3WTJA

Crystal structure of lymnaea stagnalis acetylcholine binding protein complexed with thiacloprid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 47
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtjA00
2ZJVA 4TWHA 3UU4A 2BYSA 2WN9A 4FRRA 2XYSA 2XZ6A 3P50A 3ZDGA 4UM3S 4PIRA 4ZK1A 3JAFA 4ZK4A 4F8HA 3RQUA 3EI0A 5KE4A 3C79A 5LXBA 5HEOA 4ZJTA 4UM3A 3WTMA 5HCJA 3T4MA 2XQAA 4QAAA 4HFDA 5HEHA 4A97A 5HCMA 4ILBA 3UUBA 5J5GA 2YMDA 4A98A 2XZ5A 3TLTA 5AFKA 2BJ0A 3WTHA 2PH9A 4D01A 3WTNA 5L4HA 1UV6A 2UZ6A 5HEJA 2BYQA 4ZRUA 3U8MA 4XK9A 4UM1A 2XQ8A 3SIOA 3TLWA 4ZZBA 5CO5A 2X00D 3JAEA 4HFBA 3UU5A 4QH5A 4LMJA 4IREA 4QH1A 2BG9A 3JADA 4ILAA 3TLSA 4B5DA 2C9TA 2XQ4A 4TNWA 2BYPA 5FJVA 2WNJA 2XQ7A 3ZDHA 2W8FA 2XQ6A 2Y57A 3UU8A 4ZR6A 5J5IA 5BP0A 3RQWA 4HFCA 4X5TA 2XYTA 2Y56A 5BRXA 3SQ9A 2BG9C 4IL9A 5AINA 2WNLA 2QC1B 4NPPA 4QH4A 5LG3A 1UX2A 4HFHA 2W8GA 4QACA 2YOEA 4Z91A 4ZJSA 2Y7YA 3RI5A 3PMZA 2VL0A 4BQTA 5L4EA 3SH1A 2BG9B 4UXUA 2XQ9A 3UQ4A 3UU3A 3WTLA 5CFBA 3P4WA 4XHEA 2PGZA 5IUXA 5AFMA 2YMEA 4TNVA 3WTIA 4EZ1A 5AFHA 3C84A 2WZYA 4IL4A 2XQ5A 5AFLA 3ZKRA 4ALXA 4UY2A 5KZUA 1I9BA 3U8LA 4DBMA 5HEGA 2YKSA 4HFIA 4LMKA 3WIPA 4UM3P 4TWFA 5L47A 3UU6A 2ZJUA 3UQ7A 3WTKA 4TWDA 4WV9A 4COFA 3TLVA 3EHZA 4LMLA 2BYNA 2XQ3A 2Y58A 3U8KA 1UW6A 3RIAA 4AFTA 2WNCA 4ILCA 5J0ZA 2Y54A 2XNVA 3LSVA 4BFQA 5AFMB 4NZBA 2BYRA 3PEOA 4QABA 5HEUA 2YN6A 3U8JA 2XNUA 3WTOA 4HFEA 4AFHA 3TLUA 5AFNA 2XNTA 5TVCA 3SQ6A 3GUAA 3IGQA 4Z90A 2BR8A 5BW2A 5J5HA 5JMEA 4HQPA 3RIFA 4AFGA 2BR7A 5J5FA 3WTJA 5SYOA 3EAMA 2X00A 5AFJA 3U8NA 2BG9E 3RHWA 4ZZCA
chains in the Genus database with same CATH superfamily
2ZJVA 4TWHA 3UU4A 2BYSA 2WN9A 4FRRA 2XYSA 2XZ6A 3P50A 3ZDGA 4UM3S 4PIRA 4ZK1A 3JAFA 4ZK4A 4F8HA 3RQUA 3EI0A 5KE4A 3C79A 5LXBA 5HEOA 4ZJTA 4UM3A 3WTMA 5HCJA 3T4MA 2XQAA 4QAAA 4HFDA 5HEHA 4A97A 5HCMA 4ILBA 3UUBA 5J5GA 2YMDA 4A98A 2XZ5A 3TLTA 5AFKA 2BJ0A 3WTHA 2PH9A 4D01A 3WTNA 5L4HA 1UV6A 2UZ6A 5HEJA 2BYQA 4ZRUA 3U8MA 4XK9A 4UM1A 2XQ8A 3SIOA 3TLWA 4ZZBA 5CO5A 2X00D 3JAEA 4HFBA 3UU5A 4QH5A 4LMJA 4IREA 4QH1A 2BG9A 3JADA 4ILAA 3TLSA 4B5DA 2C9TA 2XQ4A 4TNWA 2BYPA 5FJVA 2WNJA 2XQ7A 