3UU4A

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in the crystal in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu4A01
3ZDGA 5J5GA 2XQ6A 4ZR6A 2BJ0A 2W8GA 3PMZA 4UXUA 4F8HA 4TNVA 1UW6A 5CO5A 3SIOA 4HFIA 3WTJA 5J5HA 4ZJSA 2Y7YA 2LKHA 3IGQA 2BG9A 5HEGA 3RQWA 5AINA 3TLSA 4XK9A 5AFMB 2XQ8A 5CFBA 5HCJA 5LXBA 4UM3P 3UQ4A 3TLWA 5AFNA 4ZZCA 2BG9C 2WN9A 2ZJVA 4TWFA 2X00D 3SH1A 3U8JA 4COFA 4XHEA 4UM3S 5L47A 4ILBA 3U8NA 5IUXA 5HEJA 5LG3A 5HEUA 4UM3A 5JMEA 3JAEA 2XQ5A 3PEOA 5HEHA 4D01A 1OEDE 2W8FA 4IREA 2PH9A 5BRXA 4HQPA 2BG9E 2YN6A 3EHZA 4X5TA 4IL4A 2WNJA 3WTNA 3UU4A 3UU6A 2Y56A 1UV6A 4UY2A 3RIFA 4LMLA 4Z90A 4AFTA 2LM2A 3EAMA 3P50A 4HFDA 4LMKA 5TVCA 2KSRA 2YMEA 4HFCA 2M6IA 5J5FA 1UX2A 4DBMA 2WNCA 2XZ5A 4QH4A 3TLTA 3ZDHA 3C79A 3RQUA 3SQ6A 3WTHA 4QACA 3JADA 4AFHA 4LMJA 4ZJTA 3JAFA 3UQ7A 4ZK1A 5J5IA 1OEDA 2BYPA 2ZJUA 3EI0A 4PIRA 4BFQA 3U8KA 2LLYA 3WTIA 4IL9A 2XYSA 3GUAA 4B5DA 2LKGA 5FJVA 2C9TA 2XNTA 2XQ3A 3UU8A 4TWDA 2YKSA 2XZ6A 2XQAA 4ZRUA 5L4HA 4QH5A 4ILCA 2PGZA 4Z91A 5AFKA 1OEDC 4QH1A 2BG9B 4NZBA 3RHWA 3P4WA 1I9BA 4AFGA 2BYSA 3UUBA 3C84A 2Y54A 4A97A 2YOEA 2BYNA 5L4EA 5HCMA 5HEOA 2Y57A 2WNLA 3TLUA 5SYOA 2BR7A 1OEDB 3SQ9A 2XYTA 4WV9A 4NPPA 5AFJA 4ALXA 5BW2A 3RIAA 3TLVA 3UU5A 2Y58A 5AFMA 2MAWA 4HFEA 2BYRA 5KE4A 5KZUA 4ZZBA 3WIPA 3LSVA 4EZ1A 3WTLA 4QAAA 2M6BA 3ZKRA 4A98A 3T4MA 2BYQA 4FRRA 4QABA 2VL0A 4HFBA 2XNVA 4ZK4A 3WTKA 3U8MA 2QC1B 3WTMA 5AFHA 2X00A 3RI5A 5J0ZA 2XQ7A 2YMDA 4TNWA 2BR8A 4UM1A 5AFLA 4TWHA 3U8LA 4HFHA 4ILAA 4BQTA 2XQ4A 3WTOA 2UZ6A 3UU3A 2WZYA 2XNUA 5BP0A 2XQ9A
chains in the Genus database with same CATH superfamily
