3RI5A 3EAMA 2BG9B 2XYTA 2Y56A 3U8KA 2XZ6A 3SQ6A 2MAWA 2YOEA 3C79A 3WTJA 3WTMA 3UU5A 4Z90A 3WTLA 5BRXA 2WZYA 5J5HA 3JAFA 5HCJA 4ZR6A 3ZDHA 3PMZA 2LKGA 2XQAA 4IL9A 4UM3P 2WNCA 3LSVA 2XNTA 2XQ3A 5AFMA 2LM2A 2BG9C 2W8GA 4WV9A 5TVCA 2BYNA 5HEUA 4UY2A 3U8MA 4ZJSA 4D01A 3EI0A 5HEJA 3EHZA 2XQ7A 3SIOA 5AINA 2ZJUA 5AFMB 1OEDE 4BQTA 2YN6A 3UQ7A 2XYSA 2X00D 2YMEA 4IREA 3IGQA 5JMEA 4QH5A 3U8NA 5J0ZA 1OEDA 4XK9A 3JADA 2BYRA 3RQWA 3T4MA 2BYSA 3ZKRA 4ILAA 3TLTA 2C9TA 4LMJA 2XQ8A 5AFLA 2BYPA 4QAAA 3UQ4A 4QH1A 4FRRA 4HFEA 2XQ6A 4X5TA 2PH9A 4HFBA 4UM3A 1UX2A 4EZ1A 1OEDB 3UU4A 4ZRUA 4TNWA 3TLVA 2PGZA 4UXUA 3U8LA 4LMKA 4HFDA 4ZZBA 1UW6A 5HEGA 4F8HA 3TLUA 3C84A 2BJ0A 5HEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTI A;  4TNV A;  2Y57 A;  5L4E A;  4A98 A;  2XQ9 A;  5J5G A;  3UU3 A;  4QAC A;  4ZK4 A;  3WTN A;  2BG9 E;  4PIR A;  5J5I A;  3U8J A;  2VL0 A;  5L4H A;  3UU8 A;  4TWD A;  2W8F A;  5KE4 A;  5IUX A;  2XQ5 A;  4HFH A;  5J5F A;  2Y58 A;  2QC1 B;  4ZZC A;  4UM3 S;  5AFN A;  4HFC A;  5L47 A;  2YKS A;  3JAE A;  4ZK1 A;  2M6I A;  2XQ4 A;  5BP0 A;  3UUB A;  2ZJV A;  3P50 A;  4ILB A;  2BR8 A;  4IL4 A;  3WIP A;  4QH4 A;  4LML A;  3GUA A;  4B5D A;  3WTH A;  4NPP A;  4HFI A;  4A97 A;  3UU6 A;  3P4W A;  2Y54 A;  3SQ9 A;  3RIF A;  5CFB A;  2WN9 A;  2XNV A;  4ALX A;  2YMD A;  5HEH A;  4TWH A;  3RHW A;  2WNJ A;  1OED C;  5CO5 A;  3ZDG A;  4AFG A;  5AFK A;  2XNU A;  2M6B A;  5HCM A;  3WTO A;  5KZU A;  4Z91 A;  5FJV A;  4QAB A;  4AFT A;  3TLW A;  2UZ6 A;  3RQU A;  3TLS A;  5LXB A;  2XZ5 A;  4XHE A;  2WNL A;  5AFH A;  5AFJ A;  4HQP A;  4ZJT A;  2LKH A;  3RIA A;  4DBM A;  4ILC A;  2Y7Y A;  4UM1 A;  3SH1 A;  2LLY A;  2BG9 A;  1I9B A;  2BR7 A;  5LG3 A;  5BW2 A;  2KSR A;  4TWF A;  5SYO A;  4COF A;  4BFQ A;  4AFH A;  2X00 A;  1UV6 A;  3PEO A;  4NZB A;  3WTK A;  2BYQ A;  3RI5 A;  3EAM A;  2BG9 B;  2XYT A;  2Y56 A;  3U8K A;  2XZ6 A;  3SQ6 A;  2MAW A;  2YOE A;  3C79 A;  3WTJ A;  3WTM A;  3UU5 A;  4Z90 A;  3WTL A;  5BRX A;  2WZY A;  5J5H A;  3JAF A;  5HCJ A;  4ZR6 A;  3ZDH A;  3PMZ A;  2LKG A;  2XQA A;  4IL9 A;  4UM3 P;  2WNC A;  3LSV A;  2XNT A;  2XQ3 A;  5AFM A;  2LM2 A;  2BG9 C;  2W8G A;  4WV9 A;  5TVC A;  2BYN A;  5HEU A;  4UY2 A;  3U8M A;  4ZJS A;  4D01 A;  3EI0 A;  5HEJ A;  3EHZ A;  2XQ7 A;  3SIO A;  5AIN A;  2ZJU A;  5AFM