4IREA

Crystal structure of glic with mutations at the loop c region
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
312
structure length
312
Chain Sequence
b'MVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVNISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALQNRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Signal transduction pathways in the pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 88
structure length 312
sequence length 312
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ireA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ireA01
5AFHA 5J5IA 4QH4A 5AINA 3TLVA 2QC1B 4LMLA 3SH1A 3U8KA 5BP0A 2BYQA 2WN9A 3UQ7A 4DBMA 5L47A 4UXUA 5BRXA 2BG9A 3JADA 5HEJA 2PH9A 2WNJA 5SYOA 3WIPA 2BYSA 4HFEA 2YOEA 5FJVA 3P4WA 3UU8A 3WTKA 2W8FA 2Y58A 4ZJSA 3TLTA 2Y54A 5LG3A 4IL9A 3RIAA 2BJ0A 2XQ5A 4F8HA 2W8GA 5L4EA 4ZK1A 5AFMB 4EZ1A 4UM3S 4UM3P 5HEGA 4ZK4A 2X00A 2WNCA 4XHEA 2YMDA 2VL0A 4HFHA 4IL4A 2BR7A 2Y7YA 3GUAA 2M6BA 4ZRUA 3WTJA 4D01A 5AFMA 2BG9B 5KE4A 4ALXA 4ILBA 3RQWA 4PIRA 3WTMA 5HEUA 1OEDB 3JAFA 4QACA 3U8NA 4ILCA 5LXBA 4WV9A 4QH5A 3JAEA 3EI0A 4IREA 2M6IA 3RQUA 5J5HA 3WTOA 4X5TA 5IUXA 2Y56A 4HFBA 4Z90A 3RI5A 3PMZA 2C9TA 1OEDA 2YMEA 4XK9A 5BW2A 2YKSA 2XQ6A 3P50A 4TNWA 5HEOA 3UU4A 3UU5A 1I9BA 3ZDHA 2X00D 4FRRA 3TLSA 3ZDGA 4ZZBA 2XZ5A 5HEHA 4BFQA 2BYNA 4ILAA 4BQTA 2XYTA 2BG9E 5JMEA 4LMKA 1OEDE 5CFBA 4TWHA 4ZJTA 4A97A 3U8MA 2ZJVA 2XQ8A 3WTLA 3ZKRA 3TLUA 3WTIA 3UUBA 2XQ4A 4NZBA 3C84A 3PEOA 4UM1A 4TNVA 2MAWA 2LM2A 3U8LA 2BG9C 2BYRA 3UQ4A 4QABA 4NPPA 4COFA 2XQAA 5CO5A 3WTHA 3IGQA 2PGZA 2BYPA 2Y57A 3C79A 5AFKA 1UW6A 2LKHA 3UU3A 3UU6A 2ZJUA 2LLYA 4HFDA 3RHWA 2XYSA 2XNUA 3T4MA 2XQ3A 4Z91A 2XQ9A 5HCJA 2LKGA 4UY2A 4LMJA 4AFTA 3LSVA 5L4HA 1UV6A 3SQ9A 2UZ6A 5KZUA 4UM3A 3WTNA 2XQ7A 2BR8A 5AFLA 5J5FA 3EHZA 3RIFA 4QAAA 4AFGA 2XNTA 4A98A 4ZZCA 2YN6A 5J0ZA 5HCMA 3EAMA 5AFJA 3SQ6A 1OEDC 4TWDA 4QH1A 4AFHA 2KSRA 2WZYA 2XNVA 3U8JA 4HQPA 4HFCA 4B5DA 4ZR6A 5AFNA 4HFIA 3SIOA 4TWFA 5TVCA 5J5GA 2XZ6A 3TLWA 2WNLA 1UX2A
chains in the Genus database with same CATH superfamily
4ZI3C 4B3RT 2QC1B 3P4PA 1HS7A 5L3FB 4YFSA 4KMCA 3UU8A 1WYCA 1WR0A 1IJ5A 4ZI7E 5LGNB 2LHNA 3GUAA 1WFDA 4ZRUA 2WDQA 4ALXA 4TV8E 1UK5A 3ZCJA 1J5WA 3AVSA 4JI8T 2Y56A 4PJJA 4XK9A 2XQ6A 3UU4A 3PUZF 3F57A 3K3QC 5LGTB 3ZDHA 1ZV4X 3I9YA 3VR8A 3OJAA 5DABA 4U33A 5ABHA 2XYTA 2BG9E 1FMVA 4UXNB 3BQKA 3FZMB 2MTQA 2YINA 5FXVA 5LJNA 3UUMA 4O4LE 2DLRA 1UW6A 4WBNE 3GWHA 3UU6A 5LMNT 2LLYA 3T4MA 2XAFB 4XAXB 1V9DA 2XAGB 1ZOYA 3WTNA 4YSXA 3DTOA 4TWDA 4U7IA 4CXWA 3TKLB 4AXPA 2C5KT 3N9QA 5KX5E 4JI7T 3SIOA 1IBMT 2ZMAA 2XZ6A 4OX9T 2XJ7A 3U8KA 5BP0A 2BYQA 1XZYA 2FUPA 5L47A 3CKDA 2X9YA 5SYOA 2V7KA 2Y8DA 3RF1A 4IGUA 3ETVA 4UF0B 5J1GA 1HNXT 4TZ4C 4ZK4A 2YMDA 2XQYA 3HKEE 2CE7A 5AQRB 3AE7A 3N2KE 2Y6XA 3EI0A 2IC9A 2WP9A 3ZMSB 1UGOA 1YD8G 4M1PA 4DR3T 2MPKA 2VVNA 4DIDB 4V1Av 2XZ5A 4B3TT 3CQGB 3OYXA 4ILAA 2E9XC 1SE7A 2LOSA 3F31A 4U3CA 4AIUA 2BZBA 1MMAA 4IE5A 3IEEA 2L8KA 2BVLA 2LSKA 2LKHA 4Z91A 2WAUA 5AQGB 4PAGA 3QB5A 3UFEA 2IAKA 2OLTA 5JTGA 2IHR1 2CXFA 3HR0A 2JQQA 4ERRA 2ZLYA 3HKDE 4HFIA 4JI5T 4QH4A 1UUSA 4HTEA 2KMFA 1ZP0A 1UX4A 2JQ9A 3FB2A 1HTJF 4CN1A 4CXXA 5H6QB 2CBJA 4JI3T 3H3AA 5LJMA 5HEGA 3C4WA 4P1NA 3AE2A 2BR7A 4O2BE 3OPCA 5KE4A 3JAFA 3QNUA 2XHEB 4QH5A 3AAAB 5DJQC 2BBJA 4UIGA 4IT4A 2W0GA 2V1DB 4EOZB 3MKDA 4QXCB 4DO0A 4BFQA 2BYNA 4BQTA 2XY8B 4H9QC 2KLQA 5HWYA 3ZT6A 2MAWA 5GONE 3PE0A 2JJ9A 3UQ4A 3ZCIA 4WYVA 3ESLA 2JPFA 2NW7A 3ZYKA 3PUQA 3AA1B 3I9WA 2D5UA 4YXDA 2VURA 5JDFA 5AQLB 2YN6A 2EHOC 4ZI2C 5LP6E 2ZM2A 4YHHT 5BR8T 5KMGP 4X66T 5J5IA 5EK2A 4DUZT 4B3ST 4UXUA 4EAHA 2E5VA 3WIPA 1KNRA 4ADZA 4JI6T 1XMOT 1HNZT 2WWVA 4TN7B 3N9OA 1SUMB 3WAJA 1YKHB 2H3RA 4DR4T 2W8GA 4K0UA 3CQCB 2LHRA 3AE8A 4IE0A 4QWNB 5AQSB 3RQWA 3NBXX 4GK0E 3AEFA 4UV8B 3RQUA 4KX6A 5CJ5A 