4UXUA

Crystal structure of the extracellular domain of the human alpha9 nicotinic acetylcholine receptor in complex with methyllycaconitine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
GKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9
publication title Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 48
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4uxuA00
3WTMA 2XYTA 5AFKA 4TNVA 5J5IA 2BYRA 3UQ4A 5J5HA 3WTOA 1UW6A 4ZR6A 3WTHA 2XQ6A 2XQ7A 4XK9A 3IGQA 4ILBA 4Z91A 3UU3A 3RHWA 2PH9A 5KZUA 5AFNA 4QACA 5TVCA 3TLUA 3U8NA 2BR7A 4UXUA 4UM3S 4UM1A 2UZ6A 3JAFA 5AFHA 2ZJUA 3RIFA 5J5FA 5KE4A 4HQPA 5HEHA 3UU5A 4ZK4A 5L4EA 4HFDA 3P50A 3P4WA 2WN9A 5LG3A 2WNJA 4HFBA 4TNWA 4D01A 5J0ZA 2XYSA 2BYNA 3UU6A 5CFBA 4A97A 2YMDA 5HEJA 4ALXA 3WTIA 2BR8A 2QC1B 2YKSA 4ZJSA 4TWDA 3C79A 4AFTA 4TWHA 2BG9B 5BW2A 5AINA 3SH1A 3SQ6A 2BYPA 2X00A 2XQAA 3TLVA 3T4MA 4BFQA 2BG9C 1UX2A 2BG9A 4HFHA 5AFJA 3EAMA 2Y56A 4ZRUA 3WTKA 2Y7YA 4LMJA 5AFLA 2W8FA 4UM3P 3U8KA 4AFHA 5JMEA 3UQ7A 4TWFA 3TLTA 2XZ5A 4PIRA 4Z90A 4ZK1A 4F8HA 4QAAA 2XQ8A 1I9BA 5CO5A 5IUXA 3RI5A 2Y57A 5HCJA 4QH4A 5HCMA 4QABA 4ILAA 4XHEA 5J5GA 4IREA 2BYQA 2XQ3A 3EI0A 4QH1A 4ILCA 4LMKA 4COFA 2XNVA 2BG9E 2WNLA 2YN6A 2C9TA 4FRRA 2BJ0A 4QH5A 4UM3A 4IL9A 3RQWA 3WTLA 3LSVA 5L4HA 2XQ5A 5LXBA 3RQUA 5BRXA 3SQ9A 3C84A 2PGZA 3U8JA 4LMLA 3TLSA 4B5DA 4AFGA 3TLWA 3WTJA 5L47A 3JADA 4UY2A 2WNCA 3SIOA 2X00D 2XQ9A 4NPPA 2BYSA 2XQ4A 4WV9A 4HFIA 2YMEA 3PEOA 5HEGA 3ZDHA 5HEOA 5BP0A 2VL0A 5FJVA 2WZYA 5HEUA 3RIAA 4HFEA 4DBMA 2XNTA 3U8MA 3EHZA 3UU4A 2ZJVA 4IL4A 3UU8A 2YOEA 4ZJTA 2XNUA 4ZZCA 4HFCA 4BQTA 3JAEA 3ZDGA 4X5TA 5SYOA 3U8LA 3UUBA 4A98A 5AFMB 3PMZA 4NZBA 3GUAA 3ZKRA 3WIPA 4ZZBA 2XZ6A 2Y58A 1UV6A 2W8GA 5AFMA 3WTNA 2Y54A 4EZ1A
chains in the Genus database with same CATH superfamily
3WTMA 2XYTA 5AFKA 4TNVA 5J5IA 2BYRA 3UQ4A 5J5HA 3WTOA 1UW6A 4ZR6A 3WTHA 2XQ6A 2XQ7A 4XK9A 3IGQA 4ILBA 4Z91A 3UU3A 3RHWA 2PH9A 5KZUA 5AFNA 4QACA 5TVCA 3TLUA 3U8NA 2BR7A 4UXUA 4UM3S 4UM1A 2UZ6A 3JAFA 5AFHA 2ZJUA 3RIFA 5J5FA 5KE4A 4HQPA 5HEHA 3UU5A 4ZK4A 5L4EA 4HFDA 3P50A 3P4WA 2WN9A 5LG3A 2WNJA 4HFBA 4TNWA 4D01A 5J0ZA 2XYSA 2BYNA 3UU6A 5CFBA 4A97A 