B;  1OED E;  4BQT A;  2YN6 A;  3UQ7 A;  2XYS A;  2X00 D;  2YME A;  4IRE A;  3IGQ A;  5JME A;  4QH5 A;  3U8N A;  5J0Z A;  1OED A;  4XK9 A;  3JAD A;  2BYR A;  3RQW A;  3T4M A;  2BYS A;  3ZKR A;  4ILA A;  3TLT A;  2C9T A;  4LMJ A;  2XQ8 A;  5AFL A;  2BYP A;  4QAA A;  3UQ4 A;  4QH1 A;  4FRR A;  4HFE A;  2XQ6 A;  4X5T A;  2PH9 A;  4HFB A;  4UM3 A;  1UX2 A;  4EZ1 A;  1OED B;  3UU4 A;  4ZRU A;  4TNW A;  3TLV A;  2PGZ A;  4UXU A;  3U8L A;  4LMK A;  4HFD A;  4ZZB A;  1UW6 A;  5HEG A;  4F8H A;  3TLU A;  3C84 A;  2BJ0 A;  5HEO A; 
#chains in the Genus database with same CATH topology
 3LK4 2;  5FY0 A;  5LBQ B;  2X0Y A;  5HXS A;  2XM2 A;  4TWD A;  4JUY A;  4P0B A;  4PK5 A;  2X9Y A;  5LB7 B;  1D1B A;  2V7M A;  3JAE A;  5JDG A;  5AQP B;  1QSD A;  3EDU A;  3AE1 A;  4B5D A;  3DP7 A;  3OBV E;  4NPP A;  3AXJ B;  1HNZ T;  4AQF C;  5CFB A;  3QK6 A;  1T98 A;  2KLQ A;  3MKD A;  4GKJ T;  2L3L A;  2W4X A;  5FL1 A;  4CXW A;  5FJV A;  3RKO A;  2CXD A;  3PUY F;  5CB4 E;  2XZ5 A;  2VAS A;  1OXZ A;  3RIA A;  3P7I A;  4B6X A;  2VUR A;  2JMH A;  3AED A;  4COF A;  3J7Y q;  3GMI A;  2BYQ A;  3K8P C;  1WYB A;  2XYT A;  2EHO A;  2WWU A;  3FXE B;  2WZY A;  2CRB A;  4DV4 T;  3QB5 A;  3HI2 A;  2UUA T;  4KP3 C;  2XUE A;  1KNP A;  3ZST A;  2XYS A;  1WLX A;  1Z8U A;  2BKO A;  5LHH B;  2OV9 A;  5CA0 E;  4PFO A;  4WNK A;  3I1A A;  3UFG A;  2WCA A;  2XQ8 A;  5AFL A;  3RPU A;  2AE9 A;  3VHL A;  4X62 T;  4ZZB A;  5JTG A;  1J5E T;  5AQJ B;  3TLU A;  2VKD A;  1VOM A;  2VL8 A;  2Y8D A;  3AEG A;  4HWH A;  2QA7 A;  3IEE A;  3IBP A;  2RA1 A;  4NXM T;  4DBR A;  1NAF A;  5JR9 A;  3CX8 B;  5DJQ C;  2NP9 A;  4ZK1 A;  4DR6 T;  5BP0 A;  4GKK T;  3OYX A;  4LF6 T;  4IIJ E;  2X67 A;  2X51 A;  2WNJ A;  4KHP T;  2XHE B;  3WTO A;  1N32 T;  5J2T E;  4IDP A;  2VVN A;  2V7J A;  3L3P A;  2IUB A;  4L0R A;  2BR7 A;  2KT9 A;  4BFQ A;  3BQK A;  2BBJ A;  2X9X A;  2YEV C;  2GK9 A;  1HF8 A;  4UV8 B;  2ZMA A;  1MMD A;  3T1Y T;  2XNT A;  5A1L A;  1YD8 G;  3I9W A;  4MBQ A;  3EHZ A;  3SIO A;  2CM0 A;  2ACZ A;  3A7M A;  3CVR A;  4A5X A;  3JAD A;  3RQW A;  2Y48 B;  4ERR A;  3WAJ A;  2QRX A;  3KVA A;  3JCF A;  4H9O C;  2NOX A;  3LG7 A;  5L2L A;  3A8Y C;  5JDL A;  1HR0 T;  2WDV A;  1Y64 B;  5HEG A;  2LJL A;  2CBJ A;  4H9S E;  3AE6 A;  1B7T A;  3ZN1 B;  1YXR A;  2ZJV A;  2K9A