4AFGA

Capitella teleta achbp in complex with varenicline
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
NGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAYVEMKYLLALRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPITELLA TELETA ACHBP
publication title Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
pubmed doi rcsb
source organism Capitella teleta
molecule tags Acetylcholine-binding protein
total genus 48
structure length 212
sequence length 212
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4afgA00
2Y57A 2BG9C 4UM3P 2BG9A 4WV9A 5J5GA 3UU5A 3UU8A 4IL9A 2Y58A 4UM3A 5BW2A 4ZK1A 2WZYA 4ZZBA 2XZ5A 5J0ZA 3SQ9A 4A98A 4TNWA 5HEGA 4NPPA 3T4MA 4DBMA 3WTOA 2QC1B 4AFGA 2XNUA 5HCJA 3RIAA 3UU3A 2XQ4A 3WTHA 4F8HA 5CO5A 5HCMA 5HEUA 3RIFA 3WTKA 3SQ6A 2WN9A 5AFKA 3JAFA 4COFA 3UU4A 3WTNA 3RI5A 4ZJTA 4LMJA 5IUXA 4ALXA 2BG9B 4UXUA 5HEHA 2X00D 3SH1A 2Y56A 5J5IA 2Y54A 4ZR6A 2W8FA 5L4EA 3IGQA 5SYOA 3TLTA 3ZKRA 2ZJUA 4LMKA 3GUAA 3WIPA 4HFBA 4QAAA 1UX2A 5FJVA 4HFCA 4AFHA 3UUBA 4UY2A 4TNVA 4UM1A 4ILBA 2XYSA 3JADA 5BRXA 5AINA 3UU6A 2XQ9A 3C79A 4LMLA 4QH5A 4XHEA 4HQPA 3U8NA 4ZJSA 5AFMA 2BR7A 2XQ6A 2XQ5A 5L4HA 3JAEA 3UQ7A 4IREA 3P4WA 4ZK4A 3PEOA 2YOEA 2BYQA 3WTLA 4UM3S 1UV6A 4QH1A 5KE4A 3C84A 3TLSA 4TWHA 4HFEA 3RQUA 2BYNA 4Z90A 5TVCA 2XQAA 3U8LA 4HFIA 3PMZA 5L47A 2BYSA 4TWDA 4AFTA 3ZDGA 2BJ0A 4D01A 5BP0A 2XNVA 2PH9A 4FRRA 4B5DA 4QH4A 3ZDHA 2XYTA 2W8GA 4BQTA 2WNCA 3EHZA 3RQWA 3U8JA 5AFMB 3WTMA 3RHWA 3U8KA 4A97A 5AFJA 5AFLA 5CFBA 4EZ1A 4HFDA 4ILCA 5AFNA 5HEJA 2Y7YA 4IL4A 3EAMA 3UQ4A 5AFHA 2WNLA 4X5TA 2BYRA 2XQ8A 2YMEA 3TLWA 2XNTA 1UW6A 4ILAA 5LXBA 2XZ6A 3SIOA 2YKSA 4ZRUA 2PGZA 4NZBA 5HEOA 5LG3A 3EI0A 2XQ7A 3WTIA 2BG9E 5KZUA 2C9TA 4Z91A 2BR8A 2UZ6A 2X00A 3TLUA 2VL0A 1I9BA 5J5FA 5J5HA 4BFQA 2XQ3A 2WNJA 2BYPA 2ZJVA 2YN6A 3LSVA 3WTJA 4ZZCA 4PIRA 4HFHA 3P50A 4QABA 4XK9A 2YMDA 4TWFA 3TLVA 3U8MA 5JMEA 4QACA
chains in the Genus database with same CATH superfamily