3ZDHA 2W8FA 2XQ6A 2Y57A 3UU8A 4ZR6A 5J5IA 5BP0A 3RQWA 4HFCA 4X5TA 2XYTA 2Y56A 5BRXA 3SQ9A 2BG9C 4IL9A 5AINA 2WNLA 2QC1B 4NPPA 4QH4A 5LG3A 1UX2A 4HFHA 2W8GA 4QACA 2YOEA 4Z91A 4ZJSA 2Y7YA 3RI5A 3PMZA 2VL0A 4BQTA 5L4EA 3SH1A 2BG9B 4UXUA 2XQ9A 3UQ4A 3UU3A 3WTLA 5CFBA 3P4WA 4XHEA 2PGZA 5IUXA 5AFMA 2YMEA 4TNVA 3WTIA 4EZ1A 5AFHA 3C84A 2WZYA 4IL4A 2XQ5A 5AFLA 3ZKRA 4ALXA 4UY2A 5KZUA 1I9BA 3U8LA 4DBMA 5HEGA 2YKSA 4HFIA 4LMKA 3WIPA 4UM3P 4TWFA 5L47A 3UU6A 2ZJUA 3UQ7A 3WTKA 4TWDA 4WV9A 4COFA 3TLVA 3EHZA 4LMLA 2BYNA 2XQ3A 2Y58A 3U8KA 1UW6A 3RIAA 4AFTA 2WNCA 4ILCA 5J0ZA 2Y54A 2XNVA 3LSVA 4BFQA 5AFMB 4NZBA 2BYRA 3PEOA 4QABA 5HEUA 2YN6A 3U8JA 2XNUA 3WTOA 4HFEA 4AFHA 3TLUA 5AFNA 2XNTA 5TVCA 3SQ6A 3GUAA 3IGQA 4Z90A 2BR8A 5BW2A 5J5HA 5JMEA 4HQPA 3RIFA 4AFGA 2BR7A 5J5FA 3WTJA 5SYOA 3EAMA 2X00A 5AFJA 3U8NA 2BG9E 3RHWA 4ZZCA
chains in the Genus database with same CATH topology
2ZJVA 4TWHA 3UU4A 2BYSA 2WN9A 4FRRA 2XYSA 2XZ6A 3P50A 3ZDGA 4UM3S 4PIRA 4ZK1A 3JAFA 4ZK4A 4F8HA 3RQUA 3EI0A 5KE4A 3C79A 5LXBA 5HEOA 4ZJTA 4UM3A 3WTMA 5HCJA 3T4MA 2XQAA 4QAAA 4HFDA 5HEHA 4A97A 5HCMA 4ILBA 3UUBA 5J5GA 2YMDA 4A98A 2XZ5A 3TLTA 5AFKA 2BJ0A 3WTHA 2PH9A 4D01A 3WTNA 5L4HA 1UV6A 2UZ6A 5HEJA 2BYQA 4ZRUA 3U8MA 4XK9A 4UM1A 2XQ8A 3SIOA 3TLWA 4ZZBA 5CO5A 2X00D 3JAEA 4HFBA 3UU5A 4QH5A 4LMJA 4IREA 4QH1A 2BG9A 3JADA 4ILAA 3TLSA 4B5DA 2C9TA 2XQ4A 4TNWA 2BYPA 5FJVA 2WNJA 2XQ7A 3ZDHA 2W8FA 2XQ6A 2Y57A 3UU8A 4ZR6A 5J5IA 5BP0A 3RQWA 4HFCA 4X5TA 2XYTA 2Y56A 5BRXA 3SQ9A 2BG9C 4IL9A 5AINA 2WNLA 2QC1B 4NPPA 4QH4A 5LG3A 1UX2A 4HFHA 2W8GA 4QACA 2YOEA 4Z91A 4ZJSA 2Y7YA 3RI5A 3PMZA 2VL0A 4BQTA 5L4EA 3SH1A 2BG9B 4UXUA 2XQ9A 3UQ4A 3UU3A 3WTLA 5CFBA 3P4WA 4XHEA 2PGZA 5IUXA 5AFMA 2YMEA 4TNVA 3WTIA 4EZ1A 5AFHA 3C84A 2WZYA 4IL4A 2XQ5A 5AFLA 3ZKRA 4ALXA 4UY2A 5KZUA 1I9BA 3U8LA 4DBMA 5HEGA 2YKSA 4HFIA 4LMKA 3WIPA 4UM3P 4TWFA 5L47A 3UU6A 2ZJUA 3UQ7A 3WTKA 4TWDA 4WV9A 4COFA 3TLVA 3EHZA 4LMLA 2BYNA 2XQ3A 2Y58A 3U8KA 1UW6A 3RIAA 4AFTA 2WNCA 4ILCA 5J0ZA 2Y54A 2XNVA 3LSVA 4BFQA 5AFMB 4NZBA 2BYRA 3PEOA 4QABA 5HEUA 2YN6A 3U8JA 2XNUA 3WTOA 4HFEA 4AFHA 3TLUA 5AFNA 2XNTA 5TVCA 3SQ6A 3GUAA 3IGQA 