4UXUA

Crystal structure of the extracellular domain of the human alpha9 nicotinic acetylcholine receptor in complex with methyllycaconitine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
GKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9
publication title Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4uxuA00
2XQ7A 4BQTA 4UY2A 3UUBA 5HEGA 3RQWA 4Z90A 4ILBA 2Y56A 4XK9A 4ZZCA 5FJVA 2BYQA 3SH1A 5HEOA 3WTIA 5BRXA 4TNWA 5J5GA 2XYTA 2YMDA 1UV6A 1UW6A 4ILCA 3TLVA 5BP0A 2PH9A 3P50A 2XQ9A 2BG9E 4HFCA 2BR7A 2ZJVA 4HFEA 4ZK4A 4HQPA 2VL0A 3U8KA 2BR8A 4A98A 4A97A 4LMKA 4XHEA 5LXBA 4UM3S 4QH1A 4PIRA 5JMEA 5KE4A 3LSVA 3WTMA 2WZYA 2BYPA 4AFTA 2XQAA 3WIPA 5AFHA 4LMJA 3UU5A 3EI0A 4IL4A 3WTHA 2XQ5A 4ZRUA 3RHWA 3IGQA 5BW2A 4ILAA 3EAMA 3P4WA 2WNJA 4UM3A 2XQ3A 3U8MA 5AFMB 5HCJA 5HEJA 3UU4A 4F8HA 2QC1B 2WN9A 3WTLA 5L4HA 4LMLA 2Y54A 3U8LA 4EZ1A 4D01A 5J5IA 2WNCA 2Y58A 3WTOA 2XQ6A 5IUXA 2XNTA 3SIOA 4ZJSA 3C79A 4UM3P 5SYOA 4NPPA 4UXUA 5AFJA 4ZK1A 4QACA 5AFMA 5CO5A 2XZ5A 2BYSA 2BYNA 4ZR6A 5AFKA 3JAEA 4HFBA 4ZZBA 2WNLA 4HFHA 5TVCA 2Y57A 3WTJA 4UM1A 3U8JA 2Y7YA 3C84A 2W8FA 3SQ6A 2X00A 5LG3A 3UU6A 3TLSA 2YN6A 3WTKA 3UQ7A 3WTNA 2UZ6A 3TLUA 4COFA 3RQUA 3RIAA 4AFHA 3SQ9A 3ZDHA 4ALXA 5J0ZA 2W8GA 3PMZA 5CFBA 4TWDA 4QABA 5L4EA 4AFGA 2XNVA 3EHZA 3JAFA 5HEHA 3RI5A 2BYRA 3T4MA 2YMEA 2XQ8A 4IL9A 2BG9B 3JADA 4QH5A 3PEOA 3GUAA 4QAAA 5AINA 4FRRA 1UX2A 2XZ6A 3ZKRA 3U8NA 2XYSA 2X00D 5HEUA 3UU3A 5J5HA 5HCMA 4IREA 4B5DA 5AFNA 2XNUA 4HFDA 4DBMA 5AFLA 4X5TA 3UU8A 3RIFA 4Z91A 2XQ4A 3UQ4A 4ZJTA 4HFIA 4TWFA 2C9TA 2BG9A 2PGZA 4NZBA 1I9BA 5J5FA 3TLTA 2YKSA 5L47A 4TNVA 4TWHA 4BFQA 2ZJUA 4WV9A 2BG9C 3ZDGA 4QH4A 2YOEA 5KZUA 2BJ0A 3TLWA
chains in the Genus database with same CATH superfamily
2XQ7A 4BQTA 4UY2A 3UUBA 5HEGA 3RQWA 4Z90A 4ILBA 2Y56A 4XK9A 4ZZCA 5FJVA 2BYQA 3SH1A 5HEOA 3WTIA 5BRXA 4TNWA 5J5GA 2XYTA 2YMDA 1UV6A 1UW6A 4ILCA 3TLVA 5BP0A 2PH9A 3P50A 2XQ9A 2BG9E 4HFCA 2BR7A 2ZJVA 4HFEA 4ZK4A 4HQPA 2VL0A 3U8KA 2BR8A 4A98A 4A97A 4LMKA 4XHEA 5LXBA 4UM3S 4QH1A 4PIRA 5JMEA 5KE4A 3LSVA 3WTMA 2WZYA 2BYPA 4AFTA 2XQAA 3WIPA 5AFHA 4LMJA 3UU5A 3EI0A 4IL4A 3WTHA 2XQ5A 4ZRUA 3RHWA 