2YMDA 5HEJA 4ALXA 3WTIA 2BR8A 2QC1B 2YKSA 4ZJSA 4TWDA 3C79A 4AFTA 4TWHA 2BG9B 5BW2A 5AINA 3SH1A 3SQ6A 2BYPA 2X00A 2XQAA 3TLVA 3T4MA 4BFQA 2BG9C 1UX2A 2BG9A 4HFHA 5AFJA 3EAMA 2Y56A 4ZRUA 3WTKA 2Y7YA 4LMJA 5AFLA 2W8FA 4UM3P 3U8KA 4AFHA 5JMEA 3UQ7A 4TWFA 3TLTA 2XZ5A 4PIRA 4Z90A 4ZK1A 4F8HA 4QAAA 2XQ8A 1I9BA 5CO5A 5IUXA 3RI5A 2Y57A 5HCJA 4QH4A 5HCMA 4QABA 4ILAA 4XHEA 5J5GA 4IREA 2BYQA 2XQ3A 3EI0A 4QH1A 4ILCA 4LMKA 4COFA 2XNVA 2BG9E 2WNLA 2YN6A 2C9TA 4FRRA 2BJ0A 4QH5A 4UM3A 4IL9A 3RQWA 3WTLA 3LSVA 5L4HA 2XQ5A 5LXBA 3RQUA 5BRXA 3SQ9A 3C84A 2PGZA 3U8JA 4LMLA 3TLSA 4B5DA 4AFGA 3TLWA 3WTJA 5L47A 3JADA 4UY2A 2WNCA 3SIOA 2X00D 2XQ9A 4NPPA 2BYSA 2XQ4A 4WV9A 4HFIA 2YMEA 3PEOA 5HEGA 3ZDHA 5HEOA 5BP0A 2VL0A 5FJVA 2WZYA 5HEUA 3RIAA 4HFEA 4DBMA 2XNTA 3U8MA 3EHZA 3UU4A 2ZJVA 4IL4A 3UU8A 2YOEA 4ZJTA 2XNUA 4ZZCA 4HFCA 4BQTA 3JAEA 3ZDGA 4X5TA 5SYOA 3U8LA 3UUBA 4A98A 5AFMB 3PMZA 4NZBA 3GUAA 3ZKRA 3WIPA 4ZZBA 2XZ6A 2Y58A 1UV6A 2W8GA 5AFMA 3WTNA 2Y54A 4EZ1A
chains in the Genus database with same CATH topology
3WTMA 2XYTA 5AFKA 4TNVA 5J5IA 2BYRA 3UQ4A 5J5HA 3WTOA 1UW6A 4ZR6A 3WTHA 2XQ6A 2XQ7A 4XK9A 3IGQA 4ILBA 4Z91A 3UU3A 3RHWA 2PH9A 5KZUA 5AFNA 4QACA 5TVCA 3TLUA 3U8NA 2BR7A 4UXUA 4UM3S 4UM1A 2UZ6A 3JAFA 5AFHA 2ZJUA 3RIFA 5J5FA 5KE4A 4HQPA 5HEHA 3UU5A 4ZK4A 5L4EA 4HFDA 3P50A 3P4WA 2WN9A 5LG3A 2WNJA 4HFBA 4TNWA 4D01A 5J0ZA 2XYSA 2BYNA 3UU6A 5CFBA 4A97A 2YMDA 5HEJA 4ALXA 3WTIA 2BR8A 2QC1B 2YKSA 4ZJSA 4TWDA 3C79A 4AFTA 4TWHA 2BG9B 5BW2A 5AINA 3SH1A 3SQ6A 2BYPA 2X00A 2XQAA 3TLVA 3T4MA 4BFQA 2BG9C 1UX2A 2BG9A 4HFHA 5AFJA 3EAMA 2Y56A 4ZRUA 3WTKA 2Y7YA 4LMJA 5AFLA 2W8FA 4UM3P 3U8KA 4AFHA 5JMEA 3UQ7A 4TWFA 3TLTA 2XZ5A 4PIRA 4Z90A 4ZK1A 4F8HA 4QAAA 2XQ8A 1I9BA 5CO5A 5IUXA 3RI5A 2Y57A 5HCJA 4QH4A 5HCMA 4QABA 4ILAA 4XHEA 5J5GA 4IREA 2BYQA 2XQ3A 3EI0A 4QH1A 4ILCA 4LMKA 4COFA 2XNVA 2BG9E 2WNLA 2YN6A 2C9TA 4FRRA 2BJ0A 4QH5A 4UM3A 4IL9A 3RQWA 3WTLA 3LSVA 5L4HA 2XQ5A 5LXBA 3RQUA 5BRXA 3SQ9A 3C84A 2PGZA 3U8JA 4LMLA 3TLSA 4B5DA 4AFGA 3TLWA 3WTJA 5L47A 3JADA 4UY2A 2WNCA 3SIOA 2X00D 2XQ9A 4NPPA 2BYSA 2XQ4A 4WV9A 4HFIA 2YMEA 3PEOA 5HEGA 3ZDHA 5HEOA 5BP0A 2VL0A 5FJVA 2WZYA 5HEUA 3RIAA 4HFEA 