2Y57A 2BG9C 4UM3P 2BG9A 4WV9A 5J5GA 3UU5A 3UU8A 4IL9A 2Y58A 4UM3A 5BW2A 4ZK1A 2WZYA 4ZZBA 2XZ5A 5J0ZA 3SQ9A 4A98A 4TNWA 5HEGA 4NPPA 3T4MA 4DBMA 3WTOA 2QC1B 4AFGA 2XNUA 5HCJA 3RIAA 3UU3A 2XQ4A 3WTHA 4F8HA 5CO5A 5HCMA 5HEUA 3RIFA 3WTKA 3SQ6A 2WN9A 5AFKA 3JAFA 4COFA 3UU4A 3WTNA 3RI5A 4ZJTA 4LMJA 5IUXA 4ALXA 2BG9B 4UXUA 5HEHA 2X00D 3SH1A 2Y56A 5J5IA 2Y54A 4ZR6A 2W8FA 5L4EA 3IGQA 5SYOA 3TLTA 3ZKRA 2ZJUA 4LMKA 3GUAA 3WIPA 4HFBA 4QAAA 1UX2A 5FJVA 4HFCA 4AFHA 3UUBA 4UY2A 4TNVA 4UM1A 4ILBA 2XYSA 3JADA 5BRXA 5AINA 3UU6A 2XQ9A 3C79A 4LMLA 4QH5A 4XHEA 4HQPA 3U8NA 4ZJSA 5AFMA 2BR7A 2XQ6A 2XQ5A 5L4HA 3JAEA 3UQ7A 4IREA 3P4WA 4ZK4A 3PEOA 2YOEA 2BYQA 3WTLA 4UM3S 1UV6A 4QH1A 5KE4A 3C84A 3TLSA 4TWHA 4HFEA 3RQUA 2BYNA 4Z90A 5TVCA 2XQAA 3U8LA 4HFIA 3PMZA 5L47A 2BYSA 4TWDA 4AFTA 3ZDGA 2BJ0A 4D01A 5BP0A 2XNVA 2PH9A 4FRRA 4B5DA 4QH4A 3ZDHA 2XYTA 2W8GA 4BQTA 2WNCA 3EHZA 3RQWA 3U8JA 5AFMB 3WTMA 3RHWA 3U8KA 4A97A 5AFJA 5AFLA 5CFBA 4EZ1A 4HFDA 4ILCA 5AFNA 5HEJA 2Y7YA 4IL4A 3EAMA 3UQ4A 5AFHA 2WNLA 4X5TA 2BYRA 2XQ8A 2YMEA 3TLWA 2XNTA 1UW6A 4ILAA 5LXBA 2XZ6A 3SIOA 2YKSA 4ZRUA 2PGZA 4NZBA 5HEOA 5LG3A 3EI0A 2XQ7A 3WTIA 2BG9E 5KZUA 2C9TA 4Z91A 2BR8A 2UZ6A 2X00A 3TLUA 2VL0A 1I9BA 5J5FA 5J5HA 4BFQA 2XQ3A 2WNJA 2BYPA 2ZJVA 2YN6A 3LSVA 3WTJA 4ZZCA 4PIRA 4HFHA 3P50A 4QABA 4XK9A 2YMDA 4TWFA 3TLVA 3U8MA 5JMEA 4QACA
chains in the Genus database with same CATH topology
2Y57A 2BG9C 4UM3P 2BG9A 4WV9A 5J5GA 3UU5A 3UU8A 4IL9A 2Y58A 4UM3A 5BW2A 4ZK1A 2WZYA 4ZZBA 2XZ5A 5J0ZA 3SQ9A 4A98A 4TNWA 5HEGA 4NPPA 3T4MA 4DBMA 3WTOA 2QC1B 4AFGA 2XNUA 5HCJA 3RIAA 3UU3A 2XQ4A 3WTHA 4F8HA 5CO5A 5HCMA 5HEUA 3RIFA 3WTKA 3SQ6A 2WN9A 5AFKA 3JAFA 4COFA 3UU4A 3WTNA 3RI5A 4ZJTA 4LMJA 5IUXA 4ALXA 2BG9B 4UXUA 5HEHA 2X00D 3SH1A 2Y56A 5J5IA 2Y54A 4ZR6A 2W8FA 5L4EA 3IGQA 5SYOA 3TLTA 3ZKRA 2ZJUA 4LMKA 3GUAA 3WIPA 4HFBA 4QAAA 1UX2A 5FJVA 4HFCA 4AFHA 3UUBA 4UY2A 4TNVA 4UM1A 4ILBA 2XYSA 3JADA 5BRXA 5AINA 3UU6A 2XQ9A 3C79A 4LMLA 4QH5A 4XHEA 4HQPA 3U8NA 4ZJSA 5AFMA 2BR7A 2XQ6A 2XQ5A 5L4HA 3JAEA 3UQ7A 4IREA 3P4WA 4ZK4A 3PEOA 2YOEA 2BYQA 3WTLA 4UM3S 1UV6A 4QH1A 5KE4A 3C84A 3TLSA 4TWHA 4HFEA 3RQUA 2BYNA 4Z90A 5TVCA 2XQAA 3U8LA 4HFIA 3PMZA 5L47A 2BYSA 4TWDA 4AFTA 3ZDGA 2BJ0A 4D01A 5BP0A 2XNVA 2PH9A 4FRRA 4B5DA 4QH4A 3ZDHA 2XYTA 2W8GA 4BQTA 2WNCA 3EHZA 3RQWA 3U8JA 5AFMB 3WTMA 3RHWA 3U8KA 4A97A 5AFJA 5AFLA 5CFBA 4EZ1A 4HFDA 4ILCA 5AFNA 5HEJA 2Y7YA 4IL4A 3EAMA 3UQ4A 5AFHA 2WNLA 4X5TA 2BYRA 