1JNRA 2D2SA 1UK5A 5LBQB 4LF9T 2DLRA 1ZV4X 4IIJE 5CO5A 3L39A 3IGQA 5HXHA 3RYIE 4K0UA 1UCUA 3M3ZB 3NWIA 2SPCA 2JQKA 1T7SA 5AQQB 5FY0A 5AQMB 3AAIA 4ZI3C 3AEDA 5JDLA 3ZT7A 3BQLA 4YHJA 4MLKA 2BKOA 2MTQA 5AQPB 4O2BE 5JQGE 4UY2A 4PK5A 5TVCA 4X64T 5KDMC 2ODUA 2UXDT 2KWHA 3RH3A 3ZC1A 4Q25A 2WWVA 1HNZT 3CMLA 2XUEA 3HKEE 4HFVA 3EVYA 5EK3A 4PIRA 5HAXA 3U8KA 2ZM6T 4HGAA 4HWDA 4DNDA 2LRLA 2X66A 4DR2T 4EB6E 3AE1A 4DUZT 4UVCB 1ZP0A 4ZS3A 1T72A 3PJAJ 3RYCE 2CXDA 2X0HA 4BJNA 1HFAA 4A97A 2A3DA 3Q5EA 4EYYR 3PUVF 4ZEYA 5L3EB 3CX8B 3B57A 4BAYB 4ZZBA 1VOMA 4AQYT 3MXZA 1HX1B 4X66T 2VL0A 5IHYA 4FRRA 4WNKA 2XAGB 2QC1B 3VR9A 2W66A 3QUJA 4ZS2A 4OX9T 3ZN1B 5BP0A 3K1SA 5JRCB 5AQLB 1Y64B 2XQ6A 1ZHCA 2UXXB 3AA1B 3WTJA 4PJMA 4TUYE 2Y7YA 4QX8B 2ZM0A 2V6YA 4AKHA 5LXBA 1NWMX 4ZZCA 5LJNA 4COFA 2LHRA 5L47A 3OBVE 4DV5T 3SOLA 3RF1A 2VKJA 5LBMA 1M62A 2V5CA 1NAFA 3FXDB 3I0QA 2LE8A 2CXLA 1T8BA 5LA6E 3EDVA 1ZOYA 5LMUT 4EV6A 3JAFA 3CVRA 4KMCA 4F6RC 4DR4T 3RC8A 2HN2A 4TWDA 3ZMVB 4QH5A 4O4IE 4AKLA 4CI3B 4DV6T 3N9QA 4AXPA 3N9NA 1U4QA 5AQHB 3RIAA 3TLVA 3LJCA 4CXWA 3KINB 2E9XD 3LSVA 4A98A 3RKGA 3AVSA 4PFOA 4O4LE 4TWHA 2XQ4A 2QYWA 3KVBA 2WZYA 3Q5DA 4H9QC 1VCTA 4QXCB 1L0VA 1UX5A 2BG9A 2WU5A 2FJBA 2DWGA 2H3RA 2XAQB 4GK5E 3MK7C 1QSDA 1MMDA 4TWFA 2YDRA 4HTEA 2WB5A 3IHRA 3U8NA 1Z8UA 5HEUA 5JMEA 4MHCA 3X1DA 3PV0F 2W8FA 2PH9A 2BG9E 3FHNA 3AECA 3K3OA 2VKOA 5ABGA 3UFGA 3TKLB 1LKXA 3LK2B 4IDNA 3PU3A 4E7SA 3F2EA 4C90A 5ABFA 4DR3T 1HG5A 3FZKB 4EGWA 2Y48B 2WZIA 2BS4A 3ZPOA 3O1IA 2ACXA 4X1IE 4O4HE 3AE7A 2K3WA 5ABEA 3C4XA 2Y54A 5H6RB 1IAPA 4JI5T 1XDOA 2WP9A 5BR8T 4JEUB 2V6YB 2X68A 5AQVB 3LBXB 1XWMA 1KNRA 5J0ZA 2XQ7A 3NBXX 5AQUB 5AQFB 4JI2T 2X9HA 1OXZA 4FJOA 3IEEA 1D1AA 2WMNA 4UXUA 4IHJE 1UW6A 3C51A 1HS7A 4MBQA 1MIVA 2R6GF 5CB4E 5AFNA 2LEHA 3AA6B 4UM3S 1T98A 2ZLYA 2CPTA 2MPKA 1KFYA 5HEJA 4JI3T 4YTNA 1DU2A 4BJMA 5HEHA 3N9LA 4JI4T 2X0LB 5AQIB 3HI2A 1D1BA 2LM2A 1QLBA 2VKDA 4AQGA 2MBGA 4TV8E 4GKJT 3UFEA 4C91A 3LFMA 2ZJUA 3CX6B 3A8YC 3O9XA 3O4XE 2W4XA 4HWFA 5FJVA 