3IGQA 5BW2A 4ILAA 3EAMA 3P4WA 2WNJA 4UM3A 2XQ3A 3U8MA 5AFMB 5HCJA 5HEJA 3UU4A 4F8HA 2QC1B 2WN9A 3WTLA 5L4HA 4LMLA 2Y54A 3U8LA 4EZ1A 4D01A 5J5IA 2WNCA 2Y58A 3WTOA 2XQ6A 5IUXA 2XNTA 3SIOA 4ZJSA 3C79A 4UM3P 5SYOA 4NPPA 4UXUA 5AFJA 4ZK1A 4QACA 5AFMA 5CO5A 2XZ5A 2BYSA 2BYNA 4ZR6A 5AFKA 3JAEA 4HFBA 4ZZBA 2WNLA 4HFHA 5TVCA 2Y57A 3WTJA 4UM1A 3U8JA 2Y7YA 3C84A 2W8FA 3SQ6A 2X00A 5LG3A 3UU6A 3TLSA 2YN6A 3WTKA 3UQ7A 3WTNA 2UZ6A 3TLUA 4COFA 3RQUA 3RIAA 4AFHA 3SQ9A 3ZDHA 4ALXA 5J0ZA 2W8GA 3PMZA 5CFBA 4TWDA 4QABA 5L4EA 4AFGA 2XNVA 3EHZA 3JAFA 5HEHA 3RI5A 2BYRA 3T4MA 2YMEA 2XQ8A 4IL9A 2BG9B 3JADA 4QH5A 3PEOA 3GUAA 4QAAA 5AINA 4FRRA 1UX2A 2XZ6A 3ZKRA 3U8NA 2XYSA 2X00D 5HEUA 3UU3A 5J5HA 5HCMA 4IREA 4B5DA 5AFNA 2XNUA 4HFDA 4DBMA 5AFLA 4X5TA 3UU8A 3RIFA 4Z91A 2XQ4A 3UQ4A 4ZJTA 4HFIA 4TWFA 2C9TA 2BG9A 2PGZA 4NZBA 1I9BA 5J5FA 3TLTA 2YKSA 5L47A 4TNVA 4TWHA 4BFQA 2ZJUA 4WV9A 2BG9C 3ZDGA 4QH4A 2YOEA 5KZUA 2BJ0A 3TLWA
chains in the Genus database with same CATH topology
2XQ7A 4BQTA 4UY2A 3UUBA 5HEGA 3RQWA 4Z90A 4ILBA 2Y56A 4XK9A 4ZZCA 5FJVA 2BYQA 3SH1A 5HEOA 3WTIA 5BRXA 4TNWA 5J5GA 2XYTA 2YMDA 1UV6A 1UW6A 4ILCA 3TLVA 5BP0A 2PH9A 3P50A 2XQ9A 2BG9E 4HFCA 2BR7A 2ZJVA 4HFEA 4ZK4A 4HQPA 2VL0A 3U8KA 2BR8A 4A98A 4A97A 4LMKA 4XHEA 5LXBA 4UM3S 4QH1A 4PIRA 5JMEA 5KE4A 3LSVA 3WTMA 2WZYA 2BYPA 4AFTA 2XQAA 3WIPA 5AFHA 4LMJA 3UU5A 3EI0A 4IL4A 3WTHA 2XQ5A 4ZRUA 3RHWA 3IGQA 5BW2A 4ILAA 3EAMA 3P4WA 2WNJA 4UM3A 2XQ3A 3U8MA 5AFMB 5HCJA 5HEJA 3UU4A 4F8HA 2QC1B 2WN9A 3WTLA 5L4HA 4LMLA 2Y54A 3U8LA 4EZ1A 4D01A 5J5IA 2WNCA 2Y58A 3WTOA 2XQ6A 5IUXA 2XNTA 3SIOA 4ZJSA 3C79A 4UM3P 5SYOA 4NPPA 4UXUA 5AFJA 4ZK1A 4QACA 5AFMA 5CO5A 2XZ5A 2BYSA 2BYNA 4ZR6A 5AFKA 3JAEA 4HFBA 4ZZBA 2WNLA 4HFHA 5TVCA 2Y57A 3WTJA 4UM1A 3U8JA 2Y7YA 3C84A 2W8FA 3SQ6A 2X00A 5LG3A 3UU6A 3TLSA 2YN6A 3WTKA 3UQ7A 3WTNA 2UZ6A 3TLUA 4COFA 3RQUA 3RIAA 4AFHA 3SQ9A 3ZDHA 4ALXA 5J0ZA 2W8GA 3PMZA 5CFBA 4TWDA 4QABA 5L4EA 4AFGA 2XNVA 3EHZA 3JAFA 5HEHA 3RI5A 2BYRA 3T4MA 2YMEA 2XQ8A 4IL9A 2BG9B 3JADA 4QH5A 3PEOA 3GUAA 4QAAA 5AINA 4FRRA 1UX2A 2XZ6A 3ZKRA 3U8NA 2XYSA 2X00D 5HEUA 3UU3A 5J5HA 5HCMA 4IREA 4B5DA 5AFNA 2XNUA 4HFDA 4DBMA 5AFLA 