A;  2L8K A;  2DI4 A;  1SUM B;  3UUN A;  1AJ3 A;  2K5B B;  4X1K E;  2YMD A;  3N9M A;  5KX5 E;  3FBZ A;  2UXX B;  2BBH A;  3AXJ A;  4YSY A;  1MMG A;  5ABF A;  3AEA A;  4XHE A;  3MXZ A;  3HA4 A;  4CI3 B;  2EHO C;  3HKE E;  1CHU A;  3AEB A;  3AEF A;  3U3I A;  3WTJ A;  5L3F B;  3KV4 A;  4YHJ A;  2CEA A;  5E0O A;  3ZDH A;  2K3W A;  3KV5 A;  2WWV A;  1I6Z A;  5FKY A;  1MMN A;  4UY2 A;  1UCU A;  4QX7 B;  1MNE A;  5KXJ A;  2CWY A;  3GA8 A;  3GWH A;  2YN6 A;  2YME A;  2CLY C;  2A3D A;  4JI6 T;  3FB2 A;  2V7K A;  2WB5 A;  3ZCI A;  2DCF A;  3MK7 C;  2BYP A;  3U78 A;  4UM3 A;  1E1H B;  4ZRU A;  3CQC B;  2E9X C;  1YQ3 A;  2JQ9 A;  3U8L A;  4AI6 A;  1UW6 A;  1NEK A;  4TV9 E;  1N34 T;  3IHR A;  4ZI3 C;  3Q5E A;  5DQV A;  3F2E A;  4GIW A;  3SFD A;  3ZT5 A;  1KF6 A;  3RF1 A;  3ETU A;  3ZT7 A;  4HE8 A;  1QLB A;  3P50 A;  4AKR B;  2NW7 A;  3AA7 B;  2BR8 A;  2WQY A;  4B3T T;  4HFI A;  5L3B B;  2RP4 A;  2W0G A;  5AFK A;  4L9I A;  2LRL A;  3F57 A;  1XNQ T;  4JI0 T;  1ZV4 X;  4QHO A;  2KSR A;  3Q5X A;  1UK5 A;  2X00 A;  3Q5D A;  5BMV E;  5IYZ E;  1LKX A;  2V6Y B;  1W0A A;  1N33 T;  2FJE A;  5LBM A;  2JJ9 A;  3ABV A;  2Y6X A;  3WTM A;  3RYF E;  3WTL A;  2LKG A;  1J1J A;  1M62 A;  4IHJ E;  2JMK A;  2E5L T;  5H6Q B;  5AQL B;  2IAK A;  1T8B A;  1FMV A;  5JRC B;  2BVM A;  3CQG B;  3UUM A;  4IRE A;  3KV6 A;  4HTE A;  3CPZ A;  4CXY A;  2LRK A;  3AE8 A;  4TN7 B;  1UGO A;  3MA9 A;  4FRR A;  4YJ2 E;  3T1H T;  3OVU A;  4PK6 A;  3I0Q A;  1NEN A;  4UXU A;  2QVA A;  1IJ5 A;  4LF8 T;  2XAJ B;  3N2O A;  4PNI A;  1SA0 E;  4DR4 T;  4GYR A;  4DMV A;  2FJA A;  2K48 A;  3PJA J;  3ZN0 B;  5AFN A;  3ANW B;  1OWA A;  4IL4 A;  4LML A;  2WN9 A;  3SOL A;  4F6R C;  3S4U A;  2I0M A;  3H37 A;  5KZU A;  3TLW A;  1WYC A;  4QWN B;  5DQW A;  3WI3 A;  1IJ6 A;  2XM1 A;  4PAG A;  5AQH B;  4DUZ T;  3KFW X;  3B5M A;  3AE7 A;  5LXT E;  1IBK T;  3ETV A;  1JNZ A;  2LSG A;  4EB6 E;  2Y56 A;  3U8K A;  3SQ6 A;  2MAW A;  2V26 A;  4IDQ A;  3N9L A;  4XZC A;  2QGS A;  5J5H A;  1YW0 A;  2LHN A;  4PJL A;  2LM2 A;  1VRB A;  4O4H E;  5LGU B;  3H3M A;  3IA3 A;  4EOZ B;  4YTN A;  4UEL A;  3O1I A;  2H7V C;  2BS2 A;  5FNV E;  4EXT A;  2R6G F;  5AIN A;  3AEE A;  4I43 B;  2J4G A;  4AQG A;  2XSB A;  3B57 A;  2X0H A;  4AIS A;  3D0T A;  4TX5 A;  4DID B;  1WR6 A;  2VKO A;  3RYH