2BKNA 2VWAA 2WAUA 2WZHA 2NTXA 1ZKEA 2CM0A 1MNEA 2OA5A 1W09A 3N5LA 5L3FB 1HNWT 3RHWA 2K48A 3NZQA 2BS3A 1KNPA 3K3QC 2HH7A 3ZEFB 4H63H 4DR6T 2IC9A 5AFMA 4UV8B 3RX6A 2LT3A 2J62A 4EZ1A 4QAAA 5M4YA 4LF7T 4ZXLA 2YMDA 4G2AA 4DMWA 2UXCT 2XNUA 5AQNB 3AE5A 4NUUA 3FBLA 3VRBA 2N9DA 2X0YA 3ZCJA 5FKYA 1J5ET 2C5JA 4EEDA 4O2AE 4XBFB 3QOFA 3R6NA 3T8OA 1FMWA 3JAEA 3UTKA 2OLTA 1YW0A 3VR8A 5BRXA 3CK6A 5EK2A 1MMNA 2W61A 4IL4A 3UU4A 5AQJB 4AFTA 3EAMA 3P50A 1SUMB 3D0TA 1UX2A 1D0XA 3OYZA 4DO0A 4PJJA 1WFDA 3UQ7A 3DJBA 3N9MA 2RP4A 3U3IA 2UUBT 2I59A 1XMOT 5F8PA 5GONE 2RPAA 4U2ZA 1W9RA 5L4HA 2ACZA 2IAKA 1IBKT 1YQ4A 3ONLC 3I1AA 2WDQA 5ETWA 1BR1A 3ZT6A 5JR9B 1IJ6A 4KX6A 3P4QA 5AQGB 4XZCA 3JC6C 1H7CA 2Y58A 1IBMT 2MAWA 5KE4A 3WTLA 2BDEA 4QABA 2B1EA 3WTKA 3HL6A 3RI5A 2C5KT 3ZMZB 3SS1A 2XQ9A 4ZHQE 2WDVA 3RLFF 3VHLA 5A1LA 3OTOT 2CLYC 2J4GA 3AAAB 2YU1A 2KLQA 5HEGA 2WCAA 5CFBA 2NW7A 3PJAA 2WN9A 3T1YT 2X00D 3WAKA 5IYZE 3ZYLA 4HEAA 5LGUB 2X51A 2E9XC 3VU7H 4ANJA 2WNJA 3GN5B 4JV5T 3KV6A 2CMRA 4IGUA 3HKDE 2OV9A 5LOVE 4KHPT 4U74A 2WNCA 3ANWA 2E9XB 3TLTA 5LCYA 3UUNA 4EYUA 5FYMA 2X67A 1AJ3A 1Z0PA 2XNTA 3GWHA 2YKSA 3IA3A 2A72A 4PW8A 3ETUA 3KDSE 4JBWF 1HX8A 5LGNB 4OYJA 3CKDA 2KINB 4A56A 1N36T 3AE6A 2KT9A 3B13A 1LRZA 2L8KA 1M7KA 3RYFE 4B3TT 4HFEA 3OVUA 3ZKRA 3U8MA 3NRXA 3MKDA 4ZOLE 1FJGT 1SHZC 2HHHT 5FVKA 3N2OA 5L3DB 3ZSSA 3C4ZA 4UVAB 2P9BA 3FZHB 4ZI7E 3TLSA 4U7IA 4I55E 2V6XA 4GK0E 4B3MT 4UXNB 3QC9A 2PTFA 4U2YA 4LFBT 3Q5XA 4YTMA 3DP7A 1UURA 3ZYKA 2LHNA 4OYKA 3SFDA 4IREA 4U33A 2AXDS 2XY8B 2H7VC 2FUPA 2BVLA 4GYRA 4X1YE 1BR2A 4DV0T 4FI5A 4QACA 2JMKA 5LP6E 4LMJA 4PJLA 5J5IA 2BYPA 1MMAA 2LKGA 2IW5B 4N78D 2XASB 2W00A 2XM2A 4Z91A 2EHOD 4X65T 2WQYA 2BYSA 4B6XA 4QWNB 5FL0A 3P8CD 3NZPA 4EZ4A 5L3CB 2WNLA 3NKZA 4L9IA 1OEDB 1D0ZA 4YSYA 4PK6A 4UF0A 3FXEB 4M1PA 1JNZA 2BR8A 3CQXC 