2XQ8A 2YMEA 3TLWA 2XNTA 1UW6A 4ILAA 5LXBA 2XZ6A 3SIOA 2YKSA 4ZRUA 2PGZA 4NZBA 5HEOA 5LG3A 3EI0A 2XQ7A 3WTIA 2BG9E 5KZUA 2C9TA 4Z91A 2BR8A 2UZ6A 2X00A 3TLUA 2VL0A 1I9BA 5J5FA 5J5HA 4BFQA 2XQ3A 2WNJA 2BYPA 2ZJVA 2YN6A 3LSVA 3WTJA 4ZZCA 4PIRA 4HFHA 3P50A 4QABA 4XK9A 2YMDA 4TWFA 3TLVA 3U8MA 5JMEA 4QACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y57 A;  2BG9 C;  4UM3 P;  2BG9 A;  4WV9 A;  5J5G A;  3UU5 A;  3UU8 A;  4IL9 A;  2Y58 A;  4UM3 A;  5BW2 A;  4ZK1 A;  2WZY A;  4ZZB A;  2XZ5 A;  5J0Z A;  3SQ9 A;  4A98 A;  4TNW A;  5HEG A;  4NPP A;  3T4M A;  4DBM A;  3WTO A;  2QC1 B;  4AFG A;  2XNU A;  5HCJ A;  3RIA A;  3UU3 A;  2XQ4 A;  3WTH A;  4F8H A;  5CO5 A;  5HCM A;  5HEU A;  3RIF A;  3WTK A;  3SQ6 A;  2WN9 A;  5AFK A;  3JAF A;  4COF A;  3UU4 A;  3WTN A;  3RI5 A;  4ZJT A;  4LMJ A;  5IUX A;  4ALX A;  2BG9 B;  4UXU A;  5HEH A;  2X00 D;  3SH1 A;  2Y56 A;  5J5I A;  2Y54 A;  4ZR6 A;  2W8F A;  5L4E A;  3IGQ A;  5SYO A;  3TLT A;  3ZKR A;  2ZJU A;  4LMK A;  3GUA A;  3WIP A;  4HFB A;  4QAA A;  1UX2 A;  5FJV A;  4HFC A;  4AFH A;  3UUB A;  4UY2 A;  4TNV A;  4UM1 A;  4ILB A;  2XYS A;  3JAD A;  5BRX A;  5AIN A;  3UU6 A;  2XQ9 A;  3C79 A;  4LML A;  4QH5 A;  4XHE A;  4HQP A;  3U8N A;  4ZJS A;  5AFM A;  2BR7 A;  2XQ6 A;  2XQ5 A;  5L4H A;  3JAE A;  3UQ7 A;  4IRE A;  3P4W A;  4ZK4 A;  3PEO A;  2YOE A;  2BYQ A;  3WTL A;  4UM3 S;  1UV6 A;  4QH1 A;  5KE4 A;  3C84 A;  3TLS A;  4TWH A;  4HFE A;  3RQU A;  2BYN A;  4Z90 A;  5TVC A;  2XQA A;  3U8L A;  4HFI A;  3PMZ A;  5L47 A;  2BYS A;  4TWD A;  4AFT A;  3ZDG A;  2BJ0 A;  4D01 A;  5BP0 A;  2XNV A;  2PH9 A;  4FRR A;  4B5D A;  4QH4 A;  3ZDH A;  2XYT A;  2W8G A;  4BQT A;  2WNC A;  3EHZ A;  3RQW A;  3U8J A;  5AFM B;  3WTM A;  3RHW A;  3U8K A;  4A97 A;  5AFJ A;  5AFL A;  5CFB A;  4EZ1 A;  4HFD A;  4ILC A;  5AFN A;  5HEJ A;  2Y7Y A;  4IL4 A;  3EAM A;  3UQ4 A;  5AFH A;  2WNL A;  4X5T A;  2BYR A;  2XQ8 A;  2YME A;  3TLW A;  2XNT A;  1UW6 A;  4ILA A;  5LXB A;  2XZ6 A;  3SIO A;  2YKS A;  4ZRU A;  2PGZ A;  4NZB A;  5HEO A;  5LG3 A;  3EI0 A;  2XQ7 A;  3WTI A;  2BG9 E;  5KZU A;  2C9T A;  4Z91 A;  2BR8 A;  2UZ6 A;  2X00 A;  3TLU A;  2VL0 A;  1I9B A;  5J5F A;  5J5H A;  4BFQ A;  2XQ3 A;  2WNJ A;  2BYP A;  2ZJV A;  2YN6 A;  3LSV A;  3WTJ A;  4ZZC A;  4PIR A;  4HFH A;  3P50 A;  4QAB A;  4XK9 A;  2YMD A;  4TWF A;  3TLV A;  3U8M A;  5JME A;  4QAC A; 
