4AFGA

Capitella teleta achbp in complex with varenicline
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
NGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAYVEMKYLLALRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords CAPITELLA TELETA ACHBP
publication title Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
pubmed doi rcsb
source organism Capitella teleta
total genus 48
structure length 212
sequence length 212
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4afgA00
2ZJVA 3WTHA 5L4HA 3GUAA 4TWDA 1UW6A 4QH5A 2W8GA 4ILAA 3UU5A 5HEJA 5LXBA 1I9BA 2BYQA 2WNLA 4ZRUA 3TLVA 5JMEA 4QH4A 2PH9A 5AFJA 2XZ6A 5J5HA 4ILCA 2Y54A 4UM3P 5HCJA 5AFKA 4ALXA 4NZBA 4IL9A 4ZK4A 4TWFA 4XK9A 3WTIA 4HFHA 4UXUA 3EHZA 2BG9A 4COFA 3SIOA 2X00A 4HFEA 4B5DA 5AFLA 3JAFA 4A97A 4ZJTA 3U8JA 3P50A 3WTJA 5IUXA 4TNWA 5HEGA 3UU6A 4HFDA 3TLSA 2XQ4A 3TLUA 4HFIA 5BRXA 3SQ6A 3WTOA 2QC1B 3ZKRA 3RIAA 4HQPA 4NPPA 3RHWA 5J5IA 3LSVA 2Y56A 5TVCA 4ZK1A 3SH1A 3C79A 4Z90A 5SYOA 2UZ6A 2XQ9A 3U8MA 2BG9C 3U8KA 4IL4A 5L47A 4A98A 2Y7YA 2XNVA 4TNVA 5AFHA 1UV6A 4ILBA 3JAEA 4UM3A 4ZJSA 2XQ3A 5CO5A 3EI0A 3UU4A 2BR8A 2XQ7A 2YN6A 2BJ0A 2XNTA 2XYSA 3IGQA 1UX2A 4LMKA 4PIRA 2YMDA 4QABA 3RQUA 3RIFA 4DBMA 5KE4A 4UM1A 4UY2A 3UUBA 5J5GA 2BYPA 3WTKA 5J0ZA 5HCMA 3TLWA 4HFBA 4F8HA 5AFMB 5KZUA 3U8LA 2WNJA 5FJVA 4BQTA 4LMJA 3WTNA 3PEOA 2YOEA 2VL0A 4QH1A 4ZZBA 3SQ9A 2XQAA 3WTLA 4UM3S 4LMLA 3TLTA 2BG9E 3T4MA 2ZJUA 5J5FA 5AINA 4Z91A 3RI5A 2BYSA 4D01A 2YMEA 2Y57A 5HEUA 2PGZA 2XQ6A 4AFGA 5BW2A 4EZ1A 3C84A 4ZR6A 3UQ4A 3P4WA 2BG9B 3U8NA 2XQ5A 4HFCA 4QACA 4X5TA 5HEHA 4AFHA 5LG3A 3UQ7A 2W8FA 4FRRA 3WTMA 2WN9A 2XZ5A 4XHEA 2C9TA 3ZDGA 2XYTA 3WIPA 2Y58A 3PMZA 5CFBA 2BR7A 5AFNA 2BYRA 2WZYA 2XNUA 4IREA 5HEOA 4BFQA 5BP0A 2BYNA 2XQ8A 4WV9A 2WNCA 3UU3A 4TWHA 3ZDHA 5L4EA 4QAAA 3EAMA 2X00D 4ZZCA 5AFMA 3RQWA 3UU8A 3JADA 4AFTA 2YKSA
chains in the Genus database with same CATH superfamily