4Z90A 2BR8A 5BW2A 5J5HA 5JMEA 4HQPA 3RIFA 4AFGA 2BR7A 5J5FA 3WTJA 5SYOA 3EAMA 2X00A 5AFJA 3U8NA 2BG9E 3RHWA 4ZZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJV A;  4TWH A;  3UU4 A;  2BYS A;  2WN9 A;  4FRR A;  2XYS A;  2XZ6 A;  3P50 A;  3ZDG A;  4UM3 S;  4PIR A;  4ZK1 A;  3JAF A;  4ZK4 A;  4F8H A;  3RQU A;  3EI0 A;  5KE4 A;  3C79 A;  5LXB A;  5HEO A;  4ZJT A;  4UM3 A;  3WTM A;  5HCJ A;  3T4M A;  2XQA A;  4QAA A;  4HFD A;  5HEH A;  4A97 A;  5HCM A;  4ILB A;  3UUB A;  5J5G A;  2YMD A;  4A98 A;  2XZ5 A;  3TLT A;  5AFK A;  2BJ0 A;  3WTH A;  2PH9 A;  4D01 A;  3WTN A;  5L4H A;  1UV6 A;  2UZ6 A;  5HEJ A;  2BYQ A;  4ZRU A;  3U8M A;  4XK9 A;  4UM1 A;  2XQ8 A;  3SIO A;  3TLW A;  4ZZB A;  5CO5 A;  2X00 D;  3JAE A;  4HFB A;  3UU5 A;  4QH5 A;  4LMJ A;  4IRE A;  4QH1 A;  2BG9 A;  3JAD A;  4ILA A;  3TLS A;  4B5D A;  2C9T A;  2XQ4 A;  4TNW A;  2BYP A;  5FJV A;  2WNJ A;  2XQ7 A;  3ZDH A;  2W8F A;  2XQ6 A;  2Y57 A;  3UU8 A;  4ZR6 A;  5J5I A;  5BP0 A;  3RQW A;  4HFC A;  4X5T A;  2XYT A;  2Y56 A;  5BRX A;  3SQ9 A;  2BG9 C;  4IL9 A;  5AIN A;  2WNL A;  2QC1 B;  4NPP A;  4QH4 A;  5LG3 A;  1UX2 A;  4HFH A;  2W8G A;  4QAC A;  2YOE A;  4Z91 A;  4ZJS A;  2Y7Y A;  3RI5 A;  3PMZ A;  2VL0 A;  4BQT A;  5L4E A;  3SH1 A;  2BG9 B;  4UXU A;  2XQ9 A;  3UQ4 A;  3UU3 A;  3WTL A;  5CFB A;  3P4W A;  4XHE A;  2PGZ A;  5IUX A;  5AFM A;  2YME A;  4TNV A;  3WTI A;  4EZ1 A;  5AFH A;  3C84 A;  2WZY A;  4IL4 A;  2XQ5 A;  5AFL A;  3ZKR A;  4ALX A;  4UY2 A;  5KZU A;  1I9B A;  3U8L A;  4DBM A;  5HEG A;  2YKS A;  4HFI A;  4LMK A;  3WIP A;  4UM3 P;  4TWF A;  5L47 A;  3UU6 A;  2ZJU A;  3UQ7 A;  3WTK A;  4TWD A;  4WV9 A;  4COF A;  3TLV A;  3EHZ A;  4LML A;  2BYN A;  2XQ3 A;  2Y58 A;  3U8K A;  1UW6 A;  3RIA A;  4AFT A;  2WNC A;  4ILC A;  5J0Z A;  2Y54 A;  2XNV A;  3LSV A;  4BFQ A;  5AFM B;  4NZB A;  2BYR A;  3PEO A;  4QAB A;  5HEU A;  2YN6 A;  3U8J A;  2XNU A;  3WTO A;  4HFE A;  4AFH A;  3TLU A;  5AFN A;  2XNT A;  5TVC A;  3SQ6 A;  3GUA A;  3IGQ A;  4Z90 A;  2BR8 A;  5BW2 A;  5J5H A;  5JME A;  4HQP A;  3RIF A;  4AFG A;  2BR7 A;  5J5F A;  3WTJ A;  5SYO A;  3EAM A;  2X00 A;  5AFJ A;  3U8N A;  2BG9 E;  3RHW A;  4ZZC A; 