E;  4XBF B;  4JI3 T;  2VVS A;  4HFE A;  4X5T A;  5KMG P;  4BJM A;  3TLV A;  3K3N A;  2PGZ A;  5EK3 A;  1VCS A;  4ZXL A;  4I4T E;  4LFC T;  2Y57 A;  2LSK A;  3UU3 A;  1XDO A;  5KDM C;  5IUX A;  3IF8 B;  5ABH A;  1KNZ A;  2V7I A;  2LE8 A;  4ZI2 C;  2I6H A;  5LP6 E;  2YU2 A;  4A97 A;  4WBO A;  4UVB B;  5L3C B;  5AQO B;  1OED C;  3ZDG A;  1HCI A;  4AXP A;  3ONJ A;  2V5C A;  2X0L B;  4Z91 A;  4I55 E;  3PTR B;  4YTP A;  3FXD B;  3RGL A;  5LXB A;  3LDQ B;  4DV5 T;  2W67 A;  5AQQ B;  2DWG A;  3UFE A;  2Y7Y A;  3N9P A;  5BW2 A;  4WBN E;  3RH3 A;  4EYU A;  4HWC A;  3BQI A;  2BG9 B;  3B13 A;  4YSZ A;  4LF4 T;  2F4V T;  4O2A E;  1XMO T;  5ABG A;  1UX4 A;  4DR1 T;  4IST A;  3ZYK A;  3NZQ A;  4QXB B;  2JQQ A;  4X66 T;  3OTO T;  3V5U A;  2IC6 A;  1T7S A;  4ILU A;  1T72 A;  2UXD T;  1LVK A;  4QXH B;  3QNU A;  3N9O A;  3I9Y A;  5AQS B;  3EUH A;  4FJO A;  3QC9 A;  2E5V A;  4IE5 A;  4UV9 B;  2LT3 A;  3MZK B;  4ANJ A;  3UUL A;  3DTO A;  4QAC A;  5L4H A;  2W66 A;  1U4Q A;  2XQ5 A;  4TV8 E;  5L47 A;  1KK7 A;  4ILB A;  5HXH A;  3CK6 A;  3P4S A;  2ES0 A;  5JR9 C;  4KX6 A;  4ALX A;  4TWH A;  4JI7 T;  4AFG A;  4PJM A;  4JI4 T;  4O8S A;  2JPF A;  3DJB A;  3C4W A;  4HQP A;  2JIW A;  4A56 A;  5LG3 A;  4AFH A;  2E9X B;  2CMR A;  4NZB A;  5J2U E;  3O4X E;  3ZMS B;  2IIU A;  1WR0 A;  4ZR6 A;  2DNX A;  2BG9 C;  5C8Y E;  2KWH A;  2D5U A;  3PDY A;  2N2N A;  4BQT A;  5EK4 A;  4EEB A;  3ZMU B;  3PUZ F;  3IGQ A;  2FJD A;  5J0Z A;  5HAX A;  1BR1 A;  4AIU A;  2C9T A;  3K3Q C;  1IBL T;  2IW5 B;  2EHO B;  3O1H A;  2KIN B;  3JC6 D;  4TUY E;  2BS3 A;  4HFB A;  1MIW A;  2CA5 A;  4B3S T;  2YK0 A;  4BAY B;  3E22 E;  2DHR A;  4NXN T;  2XQY A;  1FEW A;  3WAK A;  3KV9 A;  2NW8 A;  3WTN A;  4EZH A;  1J5W A;  3LBX B;  3CKD A;  3VRA A;  5LHI B;  4OX9 T;  4CI2 B;  4N78 D;  5HXC A;  2V6Y A;  2YKS A;  3HKD E;  3AVS A;  4IT4 A;  4KUM B;  5EZY E;  4QH4 A;  3GUA A;  5CJ5 A;  3P4W A;  5CA1 E;  4NUU A;  1WCR A;  2XNU A;  2M6B A;  3NZP A;  1E7P A;  2WMN A;  4B3M T;  3N9N A;  5IHY A;  4EZ4 A;  2KXP B;  2HPJ A;  4AQY T;  2CE7 A;  4WYV A;  3PUA A;  2BG9 A;  2A72 A;  5FYM A;  4HWF A;  3BK9 A;  4I50 E;  2WAU A;  4UR9 A;  4HKA A;  2DLR A;  5AFM A;  4OYJ A;  3CX6 B;  1XMQ T;  4D01 A;  4JI8 T;  5LJM A;  2ZJU A;  1VCT A;  3E08 A;  3UQ7 A;  5JQG E;  1FJG T;  2W00 