2ZJVA 3WTHA 5L4HA 3GUAA 4TWDA 1UW6A 4QH5A 2W8GA 4ILAA 3UU5A 5HEJA 5LXBA 1I9BA 2BYQA 2WNLA 4ZRUA 3TLVA 5JMEA 4QH4A 2PH9A 5AFJA 2XZ6A 5J5HA 4ILCA 2Y54A 4UM3P 5HCJA 5AFKA 4ALXA 4NZBA 4IL9A 4ZK4A 4TWFA 4XK9A 3WTIA 4HFHA 4UXUA 3EHZA 2BG9A 4COFA 3SIOA 2X00A 4HFEA 4B5DA 5AFLA 3JAFA 4A97A 4ZJTA 3U8JA 3P50A 3WTJA 5IUXA 4TNWA 5HEGA 3UU6A 4HFDA 3TLSA 2XQ4A 3TLUA 4HFIA 5BRXA 3SQ6A 3WTOA 2QC1B 3ZKRA 3RIAA 4HQPA 4NPPA 3RHWA 5J5IA 3LSVA 2Y56A 5TVCA 4ZK1A 3SH1A 3C79A 4Z90A 5SYOA 2UZ6A 2XQ9A 3U8MA 2BG9C 3U8KA 4IL4A 5L47A 4A98A 2Y7YA 2XNVA 4TNVA 5AFHA 1UV6A 4ILBA 3JAEA 4UM3A 4ZJSA 2XQ3A 5CO5A 3EI0A 3UU4A 2BR8A 2XQ7A 2YN6A 2BJ0A 2XNTA 2XYSA 3IGQA 1UX2A 4LMKA 4PIRA 2YMDA 4QABA 3RQUA 3RIFA 4DBMA 5KE4A 4UM1A 4UY2A 3UUBA 5J5GA 2BYPA 3WTKA 5J0ZA 5HCMA 3TLWA 4HFBA 4F8HA 5AFMB 5KZUA 3U8LA 2WNJA 5FJVA 4BQTA 4LMJA 3WTNA 3PEOA 2YOEA 2VL0A 4QH1A 4ZZBA 3SQ9A 2XQAA 3WTLA 4UM3S 4LMLA 3TLTA 2BG9E 3T4MA 2ZJUA 5J5FA 5AINA 4Z91A 3RI5A 2BYSA 4D01A 2YMEA 2Y57A 5HEUA 2PGZA 2XQ6A 4AFGA 5BW2A 4EZ1A 3C84A 4ZR6A 3UQ4A 3P4WA 2BG9B 3U8NA 2XQ5A 4HFCA 4QACA 4X5TA 5HEHA 4AFHA 5LG3A 3UQ7A 2W8FA 4FRRA 3WTMA 2WN9A 2XZ5A 4XHEA 2C9TA 3ZDGA 2XYTA 3WIPA 2Y58A 3PMZA 5CFBA 2BR7A 5AFNA 2BYRA 2WZYA 2XNUA 4IREA 5HEOA 4BFQA 5BP0A 2BYNA 2XQ8A 4WV9A 2WNCA 3UU3A 4TWHA 3ZDHA 5L4EA 4QAAA 3EAMA 2X00D 4ZZCA 5AFMA 3RQWA 3UU8A 3JADA 4AFTA 2YKSA
chains in the Genus database with same CATH topology
2ZJVA 3WTHA 5L4HA 3GUAA 4TWDA 1UW6A 4QH5A 2W8GA 4ILAA 3UU5A 5HEJA 5LXBA 1I9BA 2BYQA 2WNLA 4ZRUA 3TLVA 5JMEA 4QH4A 2PH9A 5AFJA 2XZ6A 5J5HA 4ILCA 2Y54A 4UM3P 5HCJA 5AFKA 4ALXA 4NZBA 4IL9A 4ZK4A 4TWFA 4XK9A 3WTIA 4HFHA 4UXUA 3EHZA 2BG9A 4COFA 3SIOA 2X00A 4HFEA 4B5DA 5AFLA 3JAFA 4A97A 4ZJTA 3U8JA 3P50A 3WTJA 5IUXA 4TNWA 5HEGA 3UU6A 4HFDA 3TLSA 2XQ4A 3TLUA 4HFIA 5BRXA 3SQ6A 3WTOA 2QC1B 3ZKRA 3RIAA 4HQPA 4NPPA 3RHWA 5J5IA 3LSVA 2Y56A 5TVCA 4ZK1A 3SH1A 3C79A 4Z90A 5SYOA 2UZ6A 2XQ9A 3U8MA 2BG9C 3U8KA 4IL4A 5L47A 4A98A 2Y7YA 2XNVA 4TNVA 5AFHA 1UV6A 4ILBA 3JAEA 4UM3A 4ZJSA 2XQ3A 5CO5A 3EI0A 3UU4A 2BR8A 2XQ7A 2YN6A 2BJ0A 2XNTA 2XYSA 3IGQA 1UX2A 4LMKA 4PIRA 2YMDA 4QABA 3RQUA 3RIFA 4DBMA 5KE4A 4UM1A 4UY2A 3UUBA 5J5GA 2BYPA 3WTKA 5J0ZA 5HCMA 3TLWA 4HFBA 4F8HA 5AFMB 5KZUA 3U8LA 2WNJA 5FJVA 4BQTA 4LMJA 3WTNA 3PEOA 2YOEA 2VL0A 4QH1A 4ZZBA 3SQ9A 2XQAA 3WTLA 4UM3S 4LMLA 3TLTA 2BG9E 3T4MA 2ZJUA 5J5FA 5AINA 4Z91A 3RI5A 2BYSA 4D01A 2YMEA 2Y57A 5HEUA 2PGZA 2XQ6A 4AFGA 5BW2A 4EZ1A 3C84A 4ZR6A 3UQ4A 3P4WA 2BG9B 3U8NA 2XQ5A 