4X5TA 3UU8A 3RIFA 4Z91A 2XQ4A 3UQ4A 4ZJTA 4HFIA 4TWFA 2C9TA 2BG9A 2PGZA 4NZBA 1I9BA 5J5FA 3TLTA 2YKSA 5L47A 4TNVA 4TWHA 4BFQA 2ZJUA 4WV9A 2BG9C 3ZDGA 4QH4A 2YOEA 5KZUA 2BJ0A 3TLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ7 A;  4BQT A;  4UY2 A;  3UUB A;  5HEG A;  3RQW A;  4Z90 A;  4ILB A;  2Y56 A;  4XK9 A;  4ZZC A;  5FJV A;  2BYQ A;  3SH1 A;  5HEO A;  3WTI A;  5BRX A;  4TNW A;  5J5G A;  2XYT A;  2YMD A;  1UV6 A;  1UW6 A;  4ILC A;  3TLV A;  5BP0 A;  2PH9 A;  3P50 A;  2XQ9 A;  2BG9 E;  4HFC A;  2BR7 A;  2ZJV A;  4HFE A;  4ZK4 A;  4HQP A;  2VL0 A;  3U8K A;  2BR8 A;  4A98 A;  4A97 A;  4LMK A;  4XHE A;  5LXB A;  4UM3 S;  4QH1 A;  4PIR A;  5JME A;  5KE4 A;  3LSV A;  3WTM A;  2WZY A;  2BYP A;  4AFT A;  2XQA A;  3WIP A;  5AFH A;  4LMJ A;  3UU5 A;  3EI0 A;  4IL4 A;  3WTH A;  2XQ5 A;  4ZRU A;  3RHW A;  3IGQ A;  5BW2 A;  4ILA A;  3EAM A;  3P4W A;  2WNJ A;  4UM3 A;  2XQ3 A;  3U8M A;  5AFM B;  5HCJ A;  5HEJ A;  3UU4 A;  4F8H A;  2QC1 B;  2WN9 A;  3WTL A;  5L4H A;  4LML A;  2Y54 A;  3U8L A;  4EZ1 A;  4D01 A;  5J5I A;  2WNC A;  2Y58 A;  3WTO A;  2XQ6 A;  5IUX A;  2XNT A;  3SIO A;  4ZJS A;  3C79 A;  4UM3 P;  5SYO A;  4NPP A;  4UXU A;  5AFJ A;  4ZK1 A;  4QAC A;  5AFM A;  5CO5 A;  2XZ5 A;  2BYS A;  2BYN A;  4ZR6 A;  5AFK A;  3JAE A;  4HFB A;  4ZZB A;  2WNL A;  4HFH A;  5TVC A;  2Y57 A;  3WTJ A;  4UM1 A;  3U8J A;  2Y7Y A;  3C84 A;  2W8F A;  3SQ6 A;  2X00 A;  5LG3 A;  3UU6 A;  3TLS A;  2YN6 A;  3WTK A;  3UQ7 A;  3WTN A;  2UZ6 A;  3TLU A;  4COF A;  3RQU A;  3RIA A;  4AFH A;  3SQ9 A;  3ZDH A;  4ALX A;  5J0Z A;  2W8G A;  3PMZ A;  5CFB A;  4TWD A;  4QAB A;  5L4E A;  4AFG A;  2XNV A;  3EHZ A;  3JAF A;  5HEH A;  3RI5 A;  2BYR A;  3T4M A;  2YME A;  2XQ8 A;  4IL9 A;  2BG9 B;  3JAD A;  4QH5 A;  3PEO A;  3GUA A;  4QAA A;  5AIN A;  4FRR A;  1UX2 A;  2XZ6 A;  3ZKR A;  3U8N A;  2XYS A;  2X00 D;  5HEU A;  3UU3 A;  5J5H A;  5HCM A;  4IRE A;  4B5D A;  5AFN A;  2XNU A;  4HFD A;  4DBM A;  5AFL A;  4X5T A;  3UU8 A;  3RIF A;  4Z91 A;  2XQ4 A;  3UQ4 A;  4ZJT A;  4HFI A;  4TWF A;  2C9T A;  2BG9 A;  2PGZ A;  4NZB A;  1I9B A;  5J5F A;  3TLT A;  2YKS A;  5L47 A;  4TNV A;  4TWH A;  4BFQ A;  2ZJU A;  4WV9 A;  2BG9 C;  3ZDG A;  4QH4 A;  2YOE A;  5KZU A;  2BJ0 A;  3TLW A; 