#chains in the Genus database with same CATH topology
 2Y57 A;  2BG9 C;  4UM3 P;  2BG9 A;  4WV9 A;  5J5G A;  3UU5 A;  3UU8 A;  4IL9 A;  2Y58 A;  4UM3 A;  5BW2 A;  4ZK1 A;  2WZY A;  4ZZB A;  2XZ5 A;  5J0Z A;  3SQ9 A;  4A98 A;  4TNW A;  5HEG A;  4NPP A;  3T4M A;  4DBM A;  3WTO A;  2QC1 B;  4AFG A;  2XNU A;  5HCJ A;  3RIA A;  3UU3 A;  2XQ4 A;  3WTH A;  4F8H A;  5CO5 A;  5HCM A;  5HEU A;  3RIF A;  3WTK A;  3SQ6 A;  2WN9 A;  5AFK A;  3JAF A;  4COF A;  3UU4 A;  3WTN A;  3RI5 A;  4ZJT A;  4LMJ A;  5IUX A;  4ALX A;  2BG9 B;  4UXU A;  5HEH A;  2X00 D;  3SH1 A;  2Y56 A;  5J5I A;  2Y54 A;  4ZR6 A;  2W8F A;  5L4E A;  3IGQ A;  5SYO A;  3TLT A;  3ZKR A;  2ZJU A;  4LMK A;  3GUA A;  3WIP A;  4HFB A;  4QAA A;  1UX2 A;  5FJV A;  4HFC A;  4AFH A;  3UUB A;  4UY2 A;  4TNV A;  4UM1 A;  4ILB A;  2XYS A;  3JAD A;  5BRX A;  5AIN A;  3UU6 A;  2XQ9 A;  3C79 A;  4LML A;  4QH5 A;  4XHE A;  4HQP A;  3U8N A;  4ZJS A;  5AFM A;  2BR7 A;  2XQ6 A;  2XQ5 A;  5L4H A;  3JAE A;  3UQ7 A;  4IRE A;  3P4W A;  4ZK4 A;  3PEO A;  2YOE A;  2BYQ A;  3WTL A;  4UM3 S;  1UV6 A;  4QH1 A;  5KE4 A;  3C84 A;  3TLS A;  4TWH A;  4HFE A;  3RQU A;  2BYN A;  4Z90 A;  5TVC A;  2XQA A;  3U8L A;  4HFI A;  3PMZ A;  5L47 A;  2BYS A;  4TWD A;  4AFT A;  3ZDG A;  2BJ0 A;  4D01 A;  5BP0 A;  2XNV A;  2PH9 A;  4FRR A;  4B5D A;  4QH4 A;  3ZDH A;  2XYT A;  2W8G A;  4BQT A;  2WNC A;  3EHZ A;  3RQW A;  3U8J A;  5AFM B;  3WTM A;  3RHW A;  3U8K A;  4A97 A;  5AFJ A;  5AFL A;  5CFB A;  4EZ1 A;  4HFD A;  4ILC A;  5AFN A;  5HEJ A;  2Y7Y A;  4IL4 A;  3EAM A;  3UQ4 A;  5AFH A;  2WNL A;  4X5T A;  2BYR A;  2XQ8 A;  2YME A;  3TLW A;  2XNT A;  1UW6 A;  4ILA A;  5LXB A;  2XZ6 A;  3SIO A;  2YKS A;  4ZRU A;  2PGZ A;  4NZB A;  5HEO A;  5LG3 A;  3EI0 A;  2XQ7 A;  3WTI A;  2BG9 E;  5KZU A;  2C9T A;  4Z91 A;  2BR8 A;  2UZ6 A;  2X00 A;  3TLU A;  2VL0 A;  1I9B A;  5J5F A;  5J5H A;  4BFQ A;  2XQ3 A;  2WNJ A;  2BYP A;  2ZJV A;  2YN6 A;  3LSV A;  3WTJ A;  4ZZC A;  4PIR A;  4HFH A;  3P50 A;  4QAB A;  4XK9 A;  2YMD A;  4TWF A;  3TLV A;  3U8M A;  5JME A;  4QAC A; 