2LOPA 4XAXB 3WTOA 4LF5T 3C50A 2VVSA 4IDPA 4V1Av 2H88A 3PUXF 2VQFT 4ZJSA 4AKIA 2LKHA 2CXFA 4OK0A 2KNDA 3RRCA 3FB2A 5LHHB 1XNRT 2VL8A 3ONXA 2QVAA 2Y8DA 2XJ7A 2Q9QB 3CPZA 2VB6A 3PEOA 4DBRA 2JQQA 4UV9B 1E2AA 4UIGA 1S35A 2RA1A 4QXBB 4HN9A 3VKGA 5L2LA 2G0UA 2PFVA 2Y6XA 3LK42 2L9QA 4DMVA 3RGLA 4G63A 3Q2MA 4BFQA 3OJAA 1V9DA 3ZMTB 3E08A 3EDUA 4H9RC 2V7IA 4ILCA 3MACA 4AISA 3PUQA 5AFKA 1OEDC 3G06A 2V7MA 1I9BA 4B3RT 4JI0T 2EHOA 3UUXB 2M67A 2ZM2A 3UUBA 2BYNA 2Y57A 3BQIA 1UGOA 4I43B 5SYOA 4O8SA 3N2KE 2IDOB 2CA5A 3W15B 2PJQA 3SWHA 2E2AA 2XPKA 2WY2A 4IE5A 4CN4A 5LB7B 3U78A 2X00A 3AE2A 2NOXA 3IBPA 1GQEA 4HWIB 3UUMA 4X62T 5J5GA 4ZI2C 5E0OA 3C4WA 1WYBA 3I0OA 4DIDB 4TNVA 3N9OA 5KMGP 2J1DG 4PNIA 4XK9A 3CWZB 4CZZB 4TZ4C 2BG9C 3SH1A 4X20E 3U8JA 1IZNB 3RC3A 5DJQC 5LG3A 3FZFB 2E9XA 4EZHA 2E5VA 1OEDE 4A5XA 2H89A 2YN6A 4AIUA 2VKHA 4UELA 2KWIB 4L0RA 3B5MA 4HFCA 1W0AA 2LRKA 1YXRA 5JR9C 2W63A 4AFHA 4NXNT 2V7LA 1OEDA 3RRWA 2DWKA 5KX5E 2E8IA 2C5IT 2UUAT 4GYSA 4P1NA 5FP3A 2XZ6A 5EK4A 3RPUA 4LF8T 3HKBE 2NW8A 4ZI2D 4K0KT 3QNUA 3ONJA 4HWCA 2BZBA 2WBLA 5H6QB 3I9YA 2XQYA 5L4EA 3AA7B 4ILUA 2CLYB 4CN6A 2DL1A 4YJ3E 4P0BA 2VVNA 5HXRA 3WTMA 3UT5E 4L5GA 3AEEA 4ILAA 3K8PC 3FZMB 2Q9QD 3NVOA 3PUGA 4EIWA 4ISTA 3VKHA 1NENA 5JTGA 5LYJE 1KF6A 2CWOA 4CI2B 5FXWA 3ZC0A 4U7YA 3CQCB 3ZLIA 5J2TE 3V5SA 3PTRB 3QB5A 3AAEB 4PJNA 4NXMT 3PUYF 4X1KE 1J1JA 4JI6T 2HPLA 4YLHA 5IUXA 4LFCT 5JR9A 3ZCIA 5LHIB 4TX5A 4UF0B 3P4RA 2HPJA 4MALA 5DQWA 4HQPA 2UXBT 1YKHB 2FBWA 4DVDA 5AFUL 5F3JA 1VCSA 3CIRA 3F57A 3JC6D 2CHNA 3AE4A 3M65A 2LSJA 3WTIA 2KXPB 3VRAA 5LXTE 2C9TA 3ZYMA 2V1DB 3OYXA 5FXVA 2V7JA 2XQAA 3KV9A 2F4VT 3KBUA 2IMLA 3HKCE 3P4WA 2BS2A 2X9XA 1SE7A 1HCIA 3PE0A 4HKAA 2X9WA 3PUSA 4ZK4A 2MOZA 5JDNA 1E1HB 5LJMA 4EXTA 4H63V 1XZYA 1YKEB 2UZ6A 3QB5K 2EHOC 2CBIA 1KNZA 2BJ0A 2CBJA 1XMQT 3BK9A 