4HFCA 4QACA 4X5TA 5HEHA 4AFHA 5LG3A 3UQ7A 2W8FA 4FRRA 3WTMA 2WN9A 2XZ5A 4XHEA 2C9TA 3ZDGA 2XYTA 3WIPA 2Y58A 3PMZA 5CFBA 2BR7A 5AFNA 2BYRA 2WZYA 2XNUA 4IREA 5HEOA 4BFQA 5BP0A 2BYNA 2XQ8A 4WV9A 2WNCA 3UU3A 4TWHA 3ZDHA 5L4EA 4QAAA 3EAMA 2X00D 4ZZCA 5AFMA 3RQWA 3UU8A 3JADA 4AFTA 2YKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJV A;  3WTH A;  5L4H A;  3GUA A;  4TWD A;  1UW6 A;  4QH5 A;  2W8G A;  4ILA A;  3UU5 A;  5HEJ A;  5LXB A;  1I9B A;  2BYQ A;  2WNL A;  4ZRU A;  3TLV A;  5JME A;  4QH4 A;  2PH9 A;  5AFJ A;  2XZ6 A;  5J5H A;  4ILC A;  2Y54 A;  4UM3 P;  5HCJ A;  5AFK A;  4ALX A;  4NZB A;  4IL9 A;  4ZK4 A;  4TWF A;  4XK9 A;  3WTI A;  4HFH A;  4UXU A;  3EHZ A;  2BG9 A;  4COF A;  3SIO A;  2X00 A;  4HFE A;  4B5D A;  5AFL A;  3JAF A;  4A97 A;  4ZJT A;  3U8J A;  3P50 A;  3WTJ A;  5IUX A;  4TNW A;  5HEG A;  3UU6 A;  4HFD A;  3TLS A;  2XQ4 A;  3TLU A;  4HFI A;  5BRX A;  3SQ6 A;  3WTO A;  2QC1 B;  3ZKR A;  3RIA A;  4HQP A;  4NPP A;  3RHW A;  5J5I A;  3LSV A;  2Y56 A;  5TVC A;  4ZK1 A;  3SH1 A;  3C79 A;  4Z90 A;  5SYO A;  2UZ6 A;  2XQ9 A;  3U8M A;  2BG9 C;  3U8K A;  4IL4 A;  5L47 A;  4A98 A;  2Y7Y A;  2XNV A;  4TNV A;  5AFH A;  1UV6 A;  4ILB A;  3JAE A;  4UM3 A;  4ZJS A;  2XQ3 A;  5CO5 A;  3EI0 A;  3UU4 A;  2BR8 A;  2XQ7 A;  2YN6 A;  2BJ0 A;  2XNT A;  2XYS A;  3IGQ A;  1UX2 A;  4LMK A;  4PIR A;  2YMD A;  4QAB A;  3RQU A;  3RIF A;  4DBM A;  5KE4 A;  4UM1 A;  4UY2 A;  3UUB A;  5J5G A;  2BYP A;  3WTK A;  5J0Z A;  5HCM A;  3TLW A;  4HFB A;  4F8H A;  5AFM B;  5KZU A;  3U8L A;  2WNJ A;  5FJV A;  4BQT A;  4LMJ A;  3WTN A;  3PEO A;  2YOE A;  2VL0 A;  4QH1 A;  4ZZB A;  3SQ9 A;  2XQA A;  3WTL A;  4UM3 S;  4LML A;  3TLT A;  2BG9 E;  3T4M A;  2ZJU A;  5J5F A;  5AIN A;  4Z91 A;  3RI5 A;  2BYS A;  4D01 A;  2YME A;  2Y57 A;  5HEU A;  2PGZ A;  2XQ6 A;  4AFG A;  5BW2 A;  4EZ1 A;  3C84 A;  4ZR6 A;  3UQ4 A;  3P4W A;  2BG9 B;  3U8N A;  2XQ5 A;  4HFC A;  4QAC A;  4X5T A;  5HEH A;  4AFH A;  5LG3 A;  3UQ7 A;  2W8F A;  4FRR A;  3WTM A;  2WN9 A;  2XZ5 A;  4XHE A;  2C9T A;  3ZDG A;  2XYT A;  3WIP A;  2Y58 A;  3PMZ A;  5CFB A;  2BR7 A;  5AFN A;  2BYR A;  2WZY A;  2XNU A;  4IRE A;  5HEO A;  4BFQ A;  5BP0 A;  2BYN A;  2XQ8 A;  4WV9 A;  2WNC A;  3UU3 A;  4TWH A;  3ZDH A;  5L4E A;  4QAA A;  3EAM A;  2X00 D;  4ZZC A;  5AFM A;  3RQW A;  3UU8 A;  3JAD A;  4AFT A;  2YKS A; 