2D2SA 1KF6A 4AKLA 3N9MA 5IWAT 2WZIA 2IUBA 2WU2A 4JI0T 1ZKEA 4X1IE 3R6NA 3TLSA 2V6XA 2VWAA 2XTLA 4WZXA 5JMEA 1IJ6A 4NUUA 2W66A 4GIWA 2X51A 5LHGB 2CHNA 1N32T 2LRKA 2QVAA 3L39A 4TNVA 3U8LA 2LRLA 4QABA 3EUHA 4COFA 2FJEA 2KNDA 3Q5DA 3C79A 3L09A 2XYSA 4ZS2A 2XNUA 2IC6A 3M65A 5L4HA 1XDPA 1T7SA 5E0OA 3NRYA 1UURA 3HKBE 5AQQB 3AE9A 4ZR6A 4IDPA 2V6YA 3FZLB 3J7Yq 3TLWA 4AKIA 4JUYA 2A2FX 5AINA 2CHOA 4LMLA 3O4XE 2X68A 3RC3A 1OXZA 1T72A 3RIAA 3AE4A 4DR2T 5C3JA 3PUVF 3RYHE 5FXXA 2HPLA 3FBLA 4PK5A 4DV6T 3AE3A 4ISSA 4QACA 4NXNT 5LXBA 5LG4A 2XASB 2C9TA 2WSSV 2YKSA 4O4HE 3CIRA 3UU5A 3IA3A 1I9BA 2CBIA 4QX7B 2V7LA 3P4QA 4ZZBA 3NRXA 3G06A 3PUYF 5L3CB 5FVKA 1WRDA 2BBHA 4BJNA 2ZJVA 4YY3T 4BAYB 3WTIA 4ZHQE 4JEUB 2LJLA 4X62T 1MNEA 3PJAJ 3J9X1 2XQAA 4AKHA 1T98A 1EZ3A 3OBVE 3LDQB 2C5JA 2J1DG 2X67A 3VRAA 3LBXA 2HN1A 2XQ3A 3ZMUB 4AFTA 1XNQT 2XQ7A 5AFLA 3AECA 1Y64B 4A98A 5HCMA 2WZHA 3JCFA 2BS2A 1G8XA 3A5XA 4KBMB 5JVDE 4UEMA 4ASKA 4TWFA 2NR4A 1D1CA 2I59A 3SS1A 3H37A 5LBMA 2K9AA 4MFRA 3CX7B 3UQ7A 1US7B 4CQIA 4BJMA 2BG9A 2WNJA 3N2OA 4KP3C 4KI0F 1SA0E 2V7JA 2CXLA 3MACA 5FY1A 2LM9A 2Y54A 3T1HT 4XZCA 4UM3S 1JNRA 1HX1B 3O1IA 2PBIA 3E22E 5HXHA 5JDMA 2J47A 1MIWA 3LK42 1VCTA 2X9HA 2RPAA 2CA5A 4ILCA 4WBOA 4WV9A 3Q2MA 4IIJE 1YW0A 1OEDA 3ZSTA 3GMIA 4QXBB 4AISA 3UFGA 1I94T 3RIUA 4U72A 4MALA 4FRRA 2A9UA 1FMWA 3OVUA 4IE4A 5JRCA 2L3LA 1WCRA 2A3DA 4L9IA 2G0UA 3BK9A 5TAOA 3GA8A 2BYPA 4EV6A 3L3PA 1N34T 2KWIB 5LMUT 4LF5T 4YT0A 1D0XA 3GN5A 5ABFB 1Z0PA 3OTOT 2W00A 3PU3A 4FJOA 4LFCT 2XZEA 3EHZA 1MIVA 1MIYA 4U31A 2X9XA 3SQ6A 3AEDA 2PTFA 3QC9A 4OYJA 3P4SA 2DHRA 2ACZA 2E5LT 1E2AA 3PUGA 3AA7B 5LHIB 5DQVA 1IZNB 4PK6A 2LSIA 4HFEA 5FJVA 2W8FA 2Y58A 3CX8B 4XBFB 2YDRA 2E9XB 4GOUA 3RRCA 3OYZA 4TUYE 2BDEA 2IDOB 3S4UA 2W67A 3WTJA 5BMVE 4ILBA 4YHJA 3NWIA 2Q9QD 4I55E 3JAEA 4LF6T 1D0YA 3UULA 5J5HA 4GYRA 4TV9E 2X66A 3ZMTB 2E2AA 1QSDA 4G63A 4KHPT 4C91A 1KNPA 3AAIA 5JDLA 4I43B 3N9PA 3ZEFB 3AEAA 2QYWA 3PUSA 4YTPA 4P09A 4TWHA 1W09A 3AEEA 3CK6A 2NTXA 3EDVA 3KV4A 1MMDA 2FBWA 5EK4A 2VQET 2V7IA 4QX8B 3RHWA 5JQGE 2L9QA 2XQ9A 3ZJ2A 3M3ZB 3LSVA 1X79A 3RPUA 3ZMVB 2YU2A 5IHYA 5HYAA 1D1AA 2VQFT 4AQFA 4E7ZA 4YJ2E 3JC6D 1MMNA 5J0ZA 5A1LA 3AXJA 3U8JA 5F5WA 4HQPA 4JYAT 1NEKA 4JV5T 3FHNA 5JR9A 4EXTA 3ZMZB 2UXNB 3LJCA 4UELA 5F8PA 1HFAA 4F8HA 4F6RC 4UM3P 2DCFA 3B57A 1N36T 2YDSA 2R6GF 4PFPA 3LFMA 3O1JA 1CUNA 4IHJE 2HHHT 4B3MT 2CLYC 4H9PC 3K3NA 5AQKB 5JDNA 2M6IA 1HG5A 4HGAA 4X5TA 5FXZA 1XMQT 1AJ3A 4CXYA 4CI2B 2A72A 3RKGA 2W62A 1D0ZA 1LVFA 3ZDGA 3KV5A 3Q9DA 4JEHB 3I0QA 4DR5T 1QLBA 5LGUB 4O4JE 4DV1T 4MHCA 2EHOB 4A97A 2UUBT 2XQ4A 2F4VT 1X9BA 5AQHB 3ZLIA 2CWOA 3LK2B 5EK3A 5DQWA 2C0SA 4CI3B 3SQ9A 2UZ6A 5FYMA 5J5FA 3MXZA 4AFGA 2ACXA 2UU9T 5LXTE 2WMOA 2H89A 3ANWB 3KVAA 3N2GE 4HFCA 2ZM0A 3SWHA 5F3JA 2HN2A 4NXMT 1WYBA 2VVSA 2MBGA 5FKYA 3BQLA 4GKJT 2W2UA 5AQUB 2WU5A 3RYCE 5C2TA 2N2NA 2RP4A 4IE7A 3RYIE 4G2AA 1XWMA 2NP9A 2K3WA 5AFUL 2UUAT 1VRBA 4YSYA 5HEUA 1OEDB 1LRZA 4ZEYA 2ODUA 3CX6B 5BW2A 5J2TE 1XDOA 4O2AE 2VKOA 5ABGA 4X1KE 4L0RA 3P7IA 4IDOA 5JRCB 4HN9A 2AE9A 2VASA 2KINB 2X0HA 4ZJTA 1J5ET 1J1JA 3TLUA 1DU2A 2QGSA 3NZQA 5M4YA 2MOZA 3FBZA 2V5DA 2BG9C 2BYRA 2XAQB 4NPPA 4H9RC 5AQIB 4P0AA 2KZ7B 4HFDA 3CMLA 3PUWF 2CRBA 2LKGA 2XUEA 3HA4A 3KBTA 3KVBA 5KZUA 1I6ZA 2WM9A 4QAAA 3QK6A 1R8IA 2V26A 3ONJA 3VU7H 5L3BB 3EVYA 3AE5A 1OEDC 3ZJ1A 3Q5XA 3RIUC 4PJNA 4YJ3E 4UF0A 3T8OA 3JADA 1OWAA 2YOEA 3IF8B 5FP3A 3C50A 3ZYMA 2D9DA 3TLTA 2AXDS 4IL9A 2XPKA 1IAPA 3RLFF 3UUNA 2I6HA 2VL0A 1U5PA 3NZPA 2PFVA 4PFOA 4QHOA 2NWBA 3NVOA 3AA0B 1NAFA 2K24A 3ZT7A 4ISTA 4YSZA 4UVBB 2E8IA 2X9WA 1FIOA 2BKNA 3BQIA 3VKHA 1HX8A 2X00D 1MNDA 2IMLA 4DVDA 5CA1E 4N78D 4LMKA 3U8MA 2WQYA 3O1HA 1IBLT 3C84A 1KK7A 4UM1A 4CN4A 2V7MA 4ZXLA 1GQEA 2JRKA 4PJLA 3UU3A 5FY0A 2ZJUA 5LNKA 3K3OA 5C8YE 5HCJA 1S35A 4UY2A 3PUAA 2CXDA 4LFBT 1UV6A 3ZC0A 