4DBMA 2XNTA 3U8MA 3EHZA 3UU4A 2ZJVA 4IL4A 3UU8A 2YOEA 4ZJTA 2XNUA 4ZZCA 4HFCA 4BQTA 3JAEA 3ZDGA 4X5TA 5SYOA 3U8LA 3UUBA 4A98A 5AFMB 3PMZA 4NZBA 3GUAA 3ZKRA 3WIPA 4ZZBA 2XZ6A 2Y58A 1UV6A 2W8GA 5AFMA 3WTNA 2Y54A 4EZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTM A;  2XYT A;  5AFK A;  4TNV A;  5J5I A;  2BYR A;  3UQ4 A;  5J5H A;  3WTO A;  1UW6 A;  4ZR6 A;  3WTH A;  2XQ6 A;  2XQ7 A;  4XK9 A;  3IGQ A;  4ILB A;  4Z91 A;  3UU3 A;  3RHW A;  2PH9 A;  5KZU A;  5AFN A;  4QAC A;  5TVC A;  3TLU A;  3U8N A;  2BR7 A;  4UXU A;  4UM3 S;  4UM1 A;  2UZ6 A;  3JAF A;  5AFH A;  2ZJU A;  3RIF A;  5J5F A;  5KE4 A;  4HQP A;  5HEH A;  3UU5 A;  4ZK4 A;  5L4E A;  4HFD A;  3P50 A;  3P4W A;  2WN9 A;  5LG3 A;  2WNJ A;  4HFB A;  4TNW A;  4D01 A;  5J0Z A;  2XYS A;  2BYN A;  3UU6 A;  5CFB A;  4A97 A;  2YMD A;  5HEJ A;  4ALX A;  3WTI A;  2BR8 A;  2QC1 B;  2YKS A;  4ZJS A;  4TWD A;  3C79 A;  4AFT A;  4TWH A;  2BG9 B;  5BW2 A;  5AIN A;  3SH1 A;  3SQ6 A;  2BYP A;  2X00 A;  2XQA A;  3TLV A;  3T4M A;  4BFQ A;  2BG9 C;  1UX2 A;  2BG9 A;  4HFH A;  5AFJ A;  3EAM A;  2Y56 A;  4ZRU A;  3WTK A;  2Y7Y A;  4LMJ A;  5AFL A;  2W8F A;  4UM3 P;  3U8K A;  4AFH A;  5JME A;  3UQ7 A;  4TWF A;  3TLT A;  2XZ5 A;  4PIR A;  4Z90 A;  4ZK1 A;  4F8H A;  4QAA A;  2XQ8 A;  1I9B A;  5CO5 A;  5IUX A;  3RI5 A;  2Y57 A;  5HCJ A;  4QH4 A;  5HCM A;  4QAB A;  4ILA A;  4XHE A;  5J5G A;  4IRE A;  2BYQ A;  2XQ3 A;  3EI0 A;  4QH1 A;  4ILC A;  4LMK A;  4COF A;  2XNV A;  2BG9 E;  2WNL A;  2YN6 A;  2C9T A;  4FRR A;  2BJ0 A;  4QH5 A;  4UM3 A;  4IL9 A;  3RQW A;  3WTL A;  3LSV A;  5L4H A;  2XQ5 A;  5LXB A;  3RQU A;  5BRX A;  3SQ9 A;  3C84 A;  2PGZ A;  3U8J A;  4LML A;  3TLS A;  4B5D A;  4AFG A;  3TLW A;  3WTJ A;  5L47 A;  3JAD A;  4UY2 A;  2WNC A;  3SIO A;  2X00 D;  2XQ9 A;  4NPP A;  2BYS A;  2XQ4 A;  4WV9 A;  4HFI A;  2YME A;  3PEO A;  5HEG A;  3ZDH A;  5HEO A;  5BP0 A;  2VL0 A;  5FJV A;  2WZY A;  5HEU A;  3RIA A;  4HFE A;  4DBM A;  2XNT A;  3U8M A;  3EHZ A;  3UU4 A;  2ZJV A;  4IL4 A;  3UU8 A;  2YOE A;  4ZJT A;  2XNU A;  4ZZC A;  4HFC A;  4BQT A;  3JAE A;  3ZDG A;  4X5T A;  5SYO A;  3U8L A;  3UUB A;  4A98 A;  5AFM B;  3PMZ A;  4NZB A;  3GUA A;  3ZKR A;  3WIP A;  4ZZB A;  2XZ6 A;  2Y58 A;  1UV6 A;  2W8G A;  5AFM A;  3WTN A;  2Y54 A;  4EZ1 A; 