A;  3AVR A;  4HFV A;  2BYR A;  4P09 A;  2FBW A;  2WBL A;  1M7K A;  3C50 A;  4DV6 T;  2HHH T;  4H63 H;  2YU1 A;  3QUJ A;  3PUV F;  3AE5 A;  2ZM8 A;  2I59 A;  2SPC A;  4LMK A;  2V5D A;  2ZLY A;  3UUX B;  5TAO A;  1UUR A;  2ODU A;  1N36 T;  1BR2 A;  3NRX A;  4Z8X A;  5J5G A;  2PBI A;  2VQE T;  1IAP A;  5C2T A;  2X68 A;  2NR4 A;  5LMN T;  2QC1 B;  2ODV A;  3UTK A;  4YTM A;  3WTH A;  3ZMT B;  5JDN A;  4HWD A;  5HWY A;  3ZJ1 A;  3NVO A;  3VU7 H;  5FP3 A;  4YJ3 E;  4UIG A;  5FXX A;  3RC3 A;  2WNL A;  1YQ4 A;  2JQH A;  2MOZ A;  5SYO A;  4YSX A;  4AKG A;  3RI5 A;  3ANW A;  5J1G A;  3Q5W A;  4B3R T;  2G0U A;  4CN6 A;  4UM3 P;  4BJN A;  2CWO A;  2BKP A;  4WW0 A;  5EK2 A;  2W8G A;  4IE0 A;  5HEU A;  4UXN B;  3EI0 A;  5CGM A;  4PK4 A;  2BDE A;  4JEH B;  5JME A;  2CHO A;  5AFU L;  3M3Z B;  3O9X A;  1OED A;  2XPK A;  1D0X A;  2VB6 A;  2V1D B;  1XWM A;  2KMF A;  1W9R A;  4K0K T;  2WSS V;  3TLT A;  5AQT B;  1HNX T;  1S94 A;  4QH1 A;  4U3C A;  4UF0 B;  3VKH A;  2D0U A;  4CN1 A;  3MJX A;  3L8R A;  2BZB A;  4M1P A;  5L4E A;  1WRD A;  2PTF A;  3U8J A;  2W63 A;  3F31 A;  3ONX A;  3LFM A;  2XAH B;  4UM3 S;  2XQ4 A;  2VKJ A;  3VRB A;  4EGW A;  1LVF A;  5ETW A;  3UU6 A;  2Y54 A;  2V7L A;  2XNV A;  5C3J A;  3PJA A;  4H9N C;  3RHW A;  4DV1 T;  4X20 E;  4C91 A;  3NWI A;  4HEA A;  5FY7 A;  2PJQ A;  4U7Y A;  4AKI A;  2UZ6 A;  2CHN A;  4EYY R;  4DVD A;  4HN9 A;  4DR5 T;  3PUS A;  2LKH A;  2VKH A;  3HL6 A;  4ILC A;  3C98 B;  5HYA A;  2LLY A;  4IDO A;  4PJN A;  2FUP A;  1EZ3 A;  4U31 A;  4H9R C;  1SE7 A;  3PUW F;  1FIO A;  5ABE A;  2H3R A;  4DO0 A;  2XZ6 A;  2WU2 A;  4Z90 A;  5BRX A;  4GYS A;  3RKG A;  5LMU T;  4KBM B;  1DU2 A;  2ACX A;  2XAS B;  4WV9 A;  2BYN A;  2PG8 A;  3K3O A;  2X9H A;  2X9W A;  1HFA A;  5AQK B;  5JDQ A;  5LJN A;  3JC6 C;  1S35 A;  4U7I A;  2LM9 A;  3OPC A;  4XK9 A;  2UXB T;  2IC9 A;  3ZEF B;  4NIQ A;  3SRZ A;  3RC8 A;  3P4Q A;  4KHZ F;  2EHO D;  2XQ6 A;  2XAF B;  4EZ1 A;  1HG5 A;  4X1Y E;  1D1A A;  4K0U A;  5JR9 B;  2C5J A;  3PV0 F;  1FMW A;  1UX5 A;  3O1J A;  2HN2 A;  4X65 T;  5HXR A;  2H89 A;  4TNV A;  4ZI3 D;  2BG9 E;  4P0A A;  1U5P A;  4LF7 T;  1BR0 A;  4X64 T;  2W61 A;  3LK3 B;  4U72 A;  3LBX A;  4G63 A;  4UVC B;  5CO5 A;  3ZJ2 A;  1H7C A;  3AAE B;  3ZLI A;  4P1N A;  2NWB A;  5LNK A;  3RQU A;  2D9D