4LF4T 2BR8A 4IDQA 2SPCA 2LT3A 4WNKA 4J2CA 5LOVE 3ONLC 4PK4A 3EAMA 3JC6C 4QH1A 5JH7E 2W63A 4DBRA 4NIQA 5LA6E 4ANJA 2N1GA 4HWHA 5JR9B 4HEAA 3SH1A 2D0TA 2UXXB 5LB7B 2W4XA 2JIWA 5H6RB 2M67A 5L3EB 5LG3A 1HCIA 1YQ4A 2UXCT 3CPZA 2BVMA 3K1SA 1H7CA 2CPTA 4XHEA 1N33T 1VOMA 4D01A 4AQYT 5FMNA 2VKDA 5FL0A 2VKJA 4DNDA 5IUXA 3RI5A 3HKCE 3ZYLA 3HL6A 5AQVB 3C4XA 4AQFC 4EB6E 1JNZA 1E7PA 3PV0F 3AB3B 4LF8T 5ABEA 1YKEB 4H9SE 3ZKRA 3RC8A 3UUBA 2EHOD 4ZI2D 4C90A 5JR9C 2ES0A 3C98B 2JQKA 3E08A 3DJBA 3WI3A 2FJAA 2B76A 3ZPOA 3AA6B 4PNIA 2QA7A 3H3MA 4HWCA 4AQGA 2QRXA 3KFWX 4EZHA 3MJXA 3FXDB 4H9OC 4ZZCA 2NTYA 3A8YC 2JMHA 2V5CA 3VKGA 1W0AA 4YTMA 2WS3A 5AFNA 5J5GA 2WNLA 2ZM8A 4AKGA 4HKAA 2Q9QA 3IBPA 3LG7A 4UV9B 2HH7A 2I0MA 4EYYR 1L0VA 2WY2A 3KV9A 4Z8XA 4IL4A 4I50E 5AFMA 2M6BA 3T1YT 3L8RA 2NOXA 5AQMB 5AQOB 3KDSE 2X0YA 1QUUA 2V8SV 4QXHB 4OHFA 3ZN1B 1FEWA 1UX5A 3P50A 4GYSA 4EEDA 2WCAA 4A56A 5ETWA 2Z6EA 3CWZB 3P8CD 4DV4T 4DMWA 4BA9A 3UUXB 1OEDE 1KNZA 3UTKA 5FL1A 3N9LA 1BR1A 1FJGT 3WAKA 2OV9A 2BS3A 1W0BA 2CCQA 5AQFB 1ZHCA 2BKPA 3IGQA 3CQXC 5L3DB 3N9NA 1IBKT 3VR9A 3MZKB 2YK0A 4JI2T 2XSBA 1LVKA 3SFEA 3B13A 4CN6A 2FJBA 2CLYB 2JQHA 4LFAT 4HWIB 4U2YA 1W9RA 2KSRA 2YU1A 1BR2A 2WZYA 3U3IA 5JDGA 3AAEB 3KINB 4DV3T 2Y48B 5BRXA 1BR0A 5HEJA 4YLHA 5ADXL 2V6YB 3PTRB 2X0LB 3EDUA 4IE6A 2H7VC 4EGWA 2OA5A 3WTMA 2VL8A 5AQNB 5FXWA 4HFBA 4MBQA 3PMZA 3V5SA 2YMEA 3SOLA 3RRWA 3Q5EA 3NKZA 1KEYA 4JBWF 3A7MA 5HEHA 2HPJA 5AQTB 2J62A 3V5UA 3PU8A 3PDYA 4NZBA 4X65T 2GK9A 4DV2T 1S94A 2LSJA 4WW0A 3DP7A 3FXEB 3ZSSA 2MYSA 4UR9A 1XNRT 5AFKA 2H7OA 2PG8A 1M62A 1O3XA 3MA9A 1Y01A 4HWDA 4H63V 2VB6A 5HXSA 4UM3A 2B1EA 4P0BA 3R84B 5LYJE 4U74A 3LBXB 2W61A 2RA1A 4IDZA 3AVRA 4KUMB 4ZI3D 3ZC1A 3O9XA 2WDVA 2LSGA 1UX2A 5AFHA 3PURA 5AQJB 4OFZA 4DBMA 3FZHB 4X20E 3RYFE 2PH9A 2YEVC 3WTKA 3P4WA 3U78A 4ZJSA 2WB5A 2LE8A 4NUVA 2BJ0A 4I4TE 5L4EA 2WWUA 1M7KA 1Z8UA 4EZ1A 4L5GA 3SRZA 3IHRA 5FY7A 2BG9B 3P4RA 1UCUA 4CZZB 3UT5E 5JREA 3AEGA 2WDRA 4DV7T 2DNXA 4YTNA 4Z90A 2DWGA 2P9BA 4DV5T 4TNWA 3SFDA 4IDNA 4CI1B 3FZKB 5L3GB 4LF7T 3LK3B 3X1DA 3PUXF 4X64T 3C64A 2LSYA 5LHHB 2UXDT 3PJAA 4ZOLE 2JMKA 1HNWT 2D0UA 5ABFA 3PEOA 3W15B 3HI2A 3AEBA 2BKOA 5HXRA 1MMGA 1U4QA 2PGZA 3N5LA 2IIUA 1LKXA 1YXRA 2FJDA 4LMJA 4DR7T 4FI5A 3QB5K 2XNTA 2K5BB 3OKQA 2CM0A 4QKNA 3GN5B 2E9XA 1HG2A 1E1HB 4B5DA 5L2LA 2Q9QB 4GKKT 1G73A 5TVCA 5KXJA 3VRBA 3TLVA 4I0UA 1VCSA 2WN9A 5J2UE 4Q25A 4DMVA 3RGLA 3VHLA 4O4IE 2XM1A 2XQ5A 5AFMB 3I1AA 3Q5WA 1NWMX 2X00A 2WMNA 4MLKA 3K8PC 5FNVE 3RKOA 2CWYA 2WBLA 2Y7YA 1B7TA 4ZS3A 4PIRA 3U8NA 3C51A 1ZEEA 5CGMA 3WTOA 1D1BA 2PJQA 2CEAA 4H9NC 5HEOA 2UXBT 5HAXA 4UVAB 2E9XD 4TX5A 3KV6A 4PW8A 4OYKA 2J4GA 4UVCB 3RX6A 2XQ8A 3WTLA 5HXEA 2VKHA 3RH3A 2Q9QC 2LM2A 2K48A 4DR1T 2H88A 3D0TA 4O8SA 2DI4A 4HE8A 4HFVA 3QUJA 5IYZE 4X1YE 3C4ZA 4EIWA 3ZT5A 1HR0T 4EYUA 4GK5E 4EZ4A 4DV0T 2XM2A 3CVRA 5AFJA 5JDQA 2C5IT 4OK0A 4DBQA 5CB4E 2KT9A 3ONXA 4AFHA 2BS4A 1WR6A 2CMRA 3ETUA 4ILUA 2YDQA 5AQPB 2UUCT 1YQ3A 2XSAA 2BYSA 3AXJB 2DWKA 2LEHA 2ZM6T 1BR4A 2KXPB 4E7SA 1HF8A 2NW9A 4ZK1A 4EEBA 2VK9A 4A5XA 2WNCA 4DR6T 5HXCA 4HFHA 3MK7C 4JI4T 1KFYA 5FVLA 5HWXA 3EABA 4IREA 3ZN0B 2EHOA 3ABVA 3B5MA 4PJMA 1WLXA 5LCYA 4AKRB 4K0KT 1T8BA 1CHUA 4DUYT 3KBUA 4LF9T 3E0ZA 5CFBA 2LOPA 4JLEA 3QOFA 2DL1A 3F2EA 5CO5A 3WTHA 3AE1A 2Y57A 5KDMC 3AE6A 2XAHB 5LBQB 2IW5B 2N9DA 4KHZF 1SHZC 4U7YA 4AI6A 3ANWA 2XAJB 3FZFB 4HWFA 4B6XA 5JDHA 3RIFA 5CA0E 2NW8A 4JI1T 2KWHA 4U2ZA 4H63H 2XNVA 1NENA 5EZYE 2ODVA 3I0OA
chains in the Genus database with same CATH topology
