3WTJA

Crystal structure of lymnaea stagnalis acetylcholine binding protein complexed with thiacloprid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 47
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtjA00
2VL0A 3TLSA 2WN9A 4HFDA 4BFQA 4UM3A 5KZUA 3WTNA 2XQ8A 2WNCA 3WTKA 5J5IA 5AFMB 5AFNA 2BR7A 2XQ4A 4QABA 2WZYA 4QACA 3TLUA 4XK9A 1I9BA 4ILAA 3U8MA 2YMEA 2W8GA 4AFGA 2XNUA 2QC1B 2X00A 3TLTA 2PH9A 3ZDGA 4ILCA 3SQ9A 5HCMA 4NPPA 2PGZA 4TNWA 5HEOA 2BYRA 4ILBA 4WV9A 1UX2A 3RI5A 5IUXA 4HFIA 2ZJVA 3C84A 4F8HA 4IL4A 4QAAA 3SH1A 5AFKA 4TWFA 3WTLA 4TWDA 5AFLA 2Y54A 3T4MA 2YKSA 2XZ5A 4HQPA 3JAFA 5J5FA 3WTMA 4EZ1A 5L47A 5BW2A 4IL9A 4XHEA 2BG9A 4HFEA 2XQ9A 5BP0A 2BG9C 2WNLA 3UU8A 3IGQA 4ZK4A 3SQ6A 3GUAA 3U8NA 5HEHA 3WTIA 2BR8A 4TWHA 4ZR6A 4IREA 2YMDA 1UV6A 2W8FA 2BYQA 5CFBA 4Z90A 5J5GA 5AFJA 3RQWA 5CO5A 5HCJA 4UM3S 4QH1A 5LXBA 2X00D 3PMZA 5FJVA 3UU6A 3ZKRA 3WIPA 3LSVA 4LMLA 2C9TA 3U8JA 2XQ5A 2XYTA 3SIOA 5LG3A 3P4WA 4X5TA 3RQUA 2XQAA 4UY2A 4ALXA 4A97A 4UM1A 3TLWA 4ZRUA 4ZJTA 4PIRA 5J0ZA 4LMJA 3UQ7A 3EHZA 5AFMA 3RIFA 2XNTA 4UXUA 2BG9E 3EAMA 3P50A 4ZK1A 2XNVA 4UM3P 4B5DA 4QH5A 2YOEA 5L4HA 3WTJA 5L4EA 2XZ6A 4TNVA 4ZJSA 3RIAA 2BYNA 4BQTA 5TVCA 5AFHA 3WTHA 2Y57A 4DBMA 2YN6A 3C79A 3UUBA 2WNJA 4HFCA 2Y7YA 2Y56A 2XQ3A 3JADA 2BYSA 1UW6A 3UU3A 3EI0A 2XQ7A 5AINA 4QH4A 2BG9B 5J5HA 4ZZBA 4A98A 2XQ6A 4AFHA 4LMKA 3JAEA 4NZBA 3RHWA 3U8LA 3TLVA 3UU4A 4ZZCA 3ZDHA 5KE4A 2BJ0A 4D01A 5JMEA 4COFA 3UU5A 4HFBA 4FRRA 4Z91A 5BRXA 2Y58A 2UZ6A 3U8KA 4HFHA 5HEGA 3WTOA 2ZJUA 2XYSA 2BYPA 4AFTA 3PEOA 3UQ4A 5SYOA 5HEJA 5HEUA
chains in the Genus database with same CATH superfamily
2VL0A 3TLSA 2WN9A 4HFDA 4BFQA 4UM3A 5KZUA 3WTNA 2XQ8A 2WNCA 3WTKA 5J5IA 5AFMB 5AFNA 2BR7A 2XQ4A 4QABA 2WZYA 4QACA 3TLUA 4XK9A 1I9BA 4ILAA 3U8MA 2YMEA 2W8GA 4AFGA 2XNUA 2QC1B 2X00A 3TLTA 2PH9A 3ZDGA 4ILCA 3SQ9A 5HCMA 4NPPA 2PGZA 4TNWA 5HEOA 2BYRA 4ILBA 4WV9A 1UX2A 3RI5A 5IUXA 4HFIA 2ZJVA 3C84A 4F8HA 4IL4A 4QAAA 3SH1A 5AFKA 4TWFA 3WTLA 4TWDA 5AFLA 2Y54A 3T4MA 2YKSA 2XZ5A 4HQPA 3JAFA 5J5FA 3WTMA 4EZ1A 5L47A 5BW2A 4IL9A 4XHEA 2BG9A 4HFEA 2XQ9A 5BP0A 2BG9C 2WNLA 3UU8A 3IGQA 4ZK4A 