#chains in the Genus database with same CATH topology
 2XQ7 A;  4BQT A;  4UY2 A;  3UUB A;  5HEG A;  3RQW A;  4Z90 A;  4ILB A;  2Y56 A;  4XK9 A;  4ZZC A;  5FJV A;  2BYQ A;  3SH1 A;  5HEO A;  3WTI A;  5BRX A;  4TNW A;  5J5G A;  2XYT A;  2YMD A;  1UV6 A;  1UW6 A;  4ILC A;  3TLV A;  5BP0 A;  2PH9 A;  3P50 A;  2XQ9 A;  2BG9 E;  4HFC A;  2BR7 A;  2ZJV A;  4HFE A;  4ZK4 A;  4HQP A;  2VL0 A;  3U8K A;  2BR8 A;  4A98 A;  4A97 A;  4LMK A;  4XHE A;  5LXB A;  4UM3 S;  4QH1 A;  4PIR A;  5JME A;  5KE4 A;  3LSV A;  3WTM A;  2WZY A;  2BYP A;  4AFT A;  2XQA A;  3WIP A;  5AFH A;  4LMJ A;  3UU5 A;  3EI0 A;  4IL4 A;  3WTH A;  2XQ5 A;  4ZRU A;  3RHW A;  3IGQ A;  5BW2 A;  4ILA A;  3EAM A;  3P4W A;  2WNJ A;  4UM3 A;  2XQ3 A;  3U8M A;  5AFM B;  5HCJ A;  5HEJ A;  3UU4 A;  4F8H A;  2QC1 B;  2WN9 A;  3WTL A;  5L4H A;  4LML A;  2Y54 A;  3U8L A;  4EZ1 A;  4D01 A;  5J5I A;  2WNC A;  2Y58 A;  3WTO A;  2XQ6 A;  5IUX A;  2XNT A;  3SIO A;  4ZJS A;  3C79 A;  4UM3 P;  5SYO A;  4NPP A;  4UXU A;  5AFJ A;  4ZK1 A;  4QAC A;  5AFM A;  5CO5 A;  2XZ5 A;  2BYS A;  2BYN A;  4ZR6 A;  5AFK A;  3JAE A;  4HFB A;  4ZZB A;  2WNL A;  4HFH A;  5TVC A;  2Y57 A;  3WTJ A;  4UM1 A;  3U8J A;  2Y7Y A;  3C84 A;  2W8F A;  3SQ6 A;  2X00 A;  5LG3 A;  3UU6 A;  3TLS A;  2YN6 A;  3WTK A;  3UQ7 A;  3WTN A;  2UZ6 A;  3TLU A;  4COF A;  3RQU A;  3RIA A;  4AFH A;  3SQ9 A;  3ZDH A;  4ALX A;  5J0Z A;  2W8G A;  3PMZ A;  5CFB A;  4TWD A;  4QAB A;  5L4E A;  4AFG A;  2XNV A;  3EHZ A;  3JAF A;  5HEH A;  3RI5 A;  2BYR A;  3T4M A;  2YME A;  2XQ8 A;  4IL9 A;  2BG9 B;  3JAD A;  4QH5 A;  3PEO A;  3GUA A;  4QAA A;  5AIN A;  4FRR A;  1UX2 A;  2XZ6 A;  3ZKR A;  3U8N A;  2XYS A;  2X00 D;  5HEU A;  3UU3 A;  5J5H A;  5HCM A;  4IRE A;  4B5D A;  5AFN A;  2XNU A;  4HFD A;  4DBM A;  5AFL A;  4X5T A;  3UU8 A;  3RIF A;  4Z91 A;  2XQ4 A;  3UQ4 A;  4ZJT A;  4HFI A;  4TWF A;  2C9T A;  2BG9 A;  2PGZ A;  4NZB A;  1I9B A;  5J5F A;  3TLT A;  2YKS A;  5L47 A;  4TNV A;  4TWH A;  4BFQ A;  2ZJU A;  4WV9 A;  2BG9 C;  3ZDG A;  4QH4 A;  2YOE A;  5KZU A;  2BJ0 A;  3TLW A; 