5AFHA 5J5IA 4QH4A 5AINA 3TLVA 2QC1B 4LMLA 3SH1A 3U8KA 5BP0A 2BYQA 2WN9A 3UQ7A 4DBMA 5L47A 4UXUA 5BRXA 2BG9A 3JADA 5HEJA 2PH9A 2WNJA 5SYOA 3WIPA 2BYSA 4HFEA 2YOEA 5FJVA 3P4WA 3UU8A 3WTKA 2W8FA 2Y58A 4ZJSA 3TLTA 2Y54A 5LG3A 4IL9A 3RIAA 2BJ0A 2XQ5A 4F8HA 2W8GA 5L4EA 4ZK1A 5AFMB 4EZ1A 4UM3S 4UM3P 5HEGA 4ZK4A 2X00A 2WNCA 4XHEA 2YMDA 2VL0A 4HFHA 4IL4A 2BR7A 2Y7YA 3GUAA 2M6BA 4ZRUA 3WTJA 4D01A 5AFMA 2BG9B 5KE4A 4ALXA 4ILBA 3RQWA 4PIRA 3WTMA 5HEUA 1OEDB 3JAFA 4QACA 3U8NA 4ILCA 5LXBA 4WV9A 4QH5A 3JAEA 3EI0A 4IREA 2M6IA 3RQUA 5J5HA 3WTOA 4X5TA 5IUXA 2Y56A 4HFBA 4Z90A 3RI5A 3PMZA 2C9TA 1OEDA 2YMEA 4XK9A 5BW2A 2YKSA 2XQ6A 3P50A 4TNWA 5HEOA 3UU4A 3UU5A 1I9BA 3ZDHA 2X00D 4FRRA 3TLSA 3ZDGA 4ZZBA 2XZ5A 5HEHA 4BFQA 2BYNA 4ILAA 4BQTA 2XYTA 2BG9E 5JMEA 4LMKA 1OEDE 5CFBA 4TWHA 4ZJTA 4A97A 3U8MA 2ZJVA 2XQ8A 3WTLA 3ZKRA 3TLUA 3WTIA 3UUBA 2XQ4A 4NZBA 3C84A 3PEOA 4UM1A 4TNVA 2MAWA 2LM2A 3U8LA 2BG9C 2BYRA 3UQ4A 4QABA 4NPPA 4COFA 2XQAA 5CO5A 3WTHA 3IGQA 2PGZA 2BYPA 2Y57A 3C79A 5AFKA 1UW6A 2LKHA 3UU3A 3UU6A 2ZJUA 2LLYA 4HFDA 3RHWA 2XYSA 2XNUA 3T4MA 2XQ3A 4Z91A 2XQ9A 5HCJA 2LKGA 4UY2A 4LMJA 4AFTA 3LSVA 5L4HA 1UV6A 3SQ9A 2UZ6A 5KZUA 4UM3A 3WTNA 2XQ7A 2BR8A 5AFLA 5J5FA 3EHZA 3RIFA 4QAAA 4AFGA 2XNTA 4A98A 4ZZCA 2YN6A 5J0ZA 5HCMA 3EAMA 5AFJA 3SQ6A 1OEDC 4TWDA 4QH1A 4AFHA 2KSRA 2WZYA 2XNVA 3U8JA 4HQPA 4HFCA 4B5DA 4ZR6A 5AFNA 4HFIA 3SIOA 4TWFA 5TVCA 5J5GA 2XZ6A 3TLWA 2WNLA 1UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFH A;  5J5I A;  4QH4 A;  5AIN A;  3TLV A;  2QC1 B;  4LML A;  3SH1 A;  3U8K A;  5BP0 A;  2BYQ A;  2WN9 A;  3UQ7 A;  4DBM A;  5L47 A;  4UXU A;  5BRX A;  2BG9 A;  3JAD A;  5HEJ A;  2PH9 A;  2WNJ A;  5SYO A;  3WIP A;  2BYS A;  4HFE A;  2YOE A;  5FJV A;  3P4W A;  3UU8 A;  3WTK A;  2W8F A;  2Y58 A;  4ZJS A;  3TLT A;  2Y54 A;  5LG3 A;  4IL9 A;  3RIA A;  2BJ0 A;  2XQ5 A;  4F8H A;  2W8G A;  5L4E A;  4ZK1 A;  5AFM B;  4EZ1 A;  4UM3 S;  4UM3 P;  5HEG A;  4ZK4 A;  2X00 A;  2WNC A;  4XHE A;  2YMD A;  2VL0 A;  4HFH A;  4IL4 A;  2BR7 A;  2Y7Y A;  3GUA A;  2M6B A;  4ZRU A;  3WTJ A;  4D01 A;  5AFM A;  2BG9 B;  5KE4 A;  4ALX A;  4ILB A;  3RQW A;  4PIR A;  3WTM A;  5HEU A;  1OED B;  3JAF A;  4QAC A;  3U8N A;  4ILC A;  5LXB A;  4WV9 A;  4QH5 A;  3JAE A;  3EI0 A;  4IRE A;  2M6I A;  3RQU A;  5J5H A;  3WTO A;  4X5T A;  5IUX A;  2Y56 A;  4HFB A;  4Z90 A;  3RI5 A;  3PMZ A;  2C9T A;  1OED A;  2YME A;  4XK9 A;  5BW2 A;  2YKS A;  2XQ6 A;  3P50 A;  4TNW A;  5HEO A;  3UU4 A;  3UU5 A;  1I9B A;  3ZDH A;  2X00 D;  4FRR A;  3TLS A;  3ZDG A;  4ZZB A;  2XZ5 A;  5HEH A;  4BFQ A;  2BYN A;  4ILA A;  4BQT A;  2XYT A;  2BG9 E;  5JME A;  4LMK A;  1OED E;  5CFB A;  4TWH A;  4ZJT A;  4A97 A;  3U8M A;  2ZJV A;  2XQ8 A;  3WTL A;  3ZKR A;  3TLU A;  3WTI A;  3UUB A;  2XQ4 A;  4NZB A;  3C84 A;  3PEO A;  4UM1 A;  4TNV A;  2MAW A;  2LM2 A;  3U8L A;  2BG9 C;  2BYR A;  3UQ4 A;  4QAB A;  4NPP A;  4COF A;  2XQA A;  5CO5 A;  3WTH A;  3IGQ A;  2PGZ A;  2BYP A;  2Y57 A;  3C79 A;  5AFK A;  1UW6 A;  2LKH A;  3UU3 A;  3UU6 A;  2ZJU A;  2LLY A;  4HFD A;  3RHW A;  2XYS A;  2XNU A;  3T4M A;  2XQ3 A;  4Z91 A;  2XQ9 A;  5HCJ A;  2LKG A;  4UY2 A;  4LMJ A;  4AFT A;  3LSV A;  5L4H A;  1UV6 A;  3SQ9 A;  2UZ6 A;  5KZU A;  4UM3 A;  3WTN A;  2XQ7 A;  2BR8 A;  5AFL A;  5J5F A;  3EHZ A;  3RIF A;  4QAA A;  4AFG A;  2XNT A;  4A98 A;  4ZZC A;  2YN6 A;  5J0Z A;  5HCM A;  3EAM A;  5AFJ A;  3SQ6 A;  1OED C;  4TWD A;  4QH1 A;  4AFH A;  2KSR A;  2WZY A;  2XNV A;  3U8J A;  4HQP A;  4HFC A;  4B5D A;  4ZR6 A;  5AFN A;  4HFI A;  3SIO A;  4TWF A;  5TVC A;  5J5G A;  2XZ6 A;  3TLW A;  2WNL A;  1UX2 A; 
#chains in the Genus database with same CATH topology