A;  3RYC E;  2HPL A;  4AKL A;  4DV2 T;  3AAI A;  4DBM A;  1HG2 A;  3CIR A;  3E0Z A;  1UV6 A;  2Q9Q C;  2FJB A;  4UF0 A;  5AQI B;  3PMZ A;  5FL0 A;  5JDF A;  5FXW A;  4OK0 A;  2WDQ A;  2VK9 A;  1SHZ C;  2VWA A;  3CX7 B;  3NRY A;  5JRE A;  4PFP A;  3G06 A;  1ZKE A;  2WM9 A;  2LOS A;  4JYA T;  2P9B A;  4ILA A;  2BS4 A;  2J47 A;  4LMJ A;  2PH9 A;  3EVY A;  4HFD A;  4LFB T;  4F8H A;  2BJ0 A;  2MTQ A;  4ZK4 A;  1HX8 A;  2ZM2 A;  2W8F A;  4EV6 A;  5J5F A;  3FZK B;  3P4P A;  1JNR A;  3UUB A;  5L3D B;  1IZN B;  3R84 B;  3J9X 1;  1US7 B;  4I0U A;  3RIF A;  4O4J E;  3VR8 A;  5HEH A;  3KIN B;  4IDN A;  4DV0 T;  3AA6 B;  1D1C A;  2B76 A;  2WZI A;  4H9Q C;  2E8I A;  4QAB A;  2CPT A;  4IE7 A;  4DUY T;  4O4L E;  3HKB E;  3ZMV B;  3W15 B;  4MAL A;  2C5K T;  2W62 A;  2MBG A;  2CXL A;  3BQL A;  4GOU A;  1XNR T;  4KMC A;  3PUQ A;  4QXC B;  2L9Q A;  2CBI A;  4LF9 T;  2X66 A;  5LGT B;  4ZOL E;  3ZSS A;  2HH7 A;  4YXD A;  4C90 A;  3ZT6 A;  4FI5 A;  4JLE A;  5AFM B;  4O4I E;  1OED E;  1L0V A;  4ADZ A;  1KEY A;  1E2A A;  3U8N A;  3ZC0 A;  3VKG A;  3N2K E;  5LOV E;  1X79 A;  3ONL C;  3ZKR A;  1R8I A;  3RRC A;  3EAB A;  2M67 A;  5DAB A;  2LHR A;  3L09 A;  3AAA B;  3OYZ A;  2UUB T;  4TNW A;  4GK5 E;  5LGN B;  2B1E A;  2N1G A;  1O3X A;  4JV5 T;  2VQF T;  2LSY A;  3GN5 B;  3FHN A;  4EED A;  2CXF A;  3Q2M A;  5JDH A;  3KBT A;  4PIR A;  1YKE B;  3A5X A;  3HKC E;  2VL0 A;  5AQG B;  4CZZ B;  2Y58 A;  4JBW F;  1QUU A;  3ZYM A;  2UXN B;  1IBM T;  3WIP A;  3X1D A;  2KZ7 B;  4G2A A;  4YFS A;  5FY1 A;  2WY2 A;  5HCM A;  3N9Q A;  4ZI7 E;  1ZEE A;  2WMO A;  5JDM A;  5IWA T;  2C0S A;  4DR7 T;  1Z0P A;  5AFH A;  2E9X A;  1UUS A;  3GN5 A;  4L5G A;  4UM1 A;  3SH1 A;  5F3J A;  1HS7 A;  3RRW A;  5GON E;  2UU9 T;  1MMA A;  3C4X A;  1KNR A;  2YOE A;  3C79 A;  4EAH A;  2WNC A;  4DV7 T;  5AQF B;  5AQV B;  2CCQ A;  4ZHQ E;  3U8M A;  5AQR B;  5FMN A;  5FVK A;  3ZC1 A;  5H6R B;  4U33 A;  4U2Z A;  4JEU B;  4CN4 A;  4HWI B;  3PUG A;  3PU8 A;  3CQX C;  2Q9Q A;  4PW8 A;  3AE9 A;  2XSA A;  3FZH B;  2N9D A;  3UQ4 A;  2UUC T;  3RX6 A;  2H88 A;  1UX2 A;  2YDS A;  1GQE A;  3K1S A;  3H3A A;  2NTX A;  2DL1 A;  1Y01 A;  3VR9 A;  3I0O A;  4V1A v;  2V6X A;  4ISS A;  4IE4 A;  2Z6E A;  3LK2 B;  3AE2 A;  2HN1 A;  3N5L A;  2D0T A;  3PUR A;  4CQI A;  3SFE A;  2JQK