#chains in the Genus database with same CATH topology
 3WTM A;  2XYT A;  5AFK A;  4TNV A;  5J5I A;  2BYR A;  3UQ4 A;  5J5H A;  3WTO A;  1UW6 A;  4ZR6 A;  3WTH A;  2XQ6 A;  2XQ7 A;  4XK9 A;  3IGQ A;  4ILB A;  4Z91 A;  3UU3 A;  3RHW A;  2PH9 A;  5KZU A;  5AFN A;  4QAC A;  5TVC A;  3TLU A;  3U8N A;  2BR7 A;  4UXU A;  4UM3 S;  4UM1 A;  2UZ6 A;  3JAF A;  5AFH A;  2ZJU A;  3RIF A;  5J5F A;  5KE4 A;  4HQP A;  5HEH A;  3UU5 A;  4ZK4 A;  5L4E A;  4HFD A;  3P50 A;  3P4W A;  2WN9 A;  5LG3 A;  2WNJ A;  4HFB A;  4TNW A;  4D01 A;  5J0Z A;  2XYS A;  2BYN A;  3UU6 A;  5CFB A;  4A97 A;  2YMD A;  5HEJ A;  4ALX A;  3WTI A;  2BR8 A;  2QC1 B;  2YKS A;  4ZJS A;  4TWD A;  3C79 A;  4AFT A;  4TWH A;  2BG9 B;  5BW2 A;  5AIN A;  3SH1 A;  3SQ6 A;  2BYP A;  2X00 A;  2XQA A;  3TLV A;  3T4M A;  4BFQ A;  2BG9 C;  1UX2 A;  2BG9 A;  4HFH A;  5AFJ A;  3EAM A;  2Y56 A;  4ZRU A;  3WTK A;  2Y7Y A;  4LMJ A;  5AFL A;  2W8F A;  4UM3 P;  3U8K A;  4AFH A;  5JME A;  3UQ7 A;  4TWF A;  3TLT A;  2XZ5 A;  4PIR A;  4Z90 A;  4ZK1 A;  4F8H A;  4QAA A;  2XQ8 A;  1I9B A;  5CO5 A;  5IUX A;  3RI5 A;  2Y57 A;  5HCJ A;  4QH4 A;  5HCM A;  4QAB A;  4ILA A;  4XHE A;  5J5G A;  4IRE A;  2BYQ A;  2XQ3 A;  3EI0 A;  4QH1 A;  4ILC A;  4LMK A;  4COF A;  2XNV A;  2BG9 E;  2WNL A;  2YN6 A;  2C9T A;  4FRR A;  2BJ0 A;  4QH5 A;  4UM3 A;  4IL9 A;  3RQW A;  3WTL A;  3LSV A;  5L4H A;  2XQ5 A;  5LXB A;  3RQU A;  5BRX A;  3SQ9 A;  3C84 A;  2PGZ A;  3U8J A;  4LML A;  3TLS A;  4B5D A;  4AFG A;  3TLW A;  3WTJ A;  5L47 A;  3JAD A;  4UY2 A;  2WNC A;  3SIO A;  2X00 D;  2XQ9 A;  4NPP A;  2BYS A;  2XQ4 A;  4WV9 A;  4HFI A;  2YME A;  3PEO A;  5HEG A;  3ZDH A;  5HEO A;  5BP0 A;  2VL0 A;  5FJV A;  2WZY A;  5HEU A;  3RIA A;  4HFE A;  4DBM A;  2XNT A;  3U8M A;  3EHZ A;  3UU4 A;  2ZJV A;  4IL4 A;  3UU8 A;  2YOE A;  4ZJT A;  2XNU A;  4ZZC A;  4HFC A;  4BQT A;  3JAE A;  3ZDG A;  4X5T A;  5SYO A;  3U8L A;  3UUB A;  4A98 A;  5AFM B;  3PMZ A;  4NZB A;  3GUA A;  3ZKR A;  3WIP A;  4ZZB A;  2XZ6 A;  2Y58 A;  1UV6 A;  2W8G A;  5AFM A;  3WTN A;  2Y54 A;  4EZ1 A; 