#chains in the Genus database with same CATH topology
 2ZJV A;  3WTH A;  5L4H A;  3GUA A;  4TWD A;  1UW6 A;  4QH5 A;  2W8G A;  4ILA A;  3UU5 A;  5HEJ A;  5LXB A;  1I9B A;  2BYQ A;  2WNL A;  4ZRU A;  3TLV A;  5JME A;  4QH4 A;  2PH9 A;  5AFJ A;  2XZ6 A;  5J5H A;  4ILC A;  2Y54 A;  4UM3 P;  5HCJ A;  5AFK A;  4ALX A;  4NZB A;  4IL9 A;  4ZK4 A;  4TWF A;  4XK9 A;  3WTI A;  4HFH A;  4UXU A;  3EHZ A;  2BG9 A;  4COF A;  3SIO A;  2X00 A;  4HFE A;  4B5D A;  5AFL A;  3JAF A;  4A97 A;  4ZJT A;  3U8J A;  3P50 A;  3WTJ A;  5IUX A;  4TNW A;  5HEG A;  3UU6 A;  4HFD A;  3TLS A;  2XQ4 A;  3TLU A;  4HFI A;  5BRX A;  3SQ6 A;  3WTO A;  2QC1 B;  3ZKR A;  3RIA A;  4HQP A;  4NPP A;  3RHW A;  5J5I A;  3LSV A;  2Y56 A;  5TVC A;  4ZK1 A;  3SH1 A;  3C79 A;  4Z90 A;  5SYO A;  2UZ6 A;  2XQ9 A;  3U8M A;  2BG9 C;  3U8K A;  4IL4 A;  5L47 A;  4A98 A;  2Y7Y A;  2XNV A;  4TNV A;  5AFH A;  1UV6 A;  4ILB A;  3JAE A;  4UM3 A;  4ZJS A;  2XQ3 A;  5CO5 A;  3EI0 A;  3UU4 A;  2BR8 A;  2XQ7 A;  2YN6 A;  2BJ0 A;  2XNT A;  2XYS A;  3IGQ A;  1UX2 A;  4LMK A;  4PIR A;  2YMD A;  4QAB A;  3RQU A;  3RIF A;  4DBM A;  5KE4 A;  4UM1 A;  4UY2 A;  3UUB A;  5J5G A;  2BYP A;  3WTK A;  5J0Z A;  5HCM A;  3TLW A;  4HFB A;  4F8H A;  5AFM B;  5KZU A;  3U8L A;  2WNJ A;  5FJV A;  4BQT A;  4LMJ A;  3WTN A;  3PEO A;  2YOE A;  2VL0 A;  4QH1 A;  4ZZB A;  3SQ9 A;  2XQA A;  3WTL A;  4UM3 S;  4LML A;  3TLT A;  2BG9 E;  3T4M A;  2ZJU A;  5J5F A;  5AIN A;  4Z91 A;  3RI5 A;  2BYS A;  4D01 A;  2YME A;  2Y57 A;  5HEU A;  2PGZ A;  2XQ6 A;  4AFG A;  5BW2 A;  4EZ1 A;  3C84 A;  4ZR6 A;  3UQ4 A;  3P4W A;  2BG9 B;  3U8N A;  2XQ5 A;  4HFC A;  4QAC A;  4X5T A;  5HEH A;  4AFH A;  5LG3 A;  3UQ7 A;  2W8F A;  4FRR A;  3WTM A;  2WN9 A;  2XZ5 A;  4XHE A;  2C9T A;  3ZDG A;  2XYT A;  3WIP A;  2Y58 A;  3PMZ A;  5CFB A;  2BR7 A;  5AFN A;  2BYR A;  2WZY A;  2XNU A;  4IRE A;  5HEO A;  4BFQ A;  5BP0 A;  2BYN A;  2XQ8 A;  4WV9 A;  2WNC A;  3UU3 A;  4TWH A;  3ZDH A;  5L4E A;  4QAA A;  3EAM A;  2X00 D;  4ZZC A;  5AFM A;  3RQW A;  3UU8 A;  3JAD A;  4AFT A;  2YKS A; 