5FNVE 5FL1A 3N2GE 5AFMB 2XQ8A 2ODVA 1BR0A 3P4SA 3H37A 2UU9T 2LSGA 2YU2A 3GA8A 5LMNT 4TN7B 3F31A 2W2UA 2Q9QA 5KXJA 3P7IA 4B3ST 3GMIA 4JUYA 5AQRB 4PFPA 1MNDA 2KSRA 4JI8T 2YMEA 2VQET 2LSYA 1G8XA 1WLXA 4AI6A 1KEYA 2FJAA 2E5LT 3C79A 3SFEA 4IE7A 3R84B 3EI0A 2I6HA 3GUAA 3OKQA 4HWHA 5HXEA 3ZT5A 4DR5T 3IF8B 2V26A 2ES0A 5JDHA 1ZEEA 4H9NC 4JEHB 4J2CA 4NZBA 5J2UE 4JLEA 4YT0A 5JDGA 2BVMA 1J5WA 4NUVA 4TV9E 4YJ2E 4QXHB 4IDOA 4GOUA 2WM9A 3E22E 1NEKA 3O1HA 4DBQA 3UULA 1CHUA 2WDRA 4QKNA 4KI0F 1HNXT 3KFWX 4YXDA 3PUAA 4DUYT 2EHOB 4HFBA 2XNVA 3DTOA 4GKKT 5FY1A 2LOSA 2W0GA 5C2TA 5CJ5A 2B76A 2WMOA 4DV3T 1HR0T 4BQTA 2JJ9A 3UU3A 5JDMA 3Q9DA 3SRZA 3MJXA 3AEGA 1HG2A 2K5BB 3MZKB 3SIOA 2YDSA 5JDFA 1XDPA 4PK4A 3RQWA 2XHEB 1W0BA 4CQIA 3TLWA 1KK7A 2JIWA 4ILBA 3QK6A 3S4UA 3JCFA 2H7OA 2XM1A 4WZXA 2CCQA 5LGTB 1WR0A 4DV7T 1FEWA 3AEBA 2A9UA 5BMVE 1UV6A 4Z90A 1WCRA 4IE0A 4H9PC 5JH7E 4Z8XA 1WYCA 5J5FA 2BBJA 3ZSTA 3AXJB 3A7MA 3JADA 2I0MA 4HE8A 4IDQA 4GIWA 2CWYA 3AEFA 4B5DA 2JRKA 3MA9A 3AE3A 4I4TE 3RIUA 5F5WA 2K24A 3AVRA 1FMVA 4CXXA 4H9SE 3PU8A 2YOEA 5HYAA 1X79A 2Q9QC 3KV4A 2JQ9A 1R8IA 4NPPA 4ALXA 1MIYA 3L3PA 1EZ3A 1U5PA 1D0YA 2BYQA 2UXNB 5EZYE 4HFHA 1IBLT 3J7Yq 2JQHA 1OWAA 2YDQA 2W8GA 3NRYA 4DR1T 3L8RA 3C64A 3ESLA 1S94A 2D0TA 2KZ7B 2NTYA 3UQ4A 2NP9A 4YFSA 1YQ3A 3ZMUB 1N32T 4UM3A 4D01A 4DR7T 4CN1A 4KUMB 3FBZA 2W62A 3RIFA 4OFZA 3GN5A 2N1GA 4IE6A 3K3NA 4LFAT 2XZ5A 3WTHA 1BR4A 3ABVA 5LHGB 4ZK1A 3PURA 1WR6A 4AKGA 4P0AA 2C0SA 4IL9A 3RYHE 3KVAA 3HA4A 3P4PA 5LNKA 4DV2T 1US7B 2VURA 3PDYA 4IE4A 3ZJ1A 5L3BB 2QGSA 4QH1A 2XTLA 1B7TA 2BG9B 1O3XA 5CA0E 4YSZA 2WU2A 3OPCA 3TLUA 1SA0E 2KMFA 5FXZA 3SQ9A 2VASA 4ADZA 4YY3T 2XYTA 3WI3A 3UU5A 4JI1T 4DV1T 3I9WA 5ABHA 2D5UA 1E7PA 2LM9A 2IIUA 3LDQB 1UUSA 3RIUC 4DV4T 5JRCA 3ETVA 3J9X1 2QRXA 2WWUA 1Y01A 3PUWF 3PMZA 4U3CA 5JDQA 5J5HA 