3SQ6A 3GUAA 3U8NA 5HEHA 3WTIA 2BR8A 4TWHA 4ZR6A 4IREA 2YMDA 1UV6A 2W8FA 2BYQA 5CFBA 4Z90A 5J5GA 5AFJA 3RQWA 5CO5A 5HCJA 4UM3S 4QH1A 5LXBA 2X00D 3PMZA 5FJVA 3UU6A 3ZKRA 3WIPA 3LSVA 4LMLA 2C9TA 3U8JA 2XQ5A 2XYTA 3SIOA 5LG3A 3P4WA 4X5TA 3RQUA 2XQAA 4UY2A 4ALXA 4A97A 4UM1A 3TLWA 4ZRUA 4ZJTA 4PIRA 5J0ZA 4LMJA 3UQ7A 3EHZA 5AFMA 3RIFA 2XNTA 4UXUA 2BG9E 3EAMA 3P50A 4ZK1A 2XNVA 4UM3P 4B5DA 4QH5A 2YOEA 5L4HA 3WTJA 5L4EA 2XZ6A 4TNVA 4ZJSA 3RIAA 2BYNA 4BQTA 5TVCA 5AFHA 3WTHA 2Y57A 4DBMA 2YN6A 3C79A 3UUBA 2WNJA 4HFCA 2Y7YA 2Y56A 2XQ3A 3JADA 2BYSA 1UW6A 3UU3A 3EI0A 2XQ7A 5AINA 4QH4A 2BG9B 5J5HA 4ZZBA 4A98A 2XQ6A 4AFHA 4LMKA 3JAEA 4NZBA 3RHWA 3U8LA 3TLVA 3UU4A 4ZZCA 3ZDHA 5KE4A 2BJ0A 4D01A 5JMEA 4COFA 3UU5A 4HFBA 4FRRA 4Z91A 5BRXA 2Y58A 2UZ6A 3U8KA 4HFHA 5HEGA 3WTOA 2ZJUA 2XYSA 2BYPA 4AFTA 3PEOA 3UQ4A 5SYOA 5HEJA 5HEUA
chains in the Genus database with same CATH topology
2VL0A 3TLSA 2WN9A 4HFDA 4BFQA 4UM3A 5KZUA 3WTNA 2XQ8A 2WNCA 3WTKA 5J5IA 5AFMB 5AFNA 2BR7A 2XQ4A 4QABA 2WZYA 4QACA 3TLUA 4XK9A 1I9BA 4ILAA 3U8MA 2YMEA 2W8GA 4AFGA 2XNUA 2QC1B 2X00A 3TLTA 2PH9A 3ZDGA 4ILCA 3SQ9A 5HCMA 4NPPA 2PGZA 4TNWA 5HEOA 2BYRA 4ILBA 4WV9A 1UX2A 3RI5A 5IUXA 4HFIA 2ZJVA 3C84A 4F8HA 4IL4A 4QAAA 3SH1A 5AFKA 4TWFA 3WTLA 4TWDA 5AFLA 2Y54A 3T4MA 2YKSA 2XZ5A 4HQPA 3JAFA 5J5FA 3WTMA 4EZ1A 5L47A 5BW2A 4IL9A 4XHEA 2BG9A 4HFEA 2XQ9A 5BP0A 2BG9C 2WNLA 3UU8A 3IGQA 4ZK4A 3SQ6A 3GUAA 3U8NA 5HEHA 3WTIA 2BR8A 4TWHA 4ZR6A 4IREA 2YMDA 1UV6A 2W8FA 2BYQA 5CFBA 4Z90A 5J5GA 5AFJA 3RQWA 5CO5A 5HCJA 4UM3S 4QH1A 5LXBA 2X00D 3PMZA 5FJVA 3UU6A 3ZKRA 3WIPA 3LSVA 4LMLA 2C9TA 3U8JA 2XQ5A 2XYTA 3SIOA 5LG3A 3P4WA 4X5TA 3RQUA 2XQAA 4UY2A 4ALXA 4A97A 4UM1A 3TLWA 4ZRUA 4ZJTA 4PIRA 5J0ZA 4LMJA 3UQ7A 3EHZA 5AFMA 3RIFA 2XNTA 4UXUA 2BG9E 3EAMA 3P50A 4ZK1A 2XNVA 4UM3P 4B5DA 4QH5A 2YOEA 5L4HA 3WTJA 5L4EA 2XZ6A 4TNVA 4ZJSA 3RIAA 2BYNA 4BQTA 5TVCA 5AFHA 3WTHA 2Y57A 4DBMA 2YN6A 3C79A 3UUBA 2WNJA 4HFCA 2Y7YA 2Y56A 2XQ3A 3JADA 2BYSA 1UW6A 3UU3A 3EI0A 2XQ7A 5AINA 4QH4A 2BG9B 5J5HA 4ZZBA 4A98A 2XQ6A 4AFHA 4LMKA 3JAEA 4NZBA 3RHWA 3U8LA 3TLVA 3UU4A 4ZZCA 3ZDHA 5KE4A 2BJ0A 4D01A 5JMEA 4COFA 3UU5A 