#chains in the Genus database with same CATH homology
 3WTM A;  2XYT A;  5AFK A;  4TNV A;  5J5I A;  2BYR A;  3UQ4 A;  5J5H A;  3WTO A;  1UW6 A;  4ZR6 A;  3WTH A;  2XQ6 A;  2XQ7 A;  4XK9 A;  3IGQ A;  4ILB A;  4Z91 A;  3UU3 A;  3RHW A;  2PH9 A;  5KZU A;  5AFN A;  4QAC A;  5TVC A;  3TLU A;  3U8N A;  2BR7 A;  4UXU A;  4UM3 S;  4UM1 A;  2UZ6 A;  3JAF A;  5AFH A;  2ZJU A;  3RIF A;  5J5F A;  5KE4 A;  4HQP A;  5HEH A;  3UU5 A;  4ZK4 A;  5L4E A;  4HFD A;  3P50 A;  3P4W A;  2WN9 A;  5LG3 A;  2WNJ A;  4HFB A;  4TNW A;  4D01 A;  5J0Z A;  2XYS A;  2BYN A;  3UU6 A;  5CFB A;  4A97 A;  2YMD A;  5HEJ A;  4ALX A;  3WTI A;  2BR8 A;  2QC1 B;  2YKS A;  4ZJS A;  4TWD A;  3C79 A;  4AFT A;  4TWH A;  2BG9 B;  5BW2 A;  5AIN A;  3SH1 A;  3SQ6 A;  2BYP A;  2X00 A;  2XQA A;  3TLV A;  3T4M A;  4BFQ A;  2BG9 C;  1UX2 A;  2BG9 A;  4HFH A;  5AFJ A;  3EAM A;  2Y56 A;  4ZRU A;  3WTK A;  2Y7Y A;  4LMJ A;  5AFL A;  2W8F A;  4UM3 P;  3U8K A;  4AFH A;  5JME A;  3UQ7 A;  4TWF A;  3TLT A;  2XZ5 A;  4PIR A;  4Z90 A;  4ZK1 A;  4F8H A;  4QAA A;  2XQ8 A;  1I9B A;  5CO5 A;  5IUX A;  3RI5 A;  2Y57 A;  5HCJ A;  4QH4 A;  5HCM A;  4QAB A;  4ILA A;  4XHE A;  5J5G A;  4IRE A;  2BYQ A;  2XQ3 A;  3EI0 A;  4QH1 A;  4ILC A;  4LMK A;  4COF A;  2XNV A;  2BG9 E;  2WNL A;  2YN6 A;  2C9T A;  4FRR A;  2BJ0 A;  4QH5 A;  4UM3 A;  4IL9 A;  3RQW A;  3WTL A;  3LSV A;  5L4H A;  2XQ5 A;  5LXB A;  3RQU A;  5BRX A;  3SQ9 A;  3C84 A;  2PGZ A;  3U8J A;  4LML A;  3TLS A;  4B5D A;  4AFG A;  3TLW A;  3WTJ A;  5L47 A;  3JAD A;  4UY2 A;  2WNC A;  3SIO A;  2X00 D;  2XQ9 A;  4NPP A;  2BYS A;  2XQ4 A;  4WV9 A;  4HFI A;  2YME A;  3PEO A;  5HEG A;  3ZDH A;  5HEO A;  5BP0 A;  2VL0 A;  5FJV A;  2WZY A;  5HEU A;  3RIA A;  4HFE A;  4DBM A;  2XNT A;  3U8M A;  3EHZ A;  3UU4 A;  2ZJV A;  4IL4 A;  3UU8 A;  2YOE A;  4ZJT A;  2XNU A;  4ZZC A;  4HFC A;  4BQT A;  3JAE A;  3ZDG A;  4X5T A;  5SYO A;  3U8L A;  3UUB A;  4A98 A;  5AFM B;  3PMZ A;  4NZB A;  3GUA A;  3ZKR A;  3WIP A;  4ZZB A;  2XZ6 A;  2Y58 A;  1UV6 A;  2W8G A;  5AFM A;  3WTN A;  2Y54 A;  4EZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...