 4ZI3 C;  4B3R T;  2QC1 B;  3P4P A;  1HS7 A;  5L3F B;  4YFS A;  4KMC A;  3UU8 A;  1WYC A;  1WR0 A;  1IJ5 A;  4ZI7 E;  5LGN B;  2LHN A;  3GUA A;  1WFD A;  4ZRU A;  2WDQ A;  4ALX A;  4TV8 E;  1UK5 A;  3ZCJ A;  1J5W A;  3AVS A;  4JI8 T;  2Y56 A;  4PJJ A;  4XK9 A;  2XQ6 A;  3UU4 A;  3PUZ F;  3F57 A;  3K3Q C;  5LGT B;  3ZDH A;  1ZV4 X;  3I9Y A;  3VR8 A;  3OJA A;  5DAB A;  4U33 A;  5ABH A;  2XYT A;  2BG9 E;  1FMV A;  4UXN B;  3BQK A;  3FZM B;  2MTQ A;  2YIN A;  5FXV A;  5LJN A;  3UUM A;  4O4L E;  2DLR A;  1UW6 A;  4WBN E;  3GWH A;  3UU6 A;  5LMN T;  2LLY A;  3T4M A;  2XAF B;  4XAX B;  1V9D A;  2XAG B;  1ZOY A;  3WTN A;  4YSX A;  3DTO A;  4TWD A;  4U7I A;  4CXW A;  3TKL B;  4AXP A;  2C5K T;  3N9Q A;  5KX5 E;  4JI7 T;  3SIO A;  1IBM T;  2ZMA A;  2XZ6 A;  4OX9 T;  2XJ7 A;  3U8K A;  5BP0 A;  2BYQ A;  1XZY A;  2FUP A;  5L47 A;  3CKD A;  2X9Y A;  5SYO A;  2V7K A;  2Y8D A;  3RF1 A;  4IGU A;  3ETV A;  4UF0 B;  5J1G A;  1HNX T;  4TZ4 C;  4ZK4 A;  2YMD A;  2XQY A;  3HKE E;  2CE7 A;  5AQR B;  3AE7 A;  3N2K E;  2Y6X A;  3EI0 A;  2IC9 A;  2WP9 A;  3ZMS B;  1UGO A;  1YD8 G;  4M1P A;  4DR3 T;  2MPK A;  2VVN A;  4DID B;  4V1A v;  2XZ5 A;  4B3T T;  3CQG B;  3OYX A;  4ILA A;  2E9X C;  1SE7 A;  2LOS A;  3F31 A;  4U3C A;  4AIU A;  2BZB A;  1MMA A;  4IE5 A;  3IEE A;  2L8K A;  2BVL A;  2LSK A;  2LKH A;  4Z91 A;  2WAU A;  5AQG B;  4PAG A;  3QB5 A;  3UFE A;  2IAK A;  2OLT A;  5JTG A;  2IHR 1;  2CXF A;  3HR0 A;  2JQQ A;  4ERR A;  2ZLY A;  3HKD E;  4HFI A;  4JI5 T;  4QH4 A;  1UUS A;  4HTE A;  2KMF A;  1ZP0 A;  1UX4 A;  2JQ9 A;  3FB2 A;  1HTJ F;  4CN1 A;  4CXX A;  5H6Q B;  2CBJ A;  4JI3 T;  3H3A A;  5LJM A;  5HEG A;  3C4W A;  4P1N A;  3AE2 A;  2BR7 A;  4O2B E;  3OPC A;  5KE4 A;  3JAF A;  3QNU A;  2XHE B;  4QH5 A;  3AAA B;  5DJQ C;  2BBJ A;  4UIG A;  4IT4 A;  2W0G A;  2V1D B;  4EOZ B;  3MKD A;  4QXC B;  4DO0 A;  4BFQ A;  2BYN A;  4BQT A;  2XY8 B;  4H9Q C;  2KLQ A;  5HWY A;  3ZT6 A;  2MAW A;  5GON E;  3PE0 A;  2JJ9 A;  3UQ4 A;  3ZCI A;  4WYV A;  3ESL A;  2JPF A;  2NW7 A;  3ZYK A;  3PUQ A;  3AA1 B;  3I9W A;  2D5U A;  4YXD A;  2VUR A;  5JDF A;  5AQL B;  2YN6 A;  2EHO C;  4ZI2 C;  5LP6 E;  2ZM2 A;  4YHH T;  5BR8 T;  5KMG P;  4X66 T;  5J5I A;  5EK2 A;  4DUZ T;  4B3S T;  4UXU A;  4EAH A;  2E5V A;  3WIP A;  1KNR A;  4ADZ A;  4JI6 T;  1XMO T;  1HNZ T;  2WWV A;  4TN7 B;  3N9O A;  1SUM B;  3WAJ A;  1YKH B;  2H3R A;  4DR4 T;  2W8G A;  4K0U A;  3CQC B;  2LHR A;  3AE8 A;  4IE0 A;  4QWN B;  5AQS B;  3RQW A;  3NBX X;  4GK0 E;  3AEF A;  4UV8 B;  3RQU A;  4KX6 A;  5CJ5 A;  2D2S A;  1KF6 A;  4AKL A;  3N9M A;  5IWA T;  2WZI A;  2IUB A;  2WU2 A;  4JI0 T;  1ZKE A;  4X1I E;  3R6N A;  3TLS A;  2V6X A;  2VWA A;  2XTL A;  4WZX A;  5JME A;  1IJ6 A;  4NUU A;  2W66 A;  4GIW A;  2X51 A;  5LHG B;  2CHN A;  1N32 T;  2LRK A;  2QVA A;  3L39 A;  4TNV A;  3U8L A;  2LRL A;  4QAB A;  3EUH A;  4COF A;  2FJE A;  2KND A;  3Q5D A;  3C79 A;  3L09 A;  2XYS A;  4ZS2 A;  2XNU A;  2IC6 A;  3M65 A;  5L4H A;  1XDP A;  1T7S A;  5E0O A;  3NRY A;  1UUR A;  3HKB E;  5AQQ B;  3AE9 A;  4ZR6 A;  4IDP A;  2V6Y A;  3FZL B;  3J7Y q;  3TLW A;  4AKI A;  4JUY A;  2A2F X;  5AIN A;  2CHO A;  4LML A;  3O4X E;  2X68 A;  3RC3 A;  1OXZ A;  1T72 A;  3RIA A;  3AE4 A;  4DR2 T;  5C3J A;  3PUV F;  3RYH E;  5FXX A;  2HPL A;  3FBL A;  4PK5 A;  4DV6 T;  3AE3 A;  4ISS A;  4QAC A;  4NXN T;  5LXB A;  5LG4 A;  2XAS B;  2C9T A;  2WSS V;  2YKS A;  4O4H E;  3CIR A;  3UU5 A;  3IA3 A;  1I9B A;  2CBI A;  4QX7 B;  2V7L A;  3P4Q A;  4ZZB A;  3NRX A;  3G06 A;  3PUY F;  5L3C B;  5FVK A;  1WRD A;  2BBH A;  4BJN A;  2ZJV A;  4YY3 T;  4BAY B;  3WTI A;  4ZHQ E;  4JEU B;  2LJL A;  4X62 T;  1MNE A;  3PJA J;  3J9X 1;  2XQA A;  4AKH A;  1T98 A;  1EZ3 A;  3OBV E;  3LDQ B;  2C5J A;  2J1D G;  2X67 A;  3VRA A;  3LBX A;  2HN1 A;  2XQ3 A;  3ZMU B;  4AFT A;  1XNQ T;  2XQ7 A;  5AFL A;  3AEC A;  1Y64 B;  4A98 A;  5HCM A;  2WZH A;  3JCF A;  2BS2 A;  1G8X A;  3A5X A;  4KBM B;  5JVD E;  4UEM A;  4ASK A;  4TWF A;  2NR4 A;  1D1C A;  2I59 A;  3SS1 A;  3H37 A;  5LBM A;  2K9A A;  4MFR A;  3CX7 B;  3UQ7 A;  1US7 B;  4CQI A;  4BJM A;  2BG9 A;  2WNJ A;  3N2O A;  4KP3 C;  4KI0 F;  1SA0 E;  2V7J A;  2CXL A;  3MAC A;  5FY1 A;  2LM9 A;  2Y54 A;  3T1H T;  4XZC A;  