4PAGA 4WW0A 2X9YA 4NIQA 4QX7B 1IJ5A 3H3MA 5HWXA 2WS3A 3A5XA 3BQKA 5AQTB 2ZJVA 5ADXL 3KV5A 5AQOB 1I94T 2PBIA 3HR0A 4ISSA 3LBXA 2NW9A 3EUHA 2JMHA 2XQ5A 2V5DA 2Y56A 4LMLA 4UR9A 4HFDA 4LMKA 3ANWB 3V5UA 5CA1E 1CUNA 2IUBA 4QH4A 2YK0A 2D0UA 1WRDA 5AQKB 2YINA 2D9DA 4WYVA 2XQ3A 3AXJA 2A2FX 4YHHT 4AFGA 5HXCA 4AQFC 4ERRA 3CQGB 3C84A 5JVDE 5HCMA 4LF6T 2BR7A 2NWBA 4WV9A 5BW2A 2K9AA 4OHFA 4O4JE 2PG8A 2BYRA 4CXYA 1YD8G 2UUCT 2J47A 3ZMSB 5AFHA 3AE8A 4KBMB 4JYAT 5AFLA 4TNWA 4WBNE 1D1CA 4ZI3D 3N9PA 4KHZF 1N33T 3ZDGA 2DHRA 4EEBA 4HFIA 3FZLB 4LF4T 2NR4A 5IWAT 1HF8A 4QHOA 5AINA 4P09A 4UM3P 3KBTA 3AB3B 4XHEA 2DNXA 2AE9A 4BA9A 2BKPA 3EHZA 4IT4A 4EAHA 3ZJ2A 3WTNA 2FJEA 4YTPA 4E7ZA 5C8YE 2CE7A 4EOZB 2XSAA 1VRBA 1XNQT 4DBMA 4H9OC 3SQ6A 5J1GA 2XSBA 1HTJF 5FMNA 2LLYA 2ZM8A 4JI7T 2IHR1 2XAJB 2XYSA 2WSSV 2LJLA 5FY7A 3UU8A 3C98B 4I0UA 2V8SV 3WAJA 2BBHA 4KP3C 2QA7A 4AKRB 1MMGA 1QUUA 2MYSA 2ZMAA 2IC6A 5LG4A 2XAFB 3Q5WA 5DABA 4WBOA 2YEVC 5CGMA 3RKOA 5TAOA 2DI4A 1LVFA 3O1JA 3WIPA 4U72A 4I50E 1LVKA 5HWYA 4IDZA 1MIWA 2FJDA 3EABA 4ZR6A 3LK3B 1N34T 4F8HA 2XAHB 5HCJA 3ZN0B 3PUZF 5ABFB 2LSIA 1G73A 3AA0B 2HN1A 5JREA 2CEAA 2GK9A 4X5TA 3UU6A 1I6ZA 5AQSB 3L09A 3AEAA 2M6IA 5DQVA 4MFRA 3ZDHA 3RQUA 4ZJTA 3T1HT 4CI1B 3H3AA 2L3LA 2W67A 4ZRUA 2VK9A 2PGZA 5L3GB 4UVBB 3AE9A 2LSKA 2N2NA 4U31A 3E0ZA 2Z6EA 5C3JA 5HEOA 1X9BA 2XZEA 1UX4A 5HXSA 2JPFA 2DCFA 5AFJA 4UEMA 3LG7A 5KZUA 3CX7B 2CRBA 2M6BA 3T4MA 4ASKA 5FXXA 2CHOA 2V7KA 4YSXA 4UM1A 1FIOA 5FVLA 3U8LA 4AQFA
chains in the Genus database with same CATH topology