#chains in the Genus database with same CATH topology
 2ZJV A;  4TWH A;  3UU4 A;  2BYS A;  2WN9 A;  4FRR A;  2XYS A;  2XZ6 A;  3P50 A;  3ZDG A;  4UM3 S;  4PIR A;  4ZK1 A;  3JAF A;  4ZK4 A;  4F8H A;  3RQU A;  3EI0 A;  5KE4 A;  3C79 A;  5LXB A;  5HEO A;  4ZJT A;  4UM3 A;  3WTM A;  5HCJ A;  3T4M A;  2XQA A;  4QAA A;  4HFD A;  5HEH A;  4A97 A;  5HCM A;  4ILB A;  3UUB A;  5J5G A;  2YMD A;  4A98 A;  2XZ5 A;  3TLT A;  5AFK A;  2BJ0 A;  3WTH A;  2PH9 A;  4D01 A;  3WTN A;  5L4H A;  1UV6 A;  2UZ6 A;  5HEJ A;  2BYQ A;  4ZRU A;  3U8M A;  4XK9 A;  4UM1 A;  2XQ8 A;  3SIO A;  3TLW A;  4ZZB A;  5CO5 A;  2X00 D;  3JAE A;  4HFB A;  3UU5 A;  4QH5 A;  4LMJ A;  4IRE A;  4QH1 A;  2BG9 A;  3JAD A;  4ILA A;  3TLS A;  4B5D A;  2C9T A;  2XQ4 A;  4TNW A;  2BYP A;  5FJV A;  2WNJ A;  2XQ7 A;  3ZDH A;  2W8F A;  2XQ6 A;  2Y57 A;  3UU8 A;  4ZR6 A;  5J5I A;  5BP0 A;  3RQW A;  4HFC A;  4X5T A;  2XYT A;  2Y56 A;  5BRX A;  3SQ9 A;  2BG9 C;  4IL9 A;  5AIN A;  2WNL A;  2QC1 B;  4NPP A;  4QH4 A;  5LG3 A;  1UX2 A;  4HFH A;  2W8G A;  4QAC A;  2YOE A;  4Z91 A;  4ZJS A;  2Y7Y A;  3RI5 A;  3PMZ A;  2VL0 A;  4BQT A;  5L4E A;  3SH1 A;  2BG9 B;  4UXU A;  2XQ9 A;  3UQ4 A;  3UU3 A;  3WTL A;  5CFB A;  3P4W A;  4XHE A;  2PGZ A;  5IUX A;  5AFM A;  2YME A;  4TNV A;  3WTI A;  4EZ1 A;  5AFH A;  3C84 A;  2WZY A;  4IL4 A;  2XQ5 A;  5AFL A;  3ZKR A;  4ALX A;  4UY2 A;  5KZU A;  1I9B A;  3U8L A;  4DBM A;  5HEG A;  2YKS A;  4HFI A;  4LMK A;  3WIP A;  4UM3 P;  4TWF A;  5L47 A;  3UU6 A;  2ZJU A;  3UQ7 A;  3WTK A;  4TWD A;  4WV9 A;  4COF A;  3TLV A;  3EHZ A;  4LML A;  2BYN A;  2XQ3 A;  2Y58 A;  3U8K A;  1UW6 A;  3RIA A;  4AFT A;  2WNC A;  4ILC A;  5J0Z A;  2Y54 A;  2XNV A;  3LSV A;  4BFQ A;  5AFM B;  4NZB A;  2BYR A;  3PEO A;  4QAB A;  5HEU A;  2YN6 A;  3U8J A;  2XNU A;  3WTO A;  4HFE A;  4AFH A;  3TLU A;  5AFN A;  2XNT A;  5TVC A;  3SQ6 A;  3GUA A;  3IGQ A;  4Z90 A;  2BR8 A;  5BW2 A;  5J5H A;  5JME A;  4HQP A;  3RIF A;  4AFG A;  2BR7 A;  5J5F A;  3WTJ A;  5SYO A;  3EAM A;  2X00 A;  5AFJ A;  3U8N A;  2BG9 E;  3RHW A;  4ZZC A; 