4UM3 S;  1JNR A;  1HX1 B;  3O1I A;  2PBI A;  3E22 E;  5HXH A;  5JDM A;  2J47 A;  1MIW A;  3LK4 2;  1VCT A;  2X9H A;  2RPA A;  2CA5 A;  4ILC A;  4WBO A;  4WV9 A;  3Q2M A;  4IIJ E;  1YW0 A;  1OED A;  3ZST A;  3GMI A;  4QXB B;  4AIS A;  3UFG A;  1I94 T;  3RIU A;  4U72 A;  4MAL A;  4FRR A;  2A9U A;  1FMW A;  3OVU A;  4IE4 A;  5JRC A;  2L3L A;  1WCR A;  2A3D A;  4L9I A;  2G0U A;  3BK9 A;  5TAO A;  3GA8 A;  2BYP A;  4EV6 A;  3L3P A;  1N34 T;  2KWI B;  5LMU T;  4LF5 T;  4YT0 A;  1D0X A;  3GN5 A;  5ABF B;  1Z0P A;  3OTO T;  2W00 A;  3PU3 A;  4FJO A;  4LFC T;  2XZE A;  3EHZ A;  1MIV A;  1MIY A;  4U31 A;  2X9X A;  3SQ6 A;  3AED A;  2PTF A;  3QC9 A;  4OYJ A;  3P4S A;  2DHR A;  2ACZ A;  2E5L T;  1E2A A;  3PUG A;  3AA7 B;  5LHI B;  5DQV A;  1IZN B;  4PK6 A;  2LSI A;  4HFE A;  5FJV A;  2W8F A;  2Y58 A;  3CX8 B;  4XBF B;  2YDR A;  2E9X B;  4GOU A;  3RRC A;  3OYZ A;  4TUY E;  2BDE A;  2IDO B;  3S4U A;  2W67 A;  3WTJ A;  5BMV E;  4ILB A;  4YHJ A;  3NWI A;  2Q9Q D;  4I55 E;  3JAE A;  4LF6 T;  1D0Y A;  3UUL A;  5J5H A;  4GYR A;  4TV9 E;  2X66 A;  3ZMT B;  2E2A A;  1QSD A;  4G63 A;  4KHP T;  4C91 A;  1KNP A;  3AAI A;  5JDL A;  4I43 B;  3N9P A;  3ZEF B;  3AEA A;  2QYW A;  3PUS A;  4YTP A;  4P09 A;  4TWH A;  1W09 A;  3AEE A;  3CK6 A;  2NTX A;  3EDV A;  3KV4 A;  1MMD A;  2FBW A;  5EK4 A;  2VQE T;  2V7I A;  4QX8 B;  3RHW A;  5JQG E;  2L9Q A;  2XQ9 A;  3ZJ2 A;  3M3Z B;  3LSV A;  1X79 A;  3RPU A;  3ZMV B;  2YU2 A;  5IHY A;  5HYA A;  1D1A A;  2VQF T;  4AQF A;  4E7Z A;  4YJ2 E;  3JC6 D;  1MMN A;  5J0Z A;  5A1L A;  3AXJ A;  3U8J A;  5F5W A;  4HQP A;  4JYA T;  1NEK A;  4JV5 T;  3FHN A;  5JR9 A;  4EXT A;  3ZMZ B;  2UXN B;  3LJC A;  4UEL A;  5F8P A;  1HFA A;  4F8H A;  4F6R C;  4UM3 P;  2DCF A;  3B57 A;  1N36 T;  2YDS A;  2R6G F;  4PFP A;  3LFM A;  3O1J A;  1CUN A;  4IHJ E;  2HHH T;  4B3M T;  2CLY C;  4H9P C;  3K3N A;  5AQK B;  5JDN A;  2M6I A;  1HG5 A;  4HGA A;  4X5T A;  5FXZ A;  1XMQ T;  1AJ3 A;  4CXY A;  4CI2 B;  2A72 A;  3RKG A;  2W62 A;  1D0Z A;  1LVF A;  3ZDG A;  3KV5 A;  3Q9D A;  4JEH B;  3I0Q A;  4DR5 T;  1QLB A;  5LGU B;  4O4J E;  4DV1 T;  4MHC A;  2EHO B;  4A97 A;  2UUB T;  2XQ4 A;  2F4V T;  1X9B A;  5AQH B;  3ZLI A;  2CWO A;  3LK2 B;  5EK3 A;  5DQW A;  2C0S A;  4CI3 B;  3SQ9 A;  2UZ6 A;  5FYM A;  5J5F A;  3MXZ A;  4AFG A;  2ACX A;  2UU9 T;  5LXT E;  2WMO A;  2H89 A;  3ANW B;  3KVA A;  3N2G E;  4HFC A;  2ZM0 A;  3SWH A;  5F3J A;  2HN2 A;  4NXM T;  1WYB A;  2VVS A;  2MBG A;  5FKY A;  3BQL A;  4GKJ T;  2W2U A;  5AQU B;  2WU5 A;  3RYC E;  5C2T A;  2N2N A;  2RP4 A;  4IE7 A;  3RYI E;  4G2A A;  1XWM A;  2NP9 A;  2K3W A;  5AFU L;  2UUA T;  1VRB A;  4YSY A;  5HEU A;  1OED B;  1LRZ A;  4ZEY A;  2ODU A;  3CX6 B;  5BW2 A;  5J2T E;  1XDO A;  4O2A E;  2VKO A;  5ABG A;  4X1K E;  4L0R A;  3P7I A;  4IDO A;  5JRC B;  4HN9 A;  2AE9 A;  2VAS A;  2KIN B;  2X0H A;  4ZJT A;  1J5E T;  1J1J A;  3TLU A;  1DU2 A;  2QGS A;  3NZQ A;  5M4Y A;  2MOZ A;  3FBZ A;  2V5D A;  2BG9 C;  2BYR A;  2XAQ B;  4NPP A;  4H9R C;  5AQI B;  4P0A A;  2KZ7 B;  4HFD A;  3CML A;  3PUW F;  2CRB A;  2LKG A;  2XUE A;  3HA4 A;  3KBT A;  3KVB A;  5KZU A;  1I6Z A;  2WM9 A;  4QAA A;  3QK6 A;  1R8I A;  2V26 A;  3ONJ A;  3VU7 H;  5L3B B;  3EVY A;  3AE5 A;  1OED C;  3ZJ1 A;  3Q5X A;  3RIU C;  4PJN A;  4YJ3 E;  4UF0 A;  3T8O A;  3JAD A;  1OWA A;  2YOE A;  3IF8 B;  5FP3 A;  3C50 A;  3ZYM A;  2D9D A;  3TLT A;  2AXD S;  4IL9 A;  2XPK A;  1IAP A;  3RLF F;  3UUN A;  2I6H A;  2VL0 A;  1U5P A;  3NZP A;  2PFV A;  4PFO A;  4QHO A;  2NWB A;  3NVO A;  3AA0 B;  1NAF A;  2K24 A;  3ZT7 A;  4IST A;  4YSZ A;  4UVB B;  2E8I A;  2X9W A;  1FIO A;  2BKN A;  3BQI A;  3VKH A;  1HX8 A;  2X00 D;  1MND A;  2IML A;  4DVD A;  5CA1 E;  4N78 D;  4LMK A;  3U8M A;  2WQY A;  3O1H A;  1IBL T;  3C84 A;  