4HFBA 4FRRA 4Z91A 5BRXA 2Y58A 2UZ6A 3U8KA 4HFHA 5HEGA 3WTOA 2ZJUA 2XYSA 2BYPA 4AFTA 3PEOA 3UQ4A 5SYOA 5HEJA 5HEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL0 A;  3TLS A;  2WN9 A;  4HFD A;  4BFQ A;  4UM3 A;  5KZU A;  3WTN A;  2XQ8 A;  2WNC A;  3WTK A;  5J5I A;  5AFM B;  5AFN A;  2BR7 A;  2XQ4 A;  4QAB A;  2WZY A;  4QAC A;  3TLU A;  4XK9 A;  1I9B A;  4ILA A;  3U8M A;  2YME A;  2W8G A;  4AFG A;  2XNU A;  2QC1 B;  2X00 A;  3TLT A;  2PH9 A;  3ZDG A;  4ILC A;  3SQ9 A;  5HCM A;  4NPP A;  2PGZ A;  4TNW A;  5HEO A;  2BYR A;  4ILB A;  4WV9 A;  1UX2 A;  3RI5 A;  5IUX A;  4HFI A;  2ZJV A;  3C84 A;  4F8H A;  4IL4 A;  4QAA A;  3SH1 A;  5AFK A;  4TWF A;  3WTL A;  4TWD A;  5AFL A;  2Y54 A;  3T4M A;  2YKS A;  2XZ5 A;  4HQP A;  3JAF A;  5J5F A;  3WTM A;  4EZ1 A;  5L47 A;  5BW2 A;  4IL9 A;  4XHE A;  2BG9 A;  4HFE A;  2XQ9 A;  5BP0 A;  2BG9 C;  2WNL A;  3UU8 A;  3IGQ A;  4ZK4 A;  3SQ6 A;  3GUA A;  3U8N A;  5HEH A;  3WTI A;  2BR8 A;  4TWH A;  4ZR6 A;  4IRE A;  2YMD A;  1UV6 A;  2W8F A;  2BYQ A;  5CFB A;  4Z90 A;  5J5G A;  5AFJ A;  3RQW A;  5CO5 A;  5HCJ A;  4UM3 S;  4QH1 A;  5LXB A;  2X00 D;  3PMZ A;  5FJV A;  3UU6 A;  3ZKR A;  3WIP A;  3LSV A;  4LML A;  2C9T A;  3U8J A;  2XQ5 A;  2XYT A;  3SIO A;  5LG3 A;  3P4W A;  4X5T A;  3RQU A;  2XQA A;  4UY2 A;  4ALX A;  4A97 A;  4UM1 A;  3TLW A;  4ZRU A;  4ZJT A;  4PIR A;  5J0Z A;  4LMJ A;  3UQ7 A;  3EHZ A;  5AFM A;  3RIF A;  2XNT A;  4UXU A;  2BG9 E;  3EAM A;  3P50 A;  4ZK1 A;  2XNV A;  4UM3 P;  4B5D A;  4QH5 A;  2YOE A;  5L4H A;  3WTJ A;  5L4E A;  2XZ6 A;  4TNV A;  4ZJS A;  3RIA A;  2BYN A;  4BQT A;  5TVC A;  5AFH A;  3WTH A;  2Y57 A;  4DBM A;  2YN6 A;  3C79 A;  3UUB A;  2WNJ A;  4HFC A;  2Y7Y A;  2Y56 A;  2XQ3 A;  3JAD A;  2BYS A;  1UW6 A;  3UU3 A;  3EI0 A;  2XQ7 A;  5AIN A;  4QH4 A;  2BG9 B;  5J5H A;  4ZZB A;  4A98 A;  2XQ6 A;  4AFH A;  4LMK A;  3JAE A;  4NZB A;  3RHW A;  3U8L A;  3TLV A;  3UU4 A;  4ZZC A;  3ZDH A;  5KE4 A;  2BJ0 A;  4D01 A;  5JME A;  4COF A;  3UU5 A;  4HFB A;  4FRR A;  4Z91 A;  5BRX A;  2Y58 A;  2UZ6 A;  3U8K A;  4HFH A;  5HEG A;  3WTO A;  2ZJU A;  2XYS A;  2BYP A;  4AFT A;  3PEO A;  3UQ4 A;  5SYO A;  5HEJ A;  5HEU A; 