#chains in the Genus database with same CATH homology
 2Y57 A;  2BG9 C;  4UM3 P;  2BG9 A;  4WV9 A;  5J5G A;  3UU5 A;  3UU8 A;  4IL9 A;  2Y58 A;  4UM3 A;  5BW2 A;  4ZK1 A;  2WZY A;  4ZZB A;  2XZ5 A;  5J0Z A;  3SQ9 A;  4A98 A;  4TNW A;  5HEG A;  4NPP A;  3T4M A;  4DBM A;  3WTO A;  2QC1 B;  4AFG A;  2XNU A;  5HCJ A;  3RIA A;  3UU3 A;  2XQ4 A;  3WTH A;  4F8H A;  5CO5 A;  5HCM A;  5HEU A;  3RIF A;  3WTK A;  3SQ6 A;  2WN9 A;  5AFK A;  3JAF A;  4COF A;  3UU4 A;  3WTN A;  3RI5 A;  4ZJT A;  4LMJ A;  5IUX A;  4ALX A;  2BG9 B;  4UXU A;  5HEH A;  2X00 D;  3SH1 A;  2Y56 A;  5J5I A;  2Y54 A;  4ZR6 A;  2W8F A;  5L4E A;  3IGQ A;  5SYO A;  3TLT A;  3ZKR A;  2ZJU A;  4LMK A;  3GUA A;  3WIP A;  4HFB A;  4QAA A;  1UX2 A;  5FJV A;  4HFC A;  4AFH A;  3UUB A;  4UY2 A;  4TNV A;  4UM1 A;  4ILB A;  2XYS A;  3JAD A;  5BRX A;  5AIN A;  3UU6 A;  2XQ9 A;  3C79 A;  4LML A;  4QH5 A;  4XHE A;  4HQP A;  3U8N A;  4ZJS A;  5AFM A;  2BR7 A;  2XQ6 A;  2XQ5 A;  5L4H A;  3JAE A;  3UQ7 A;  4IRE A;  3P4W A;  4ZK4 A;  3PEO A;  2YOE A;  2BYQ A;  3WTL A;  4UM3 S;  1UV6 A;  4QH1 A;  5KE4 A;  3C84 A;  3TLS A;  4TWH A;  4HFE A;  3RQU A;  2BYN A;  4Z90 A;  5TVC A;  2XQA A;  3U8L A;  4HFI A;  3PMZ A;  5L47 A;  2BYS A;  4TWD A;  4AFT A;  3ZDG A;  2BJ0 A;  4D01 A;  5BP0 A;  2XNV A;  2PH9 A;  4FRR A;  4B5D A;  4QH4 A;  3ZDH A;  2XYT A;  2W8G A;  4BQT A;  2WNC A;  3EHZ A;  3RQW A;  3U8J A;  5AFM B;  3WTM A;  3RHW A;  3U8K A;  4A97 A;  5AFJ A;  5AFL A;  5CFB A;  4EZ1 A;  4HFD A;  4ILC A;  5AFN A;  5HEJ A;  2Y7Y A;  4IL4 A;  3EAM A;  3UQ4 A;  5AFH A;  2WNL A;  4X5T A;  2BYR A;  2XQ8 A;  2YME A;  3TLW A;  2XNT A;  1UW6 A;  4ILA A;  5LXB A;  2XZ6 A;  3SIO A;  2YKS A;  4ZRU A;  2PGZ A;  4NZB A;  5HEO A;  5LG3 A;  3EI0 A;  2XQ7 A;  3WTI A;  2BG9 E;  5KZU A;  2C9T A;  4Z91 A;  2BR8 A;  2UZ6 A;  2X00 A;  3TLU A;  2VL0 A;  1I9B A;  5J5F A;  5J5H A;  4BFQ A;  2XQ3 A;  2WNJ A;  2BYP A;  2ZJV A;  2YN6 A;  3LSV A;  3WTJ A;  4ZZC A;  4PIR A;  4HFH A;  3P50 A;  4QAB A;  4XK9 A;  2YMD A;  4TWF A;  3TLV A;  3U8M A;  5JME A;  4QAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...