A;  3SQ9 A;  1X9B A;  2WP9 A;  4OYK A;  3C4Z A;  3P4R A;  4OHF A;  2OA5 A;  3SS1 A;  4DND A;  4ZS3 A;  3TLS A;  4ZJT A;  3AEC A;  2QYW A;  2WU5 A;  1I9B A;  5LCY A;  4JI2 T;  3ZMZ B;  3PEO A;  5LHG B;  3WTK A;  3EAM A;  2WZH A;  4LFA T;  2DWK A;  4IL9 A;  2XQA A;  4LF5 T;  4IDZ A;  2V8S V;  5TVC A;  2YIN A;  3AA1 B;  4U2Y A;  5M4Y A;  2XAG B;  5LG4 A;  2J62 A;  2XZE A;  5HWX A;  2LEH A;  3TKL B;  4YT0 A;  2X00 D;  3QOF A;  5AQN B;  1W0B A;  2KWI B;  3T4M A;  4H63 V;  3AE4 A;  4AKH A;  2MPK A;  1D0Y A;  4QX8 B;  1WFD A;  3EDV A;  4ZS2 A;  1I94 T;  1HNW T;  3L39 A;  4CI1 B;  1NWM X;  4J2C A;  4QAA A;  4TZ4 C;  4NUV A;  3RYI E;  4CXX A;  4A98 A;  2LOP A;  4KI0 F;  3SWH A;  3V5S A;  5L3E B;  3UU8 A;  2YDQ A;  4HFH A;  3FZL B;  1MND A;  4HFC A;  3QB5 K;  1HX1 B;  2M6I A;  3HR0 A;  3NBX X;  3ZCJ A;  4DMW A;  5F5W A;  5ADX L;  2XTL A;  2UXC T;  2LSJ A;  4YY3 T;  4UEM A;  3PUX F;  3PE0 A;  2AXD S;  4HGA A;  3KVB A;  4AFT A;  3NKZ A;  5AQU B;  2WS3 A;  2A2F X;  4WZX A;  5AFJ A;  4H9P C;  4DV3 T;  3KBU A;  2KND A;  3RIU C;  5ABF B;  4TWF A;  3AB3 B;  3ZYL A;  5JRC A;  1G73 A;  3N2G E;  2E9X D;  2Q9Q D;  5HCJ A;  2LSI A;  5FVL A;  3LSV A;  4PJJ A;  3OKQ A;  1LRZ A;  2WDR A;  2BVL A;  4ZJS A;  4IGU A;  5HEJ A;  4UVA B;  3T8O A;  4MLK A;  3FZF B;  2BKN A;  2Q9Q B;  1MIY A;  2ZM0 A;  2XAQ B;  4E7Z A;  4GK0 E;  2BYS A;  5BR8 T;  1ZOY A;  3KDS E;  4JI5 T;  3UT5 E;  3M65 A;  2ZM6 T;  1XZY A;  3C51 A;  5HEO A;  5LA6 E;  4DR3 T;  3WTI A;  2XQ9 A;  5J5I A;  2RPA A;  4MFR A;  5KE4 A;  4ASK A;  2PFV A;  1BR4 A;  2A9U A;  4AQF A;  4ZZC A;  3AA0 B;  4BA9 A;  2XY8 B;  2NW9 A;  2YDR A;  2W2U A;  4DR2 T;  4DBQ A;  5FXV A;  2CLY B;  2MYS A;  2OLT A;  1ZP0 A;  1KFY A;  1YKH B;  4E7S A;  2E2A A;  4IE6 A;  2H7O A;  3CWZ B;  5JH7 E;  4QKN A;  3FZM B;  1MIV A;  4X1I E;  5JVD E;  3P8C D;  2K24 A;  1G8X A;  4JI1 T;  2JRK A;  2IDO B;  3MAC A;  4O2B E;  2D2S A;  3ESL A;  3FBL A;  3UU5 A;  5LYJ E;  3JAF A;  2XQ3 A;  3RIU A;  5L3G B;  4XAX B;  3ZPO A;  1HTJ F;  4EIW A;  5FXZ A;  5AQM B;  2IML A;  2XQ7 A;  1D0Z A;  4Q25 A;  2XJ7 A;  5F8P A;  3PU3 A;  4OFZ A;  3C64 A;  4YHH T;  4QH5 A;  1ZHC A;  3R6N A;  2J1D G;  2NTY A;  3Q9D A;  4YLH A;  1CUN A;  5HXE A;  1OED B;  3UU4 A;  1XDP A;  3RLF F;  3AE3 A;  3OJA A;  3LJC A;  1W09 A;  2C5I T;  4ZEY A;  2IHR 1;  3CML A;  1V9D A;  4MHC A;  4U74 A;  3C84 A;  4ZI2 D; 