1KK7 A;  4UM1 A;  4CN4 A;  2V7M A;  4ZXL A;  1GQE A;  2JRK A;  4PJL A;  3UU3 A;  5FY0 A;  2ZJU A;  5LNK A;  3K3O A;  5C8Y E;  5HCJ A;  1S35 A;  4UY2 A;  3PUA A;  2CXD A;  4LFB T;  1UV6 A;  3ZC0 A;  4LF4 T;  2BR8 A;  4IDQ A;  2SPC A;  2LT3 A;  4WNK A;  4J2C A;  5LOV E;  3ONL C;  4PK4 A;  3EAM A;  3JC6 C;  4QH1 A;  5JH7 E;  2W63 A;  4DBR A;  4NIQ A;  5LA6 E;  4ANJ A;  2N1G A;  4HWH A;  5JR9 B;  4HEA A;  3SH1 A;  2D0T A;  2UXX B;  5LB7 B;  2W4X A;  2JIW A;  5H6R B;  2M67 A;  5L3E B;  5LG3 A;  1HCI A;  1YQ4 A;  2UXC T;  3CPZ A;  2BVM A;  3K1S A;  1H7C A;  2CPT A;  4XHE A;  1N33 T;  1VOM A;  4D01 A;  4AQY T;  5FMN A;  2VKD A;  5FL0 A;  2VKJ A;  4DND A;  5IUX A;  3RI5 A;  3HKC E;  3ZYL A;  3HL6 A;  5AQV B;  3C4X A;  4AQF C;  4EB6 E;  1JNZ A;  1E7P A;  3PV0 F;  3AB3 B;  4LF8 T;  5ABE A;  1YKE B;  4H9S E;  3ZKR A;  3RC8 A;  3UUB A;  2EHO D;  4ZI2 D;  4C90 A;  5JR9 C;  2ES0 A;  3C98 B;  2JQK A;  3E08 A;  3DJB A;  3WI3 A;  2FJA A;  2B76 A;  3ZPO A;  3AA6 B;  4PNI A;  2QA7 A;  3H3M A;  4HWC A;  4AQG A;  2QRX A;  3KFW X;  4EZH A;  3MJX A;  3FXD B;  4H9O C;  4ZZC A;  2NTY A;  3A8Y C;  2JMH A;  2V5C A;  3VKG A;  1W0A A;  4YTM A;  2WS3 A;  5AFN A;  5J5G A;  2WNL A;  2ZM8 A;  4AKG A;  4HKA A;  2Q9Q A;  3IBP A;  3LG7 A;  4UV9 B;  2HH7 A;  2I0M A;  4EYY R;  1L0V A;  2WY2 A;  3KV9 A;  4Z8X A;  4IL4 A;  4I50 E;  5AFM A;  2M6B A;  3T1Y T;  3L8R A;  2NOX A;  5AQM B;  5AQO B;  3KDS E;  2X0Y A;  1QUU A;  2V8S V;  4QXH B;  4OHF A;  3ZN1 B;  1FEW A;  1UX5 A;  3P50 A;  4GYS A;  4EED A;  2WCA A;  4A56 A;  5ETW A;  2Z6E A;  3CWZ B;  3P8C D;  4DV4 T;  4DMW A;  4BA9 A;  3UUX B;  1OED E;  1KNZ A;  3UTK A;  5FL1 A;  3N9L A;  1BR1 A;  1FJG T;  3WAK A;  2OV9 A;  2BS3 A;  1W0B A;  2CCQ A;  5AQF B;  1ZHC A;  2BKP A;  3IGQ A;  3CQX C;  5L3D B;  3N9N A;  1IBK T;  3VR9 A;  3MZK B;  2YK0 A;  4JI2 T;  2XSB A;  1LVK A;  3SFE A;  3B13 A;  4CN6 A;  2FJB A;  2CLY B;  2JQH A;  4LFA T;  4HWI B;  4U2Y A;  1W9R A;  2KSR A;  2YU1 A;  1BR2 A;  2WZY A;  3U3I A;  5JDG A;  3AAE B;  3KIN B;  4DV3 T;  2Y48 B;  5BRX A;  1BR0 A;  5HEJ A;  4YLH A;  5ADX L;  2V6Y B;  3PTR B;  2X0L B;  3EDU A;  4IE6 A;  2H7V C;  4EGW A;  2OA5 A;  3WTM A;  2VL8 A;  5AQN B;  5FXW A;  4HFB A;  4MBQ A;  3PMZ A;  3V5S A;  2YME A;  3SOL A;  3RRW A;  3Q5E A;  3NKZ A;  1KEY A;  4JBW F;  3A7M A;  5HEH A;  2HPJ A;  5AQT B;  2J62 A;  3V5U A;  3PU8 A;  3PDY A;  4NZB A;  4X65 T;  2GK9 A;  4DV2 T;  1S94 A;  2LSJ A;  4WW0 A;  3DP7 A;  3FXE B;  3ZSS A;  2MYS A;  4UR9 A;  1XNR T;  5AFK A;  2H7O A;  2PG8 A;  1M62 A;  1O3X A;  3MA9 A;  1Y01 A;  4HWD A;  4H63 V;  2VB6 A;  5HXS A;  4UM3 A;  2B1E A;  4P0B A;  3R84 B;  5LYJ E;  4U74 A;  3LBX B;  2W61 A;  2RA1 A;  4IDZ A;  3AVR A;  4KUM B;  4ZI3 D;  3ZC1 A;  3O9X A;  2WDV A;  2LSG A;  1UX2 A;  5AFH A;  3PUR A;  5AQJ B;  4OFZ A;  4DBM A;  3FZH B;  4X20 E;  3RYF E;  2PH9 A;  2YEV C;  3WTK A;  3P4W A;  3U78 A;  4ZJS A;  2WB5 A;  2LE8 A;  4NUV A;  2BJ0 A;  4I4T E;  5L4E A;  2WWU A;  1M7K A;  1Z8U A;  4EZ1 A;  4L5G A;  3SRZ A;  3IHR A;  5FY7 A;  2BG9 B;  3P4R A;  1UCU A;  4CZZ B;  3UT5 E;  5JRE A;  3AEG A;  2WDR A;  4DV7 T;  2DNX A;  4YTN A;  4Z90 A;  2DWG A;  2P9B A;  4DV5 T;  4TNW A;  3SFD A;  4IDN A;  4CI1 B;  3FZK B;  5L3G B;  4LF7 T;  3LK3 B;  3X1D A;  3PUX F;  4X64 T;  3C64 A;  2LSY A;  5LHH B;  2UXD T;  3PJA A;  4ZOL E;  2JMK A;  1HNW T;  2D0U A;  5ABF A;  3PEO A;  3W15 B;  3HI2 A;  3AEB A;  2BKO A;  5HXR A;  1MMG A;  1U4Q A;  2PGZ A;  3N5L A;  2IIU A;  1LKX A;  1YXR A;  2FJD A;  4LMJ A;  4DR7 T;  4FI5 A;  3QB5 K;  2XNT A;  2K5B B;  3OKQ A;  2CM0 A;  4QKN A;  3GN5 B;  2E9X A;  1HG2 A;  1E1H B;  4B5D A;  5L2L A;  2Q9Q B;  4GKK T;  1G73 A;  5TVC A;  5KXJ A;  3VRB A;  3TLV A;  4I0U A;  1VCS A;  2WN9 A;  5J2U E;  4Q25 A;  4DMV A;  3RGL