#chains in the Genus database with same CATH topology
 2VL0 A;  3TLS A;  2WN9 A;  4HFD A;  4BFQ A;  4UM3 A;  5KZU A;  3WTN A;  2XQ8 A;  2WNC A;  3WTK A;  5J5I A;  5AFM B;  5AFN A;  2BR7 A;  2XQ4 A;  4QAB A;  2WZY A;  4QAC A;  3TLU A;  4XK9 A;  1I9B A;  4ILA A;  3U8M A;  2YME A;  2W8G A;  4AFG A;  2XNU A;  2QC1 B;  2X00 A;  3TLT A;  2PH9 A;  3ZDG A;  4ILC A;  3SQ9 A;  5HCM A;  4NPP A;  2PGZ A;  4TNW A;  5HEO A;  2BYR A;  4ILB A;  4WV9 A;  1UX2 A;  3RI5 A;  5IUX A;  4HFI A;  2ZJV A;  3C84 A;  4F8H A;  4IL4 A;  4QAA A;  3SH1 A;  5AFK A;  4TWF A;  3WTL A;  4TWD A;  5AFL A;  2Y54 A;  3T4M A;  2YKS A;  2XZ5 A;  4HQP A;  3JAF A;  5J5F A;  3WTM A;  4EZ1 A;  5L47 A;  5BW2 A;  4IL9 A;  4XHE A;  2BG9 A;  4HFE A;  2XQ9 A;  5BP0 A;  2BG9 C;  2WNL A;  3UU8 A;  3IGQ A;  4ZK4 A;  3SQ6 A;  3GUA A;  3U8N A;  5HEH A;  3WTI A;  2BR8 A;  4TWH A;  4ZR6 A;  4IRE A;  2YMD A;  1UV6 A;  2W8F A;  2BYQ A;  5CFB A;  4Z90 A;  5J5G A;  5AFJ A;  3RQW A;  5CO5 A;  5HCJ A;  4UM3 S;  4QH1 A;  5LXB A;  2X00 D;  3PMZ A;  5FJV A;  3UU6 A;  3ZKR A;  3WIP A;  3LSV A;  4LML A;  2C9T A;  3U8J A;  2XQ5 A;  2XYT A;  3SIO A;  5LG3 A;  3P4W A;  4X5T A;  3RQU A;  2XQA A;  4UY2 A;  4ALX A;  4A97 A;  4UM1 A;  3TLW A;  4ZRU A;  4ZJT A;  4PIR A;  5J0Z A;  4LMJ A;  3UQ7 A;  3EHZ A;  5AFM A;  3RIF A;  2XNT A;  4UXU A;  2BG9 E;  3EAM A;  3P50 A;  4ZK1 A;  2XNV A;  4UM3 P;  4B5D A;  4QH5 A;  2YOE A;  5L4H A;  3WTJ A;  5L4E A;  2XZ6 A;  4TNV A;  4ZJS A;  3RIA A;  2BYN A;  4BQT A;  5TVC A;  5AFH A;  3WTH A;  2Y57 A;  4DBM A;  2YN6 A;  3C79 A;  3UUB A;  2WNJ A;  4HFC A;  2Y7Y A;  2Y56 A;  2XQ3 A;  3JAD A;  2BYS A;  1UW6 A;  3UU3 A;  3EI0 A;  2XQ7 A;  5AIN A;  4QH4 A;  2BG9 B;  5J5H A;  4ZZB A;  4A98 A;  2XQ6 A;  4AFH A;  4LMK A;  3JAE A;  4NZB A;  3RHW A;  3U8L A;  3TLV A;  3UU4 A;  4ZZC A;  3ZDH A;  5KE4 A;  2BJ0 A;  4D01 A;  5JME A;  4COF A;  3UU5 A;  4HFB A;  4FRR A;  4Z91 A;  5BRX A;  2Y58 A;  2UZ6 A;  3U8K A;  4HFH A;  5HEG A;  3WTO A;  2ZJU A;  2XYS A;  2BYP A;  4AFT A;  3PEO A;  3UQ4 A;  5SYO A;  5HEJ A;  5HEU A; 