#chains in the Genus database with same CATH homology
 3WTI A;  4TNV A;  2Y57 A;  5L4E A;  4A98 A;  2XQ9 A;  5J5G A;  3UU3 A;  4QAC A;  4ZK4 A;  3WTN A;  2BG9 E;  4PIR A;  5J5I A;  3U8J A;  2VL0 A;  5L4H A;  3UU8 A;  4TWD A;  2W8F A;  5KE4 A;  5IUX A;  2XQ5 A;  4HFH A;  5J5F A;  2Y58 A;  2QC1 B;  4ZZC A;  4UM3 S;  5AFN A;  4HFC A;  5L47 A;  2YKS A;  3JAE A;  4ZK1 A;  2M6I A;  2XQ4 A;  5BP0 A;  3UUB A;  2ZJV A;  3P50 A;  4ILB A;  2BR8 A;  4IL4 A;  3WIP A;  4QH4 A;  4LML A;  3GUA A;  4B5D A;  3WTH A;  4NPP A;  4HFI A;  4A97 A;  3UU6 A;  3P4W A;  2Y54 A;  3SQ9 A;  3RIF A;  5CFB A;  2WN9 A;  2XNV A;  4ALX A;  2YMD A;  5HEH A;  4TWH A;  3RHW A;  2WNJ A;  1OED C;  5CO5 A;  3ZDG A;  4AFG A;  5AFK A;  2XNU A;  2M6B A;  5HCM A;  3WTO A;  5KZU A;  4Z91 A;  5FJV A;  4QAB A;  4AFT A;  3TLW A;  2UZ6 A;  3RQU A;  3TLS A;  5LXB A;  2XZ5 A;  4XHE A;  2WNL A;  5AFH A;  5AFJ A;  4HQP A;  4ZJT A;  2LKH A;  3RIA A;  4DBM A;  4ILC A;  2Y7Y A;  4UM1 A;  3SH1 A;  2LLY A;  2BG9 A;  1I9B A;  2BR7 A;  5LG3 A;  5BW2 A;  2KSR A;  4TWF A;  5SYO A;  4COF A;  4BFQ A;  4AFH A;  2X00 A;  1UV6 A;  3PEO A;  4NZB A;  3WTK A;  2BYQ A;  3RI5 A;  3EAM A;  2BG9 B;  2XYT A;  2Y56 A;  3U8K A;  2XZ6 A;  3SQ6 A;  2MAW A;  2YOE A;  3C79 A;  3WTJ A;  3WTM A;  3UU5 A;  4Z90 A;  3WTL A;  5BRX A;  2WZY A;  5J5H A;  3JAF A;  5HCJ A;  4ZR6 A;  3ZDH A;  3PMZ A;  2LKG A;  2XQA A;  4IL9 A;  4UM3 P;  2WNC A;  3LSV A;  2XNT A;  2XQ3 A;  5AFM A;  2LM2 A;  2BG9 C;  2W8G A;  4WV9 A;  5TVC A;  2BYN A;  5HEU A;  4UY2 A;  3U8M A;  4ZJS A;  4D01 A;  3EI0 A;  5HEJ A;  3EHZ A;  2XQ7 A;  3SIO A;  5AIN A;  2ZJU A;  5AFM B;  1OED E;  4BQT A;  2YN6 A;  3UQ7 A;  2XYS A;  2X00 D;  2YME A;  4IRE A;  3IGQ A;  5JME A;  4QH5 A;  3U8N A;  5J0Z A;  1OED A;  4XK9 A;  3JAD A;  2BYR A;  3RQW A;  3T4M A;  2BYS A;  3ZKR A;  4ILA A;  3TLT A;  2C9T A;  4LMJ A;  2XQ8 A;  5AFL A;  2BYP A;  4QAA A;  3UQ4 A;  4QH1 A;  4FRR A;  4HFE A;  2XQ6 A;  4X5T A;  2PH9 A;  4HFB A;  4UM3 A;  1UX2 A;  4EZ1 A;  1OED B;  3UU4 A;  4ZRU A;  4TNW A;  3TLV A;  2PGZ A;  4UXU A;  3U8L A;  4LMK A;  4HFD A;  4ZZB A;  1UW6 A;  5HEG A;  4F8H A;  3TLU A;  3C84 A;  2BJ0 A;  5HEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...