A;  3VHL A;  4O4I E;  2XM1 A;  2XQ5 A;  5AFM B;  3I1A A;  3Q5W A;  1NWM X;  2X00 A;  2WMN A;  4MLK A;  3K8P C;  5FNV E;  3RKO A;  2CWY A;  2WBL A;  2Y7Y A;  1B7T A;  4ZS3 A;  4PIR A;  3U8N A;  3C51 A;  1ZEE A;  5CGM A;  3WTO A;  1D1B A;  2PJQ A;  2CEA A;  4H9N C;  5HEO A;  2UXB T;  5HAX A;  4UVA B;  2E9X D;  4TX5 A;  3KV6 A;  4PW8 A;  4OYK A;  2J4G A;  4UVC B;  3RX6 A;  2XQ8 A;  3WTL A;  5HXE A;  2VKH A;  3RH3 A;  2Q9Q C;  2LM2 A;  2K48 A;  4DR1 T;  2H88 A;  3D0T A;  4O8S A;  2DI4 A;  4HE8 A;  4HFV A;  3QUJ A;  5IYZ E;  4X1Y E;  3C4Z A;  4EIW A;  3ZT5 A;  1HR0 T;  4EYU A;  4GK5 E;  4EZ4 A;  4DV0 T;  2XM2 A;  3CVR A;  5AFJ A;  5JDQ A;  2C5I T;  4OK0 A;  4DBQ A;  5CB4 E;  2KT9 A;  3ONX A;  4AFH A;  2BS4 A;  1WR6 A;  2CMR A;  3ETU A;  4ILU A;  2YDQ A;  5AQP B;  2UUC T;  1YQ3 A;  2XSA A;  2BYS A;  3AXJ B;  2DWK A;  2LEH A;  2ZM6 T;  1BR4 A;  2KXP B;  4E7S A;  1HF8 A;  2NW9 A;  4ZK1 A;  4EEB A;  2VK9 A;  4A5X A;  2WNC A;  4DR6 T;  5HXC A;  4HFH A;  3MK7 C;  4JI4 T;  1KFY A;  5FVL A;  5HWX A;  3EAB A;  4IRE A;  3ZN0 B;  2EHO A;  3ABV A;  3B5M A;  4PJM A;  1WLX A;  5LCY A;  4AKR B;  4K0K T;  1T8B A;  1CHU A;  4DUY T;  3KBU A;  4LF9 T;  3E0Z A;  5CFB A;  2LOP A;  4JLE A;  3QOF A;  2DL1 A;  3F2E A;  5CO5 A;  3WTH A;  3AE1 A;  2Y57 A;  5KDM C;  3AE6 A;  2XAH B;  5LBQ B;  2IW5 B;  2N9D A;  4KHZ F;  1SHZ C;  4U7Y A;  4AI6 A;  3ANW A;  2XAJ B;  3FZF B;  4HWF A;  4B6X A;  5JDH A;  3RIF A;  5CA0 E;  2NW8 A;  4JI1 T;  2KWH A;  4U2Z A;  4H63 H;  2XNV A;  1NEN A;  5EZY E;  2ODV A;  3I0O A; 
#chains in the Genus database with same CATH homology
 5AFH A;  5J5I A;  4QH4 A;  5AIN A;  3TLV A;  2QC1 B;  4LML A;  3SH1 A;  3U8K A;  5BP0 A;  2BYQ A;  2WN9 A;  3UQ7 A;  4DBM A;  5L47 A;  4UXU A;  5BRX A;  2BG9 A;  3JAD A;  5HEJ A;  2PH9 A;  2WNJ A;  5SYO A;  3WIP A;  2BYS A;  4HFE A;  2YOE A;  5FJV A;  3P4W A;  3UU8 A;  3WTK A;  2W8F A;  2Y58 A;  4ZJS A;  3TLT A;  2Y54 A;  5LG3 A;  4IL9 A;  3RIA A;  2BJ0 A;  2XQ5 A;  4F8H A;  2W8G A;  5L4E A;  4ZK1 A;  5AFM B;  4EZ1 A;  4UM3 S;  4UM3 P;  5HEG A;  4ZK4 A;  2X00 A;  2WNC A;  4XHE A;  2YMD A;  2VL0 A;  4HFH A;  4IL4 A;  2BR7 A;  2Y7Y A;  3GUA A;  2M6B A;  4ZRU A;  3WTJ A;  4D01 A;  5AFM A;  2BG9 B;  5KE4 A;  4ALX A;  4ILB A;  3RQW A;  4PIR A;  3WTM A;  5HEU A;  1OED B;  3JAF A;  4QAC A;  3U8N A;  4ILC A;  5LXB A;  4WV9 A;  4QH5 A;  3JAE A;  3EI0 A;  4IRE A;  2M6I A;  3RQU A;  5J5H A;  3WTO A;  4X5T A;  5IUX A;  2Y56 A;  4HFB A;  4Z90 A;  3RI5 A;  3PMZ A;  2C9T A;  1OED A;  2YME A;  4XK9 A;  5BW2 A;  2YKS A;  2XQ6 A;  3P50 A;  4TNW A;  5HEO A;  3UU4 A;  3UU5 A;  1I9B A;  3ZDH A;  2X00 D;  4FRR A;  3TLS A;  3ZDG A;  4ZZB A;  2XZ5 A;  5HEH A;  4BFQ A;  2BYN A;  4ILA A;  4BQT A;  2XYT A;  2BG9 E;  5JME A;  4LMK A;  1OED E;  5CFB A;  4TWH A;  4ZJT A;  4A97 A;  3U8M A;  2ZJV A;  2XQ8 A;  3WTL A;  3ZKR A;  3TLU A;  3WTI A;  3UUB A;  2XQ4 A;  4NZB A;  3C84 A;  3PEO A;  4UM1 A;  4TNV A;  2MAW A;  2LM2 A;  3U8L A;  2BG9 C;  2BYR A;  3UQ4 A;  4QAB A;  4NPP A;  4COF A;  2XQA A;  5CO5 A;  3WTH A;  3IGQ A;  2PGZ A;  2BYP A;  2Y57 A;  3C79 A;  5AFK A;  1UW6 A;  2LKH A;  3UU3 A;  3UU6 A;  2ZJU A;  2LLY A;  4HFD A;  3RHW A;  2XYS A;  2XNU A;  3T4M A;  2XQ3 A;  4Z91 A;  2XQ9 A;  5HCJ A;  2LKG A;  4UY2 A;  4LMJ A;  4AFT A;  3LSV A;  5L4H A;  1UV6 A;  3SQ9 A;  2UZ6 A;  5KZU A;  4UM3 A;  3WTN A;  2XQ7 A;  2BR8 A;  5AFL A;  5J5F A;  3EHZ A;  3RIF A;  4QAA A;  4AFG A;  2XNT A;  4A98 A;  4ZZC A;  2YN6 A;  5J0Z A;  5HCM A;  3EAM A;  5AFJ A;  3SQ6 A;  1OED C;  4TWD A;  4QH1 A;  4AFH A;  2KSR A;  2WZY A;  2XNV A;  3U8J A;  4HQP A;  4HFC A;  4B5D A;  4ZR6 A;  5AFN A;  4HFI A;  3SIO A;  4TWF A;  5TVC A;  5J5G A;  2XZ6 A;  3TLW A;  2WNL A;  1UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...