#chains in the Genus database with same CATH homology
 2ZJV A;  3WTH A;  5L4H A;  3GUA A;  4TWD A;  1UW6 A;  4QH5 A;  2W8G A;  4ILA A;  3UU5 A;  5HEJ A;  5LXB A;  1I9B A;  2BYQ A;  2WNL A;  4ZRU A;  3TLV A;  5JME A;  4QH4 A;  2PH9 A;  5AFJ A;  2XZ6 A;  5J5H A;  4ILC A;  2Y54 A;  4UM3 P;  5HCJ A;  5AFK A;  4ALX A;  4NZB A;  4IL9 A;  4ZK4 A;  4TWF A;  4XK9 A;  3WTI A;  4HFH A;  4UXU A;  3EHZ A;  2BG9 A;  4COF A;  3SIO A;  2X00 A;  4HFE A;  4B5D A;  5AFL A;  3JAF A;  4A97 A;  4ZJT A;  3U8J A;  3P50 A;  3WTJ A;  5IUX A;  4TNW A;  5HEG A;  3UU6 A;  4HFD A;  3TLS A;  2XQ4 A;  3TLU A;  4HFI A;  5BRX A;  3SQ6 A;  3WTO A;  2QC1 B;  3ZKR A;  3RIA A;  4HQP A;  4NPP A;  3RHW A;  5J5I A;  3LSV A;  2Y56 A;  5TVC A;  4ZK1 A;  3SH1 A;  3C79 A;  4Z90 A;  5SYO A;  2UZ6 A;  2XQ9 A;  3U8M A;  2BG9 C;  3U8K A;  4IL4 A;  5L47 A;  4A98 A;  2Y7Y A;  2XNV A;  4TNV A;  5AFH A;  1UV6 A;  4ILB A;  3JAE A;  4UM3 A;  4ZJS A;  2XQ3 A;  5CO5 A;  3EI0 A;  3UU4 A;  2BR8 A;  2XQ7 A;  2YN6 A;  2BJ0 A;  2XNT A;  2XYS A;  3IGQ A;  1UX2 A;  4LMK A;  4PIR A;  2YMD A;  4QAB A;  3RQU A;  3RIF A;  4DBM A;  5KE4 A;  4UM1 A;  4UY2 A;  3UUB A;  5J5G A;  2BYP A;  3WTK A;  5J0Z A;  5HCM A;  3TLW A;  4HFB A;  4F8H A;  5AFM B;  5KZU A;  3U8L A;  2WNJ A;  5FJV A;  4BQT A;  4LMJ A;  3WTN A;  3PEO A;  2YOE A;  2VL0 A;  4QH1 A;  4ZZB A;  3SQ9 A;  2XQA A;  3WTL A;  4UM3 S;  4LML A;  3TLT A;  2BG9 E;  3T4M A;  2ZJU A;  5J5F A;  5AIN A;  4Z91 A;  3RI5 A;  2BYS A;  4D01 A;  2YME A;  2Y57 A;  5HEU A;  2PGZ A;  2XQ6 A;  4AFG A;  5BW2 A;  4EZ1 A;  3C84 A;  4ZR6 A;  3UQ4 A;  3P4W A;  2BG9 B;  3U8N A;  2XQ5 A;  4HFC A;  4QAC A;  4X5T A;  5HEH A;  4AFH A;  5LG3 A;  3UQ7 A;  2W8F A;  4FRR A;  3WTM A;  2WN9 A;  2XZ5 A;  4XHE A;  2C9T A;  3ZDG A;  2XYT A;  3WIP A;  2Y58 A;  3PMZ A;  5CFB A;  2BR7 A;  5AFN A;  2BYR A;  2WZY A;  2XNU A;  4IRE A;  5HEO A;  4BFQ A;  5BP0 A;  2BYN A;  2XQ8 A;  4WV9 A;  2WNC A;  3UU3 A;  4TWH A;  3ZDH A;  5L4E A;  4QAA A;  3EAM A;  2X00 D;  4ZZC A;  5AFM A;  3RQW A;  3UU8 A;  3JAD A;  4AFT A;  2YKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...