#chains in the Genus database with same CATH homology
 2XQ7 A;  4BQT A;  4UY2 A;  3UUB A;  5HEG A;  3RQW A;  4Z90 A;  4ILB A;  2Y56 A;  4XK9 A;  4ZZC A;  5FJV A;  2BYQ A;  3SH1 A;  5HEO A;  3WTI A;  5BRX A;  4TNW A;  5J5G A;  2XYT A;  2YMD A;  1UV6 A;  1UW6 A;  4ILC A;  3TLV A;  5BP0 A;  2PH9 A;  3P50 A;  2XQ9 A;  2BG9 E;  4HFC A;  2BR7 A;  2ZJV A;  4HFE A;  4ZK4 A;  4HQP A;  2VL0 A;  3U8K A;  2BR8 A;  4A98 A;  4A97 A;  4LMK A;  4XHE A;  5LXB A;  4UM3 S;  4QH1 A;  4PIR A;  5JME A;  5KE4 A;  3LSV A;  3WTM A;  2WZY A;  2BYP A;  4AFT A;  2XQA A;  3WIP A;  5AFH A;  4LMJ A;  3UU5 A;  3EI0 A;  4IL4 A;  3WTH A;  2XQ5 A;  4ZRU A;  3RHW A;  3IGQ A;  5BW2 A;  4ILA A;  3EAM A;  3P4W A;  2WNJ A;  4UM3 A;  2XQ3 A;  3U8M A;  5AFM B;  5HCJ A;  5HEJ A;  3UU4 A;  4F8H A;  2QC1 B;  2WN9 A;  3WTL A;  5L4H A;  4LML A;  2Y54 A;  3U8L A;  4EZ1 A;  4D01 A;  5J5I A;  2WNC A;  2Y58 A;  3WTO A;  2XQ6 A;  5IUX A;  2XNT A;  3SIO A;  4ZJS A;  3C79 A;  4UM3 P;  5SYO A;  4NPP A;  4UXU A;  5AFJ A;  4ZK1 A;  4QAC A;  5AFM A;  5CO5 A;  2XZ5 A;  2BYS A;  2BYN A;  4ZR6 A;  5AFK A;  3JAE A;  4HFB A;  4ZZB A;  2WNL A;  4HFH A;  5TVC A;  2Y57 A;  3WTJ A;  4UM1 A;  3U8J A;  2Y7Y A;  3C84 A;  2W8F A;  3SQ6 A;  2X00 A;  5LG3 A;  3UU6 A;  3TLS A;  2YN6 A;  3WTK A;  3UQ7 A;  3WTN A;  2UZ6 A;  3TLU A;  4COF A;  3RQU A;  3RIA A;  4AFH A;  3SQ9 A;  3ZDH A;  4ALX A;  5J0Z A;  2W8G A;  3PMZ A;  5CFB A;  4TWD A;  4QAB A;  5L4E A;  4AFG A;  2XNV A;  3EHZ A;  3JAF A;  5HEH A;  3RI5 A;  2BYR A;  3T4M A;  2YME A;  2XQ8 A;  4IL9 A;  2BG9 B;  3JAD A;  4QH5 A;  3PEO A;  3GUA A;  4QAA A;  5AIN A;  4FRR A;  1UX2 A;  2XZ6 A;  3ZKR A;  3U8N A;  2XYS A;  2X00 D;  5HEU A;  3UU3 A;  5J5H A;  5HCM A;  4IRE A;  4B5D A;  5AFN A;  2XNU A;  4HFD A;  4DBM A;  5AFL A;  4X5T A;  3UU8 A;  3RIF A;  4Z91 A;  2XQ4 A;  3UQ4 A;  4ZJT A;  4HFI A;  4TWF A;  2C9T A;  2BG9 A;  2PGZ A;  4NZB A;  1I9B A;  5J5F A;  3TLT A;  2YKS A;  5L47 A;  4TNV A;  4TWH A;  4BFQ A;  2ZJU A;  4WV9 A;  2BG9 C;  3ZDG A;  4QH4 A;  2YOE A;  5KZU A;  2BJ0 A;  3TLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...