#chains in the Genus database with same CATH homology
 2VL0 A;  3TLS A;  2WN9 A;  4HFD A;  4BFQ A;  4UM3 A;  5KZU A;  3WTN A;  2XQ8 A;  2WNC A;  3WTK A;  5J5I A;  5AFM B;  5AFN A;  2BR7 A;  2XQ4 A;  4QAB A;  2WZY A;  4QAC A;  3TLU A;  4XK9 A;  1I9B A;  4ILA A;  3U8M A;  2YME A;  2W8G A;  4AFG A;  2XNU A;  2QC1 B;  2X00 A;  3TLT A;  2PH9 A;  3ZDG A;  4ILC A;  3SQ9 A;  5HCM A;  4NPP A;  2PGZ A;  4TNW A;  5HEO A;  2BYR A;  4ILB A;  4WV9 A;  1UX2 A;  3RI5 A;  5IUX A;  4HFI A;  2ZJV A;  3C84 A;  4F8H A;  4IL4 A;  4QAA A;  3SH1 A;  5AFK A;  4TWF A;  3WTL A;  4TWD A;  5AFL A;  2Y54 A;  3T4M A;  2YKS A;  2XZ5 A;  4HQP A;  3JAF A;  5J5F A;  3WTM A;  4EZ1 A;  5L47 A;  5BW2 A;  4IL9 A;  4XHE A;  2BG9 A;  4HFE A;  2XQ9 A;  5BP0 A;  2BG9 C;  2WNL A;  3UU8 A;  3IGQ A;  4ZK4 A;  3SQ6 A;  3GUA A;  3U8N A;  5HEH A;  3WTI A;  2BR8 A;  4TWH A;  4ZR6 A;  4IRE A;  2YMD A;  1UV6 A;  2W8F A;  2BYQ A;  5CFB A;  4Z90 A;  5J5G A;  5AFJ A;  3RQW A;  5CO5 A;  5HCJ A;  4UM3 S;  4QH1 A;  5LXB A;  2X00 D;  3PMZ A;  5FJV A;  3UU6 A;  3ZKR A;  3WIP A;  3LSV A;  4LML A;  2C9T A;  3U8J A;  2XQ5 A;  2XYT A;  3SIO A;  5LG3 A;  3P4W A;  4X5T A;  3RQU A;  2XQA A;  4UY2 A;  4ALX A;  4A97 A;  4UM1 A;  3TLW A;  4ZRU A;  4ZJT A;  4PIR A;  5J0Z A;  4LMJ A;  3UQ7 A;  3EHZ A;  5AFM A;  3RIF A;  2XNT A;  4UXU A;  2BG9 E;  3EAM A;  3P50 A;  4ZK1 A;  2XNV A;  4UM3 P;  4B5D A;  4QH5 A;  2YOE A;  5L4H A;  3WTJ A;  5L4E A;  2XZ6 A;  4TNV A;  4ZJS A;  3RIA A;  2BYN A;  4BQT A;  5TVC A;  5AFH A;  3WTH A;  2Y57 A;  4DBM A;  2YN6 A;  3C79 A;  3UUB A;  2WNJ A;  4HFC A;  2Y7Y A;  2Y56 A;  2XQ3 A;  3JAD A;  2BYS A;  1UW6 A;  3UU3 A;  3EI0 A;  2XQ7 A;  5AIN A;  4QH4 A;  2BG9 B;  5J5H A;  4ZZB A;  4A98 A;  2XQ6 A;  4AFH A;  4LMK A;  3JAE A;  4NZB A;  3RHW A;  3U8L A;  3TLV A;  3UU4 A;  4ZZC A;  3ZDH A;  5KE4 A;  2BJ0 A;  4D01 A;  5JME A;  4COF A;  3UU5 A;  4HFB A;  4FRR A;  4Z91 A;  5BRX A;  2Y58 A;  2UZ6 A;  3U8K A;  4HFH A;  5HEG A;  3WTO A;  2ZJU A;  2XYS A;  2BYP A;  4AFT A;  3PEO A;  3UQ4 A;  5SYO A;  5HEJ A;  5HEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...