#chains in the Genus database with same CATH homology
 2ZJV A;  4TWH A;  3UU4 A;  2BYS A;  2WN9 A;  4FRR A;  2XYS A;  2XZ6 A;  3P50 A;  3ZDG A;  4UM3 S;  4PIR A;  4ZK1 A;  3JAF A;  4ZK4 A;  4F8H A;  3RQU A;  3EI0 A;  5KE4 A;  3C79 A;  5LXB A;  5HEO A;  4ZJT A;  4UM3 A;  3WTM A;  5HCJ A;  3T4M A;  2XQA A;  4QAA A;  4HFD A;  5HEH A;  4A97 A;  5HCM A;  4ILB A;  3UUB A;  5J5G A;  2YMD A;  4A98 A;  2XZ5 A;  3TLT A;  5AFK A;  2BJ0 A;  3WTH A;  2PH9 A;  4D01 A;  3WTN A;  5L4H A;  1UV6 A;  2UZ6 A;  5HEJ A;  2BYQ A;  4ZRU A;  3U8M A;  4XK9 A;  4UM1 A;  2XQ8 A;  3SIO A;  3TLW A;  4ZZB A;  5CO5 A;  2X00 D;  3JAE A;  4HFB A;  3UU5 A;  4QH5 A;  4LMJ A;  4IRE A;  4QH1 A;  2BG9 A;  3JAD A;  4ILA A;  3TLS A;  4B5D A;  2C9T A;  2XQ4 A;  4TNW A;  2BYP A;  5FJV A;  2WNJ A;  2XQ7 A;  3ZDH A;  2W8F A;  2XQ6 A;  2Y57 A;  3UU8 A;  4ZR6 A;  5J5I A;  5BP0 A;  3RQW A;  4HFC A;  4X5T A;  2XYT A;  2Y56 A;  5BRX A;  3SQ9 A;  2BG9 C;  4IL9 A;  5AIN A;  2WNL A;  2QC1 B;  4NPP A;  4QH4 A;  5LG3 A;  1UX2 A;  4HFH A;  2W8G A;  4QAC A;  2YOE A;  4Z91 A;  4ZJS A;  2Y7Y A;  3RI5 A;  3PMZ A;  2VL0 A;  4BQT A;  5L4E A;  3SH1 A;  2BG9 B;  4UXU A;  2XQ9 A;  3UQ4 A;  3UU3 A;  3WTL A;  5CFB A;  3P4W A;  4XHE A;  2PGZ A;  5IUX A;  5AFM A;  2YME A;  4TNV A;  3WTI A;  4EZ1 A;  5AFH A;  3C84 A;  2WZY A;  4IL4 A;  2XQ5 A;  5AFL A;  3ZKR A;  4ALX A;  4UY2 A;  5KZU A;  1I9B A;  3U8L A;  4DBM A;  5HEG A;  2YKS A;  4HFI A;  4LMK A;  3WIP A;  4UM3 P;  4TWF A;  5L47 A;  3UU6 A;  2ZJU A;  3UQ7 A;  3WTK A;  4TWD A;  4WV9 A;  4COF A;  3TLV A;  3EHZ A;  4LML A;  2BYN A;  2XQ3 A;  2Y58 A;  3U8K A;  1UW6 A;  3RIA A;  4AFT A;  2WNC A;  4ILC A;  5J0Z A;  2Y54 A;  2XNV A;  3LSV A;  4BFQ A;  5AFM B;  4NZB A;  2BYR A;  3PEO A;  4QAB A;  5HEU A;  2YN6 A;  3U8J A;  2XNU A;  3WTO A;  4HFE A;  4AFH A;  3TLU A;  5AFN A;  2XNT A;  5TVC A;  3SQ6 A;  3GUA A;  3IGQ A;  4Z90 A;  2BR8 A;  5BW2 A;  5J5H A;  5JME A;  4HQP A;  3RIF A;  4AFG A;  2BR7 A;  5J5F A;  3WTJ A;  5SYO A;  3EAM A;  2X00 A;  5AFJ A;  3U8N A;  2BG9 E;  3RHW A;  4ZZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...