3ZDGA 5J5GA 2XQ6A 4ZR6A 2BJ0A 2W8GA 3PMZA 4UXUA 4F8HA 4TNVA 1UW6A 5CO5A 3SIOA 4HFIA 3WTJA 5J5HA 4ZJSA 2Y7YA 2LKHA 3IGQA 2BG9A 5HEGA 3RQWA 5AINA 3TLSA 4XK9A 5AFMB 2XQ8A 5CFBA 5HCJA 5LXBA 4UM3P 3UQ4A 3TLWA 5AFNA 4ZZCA 2BG9C 2WN9A 2ZJVA 4TWFA 2X00D 3SH1A 3U8JA 4COFA 4XHEA 4UM3S 5L47A 4ILBA 3U8NA 5IUXA 5HEJA 5LG3A 5HEUA 4UM3A 5JMEA 3JAEA 2XQ5A 3PEOA 5HEHA 4D01A 1OEDE 2W8FA 4IREA 2PH9A 5BRXA 4HQPA 2BG9E 2YN6A 3EHZA 4X5TA 4IL4A 2WNJA 3WTNA 3UU4A 3UU6A 2Y56A 1UV6A 4UY2A 3RIFA 4LMLA 4Z90A 4AFTA 2LM2A 3EAMA 3P50A 4HFDA 4LMKA 5TVCA 2KSRA 2YMEA 4HFCA 2M6IA 5J5FA 1UX2A 4DBMA 2WNCA 2XZ5A 4QH4A 3TLTA 3ZDHA 3C79A 3RQUA 3SQ6A 3WTHA 4QACA 3JADA 4AFHA 4LMJA 4ZJTA 3JAFA 3UQ7A 4ZK1A 5J5IA 1OEDA 2BYPA 2ZJUA 3EI0A 4PIRA 4BFQA 3U8KA 2LLYA 3WTIA 4IL9A 2XYSA 3GUAA 4B5DA 2LKGA 5FJVA 2C9TA 2XNTA 2XQ3A 3UU8A 4TWDA 2YKSA 2XZ6A 2XQAA 4ZRUA 5L4HA 4QH5A 4ILCA 2PGZA 4Z91A 5AFKA 1OEDC 4QH1A 2BG9B 4NZBA 3RHWA 3P4WA 1I9BA 4AFGA 2BYSA 3UUBA 3C84A 2Y54A 4A97A 2YOEA 2BYNA 5L4EA 5HCMA 5HEOA 2Y57A 2WNLA 3TLUA 5SYOA 2BR7A 1OEDB 3SQ9A 2XYTA 4WV9A 4NPPA 5AFJA 4ALXA 5BW2A 3RIAA 3TLVA 3UU5A 2Y58A 5AFMA 2MAWA 4HFEA 2BYRA 5KE4A 5KZUA 4ZZBA 3WIPA 3LSVA 4EZ1A 3WTLA 4QAAA 2M6BA 3ZKRA 4A98A 3T4MA 2BYQA 4FRRA 4QABA 2VL0A 4HFBA 2XNVA 4ZK4A 3WTKA 3U8MA 2QC1B 3WTMA 5AFHA 2X00A 3RI5A 5J0ZA 2XQ7A 2YMDA 4TNWA 2BR8A 4UM1A 5AFLA 4TWHA 3U8LA 4HFHA 4ILAA 4BQTA 2XQ4A 3WTOA 2UZ6A 3UU3A 2WZYA 2XNUA 5BP0A 2XQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDG A;  5J5G A;  2XQ6 A;  4ZR6 A;  2BJ0 A;  2W8G A;  3PMZ A;  4UXU A;  4F8H A;  4TNV A;  1UW6 A;  5CO5 A;  3SIO A;  4HFI A;  3WTJ A;  5J5H A;  4ZJS A;  2Y7Y A;  2LKH A;  3IGQ A;  2BG9 A;  5HEG A;  3RQW A;  5AIN A;  3TLS A;  4XK9 A;  5AFM B;  2XQ8 A;  5CFB A;  5HCJ A;  5LXB A;  4UM3 P;  3UQ4 A;  3TLW A;  5AFN A;  4ZZC A;  2BG9 C;  2WN9 A;  2ZJV A;  4TWF A;  2X00 D;  3SH1 A;  3U8J A;  4COF A;  4XHE A;  4UM3 S;  5L47 A;  4ILB A;  3U8N A;  5IUX A;  5HEJ A;  5LG3 A;  5HEU A;  4UM3 A;  5JME A;  3JAE A;  2XQ5 A;  3PEO A;  5HEH A;  4D01 A;  1OED E;  2W8F A;  4IRE A;  2PH9 A;  5BRX A;  4HQP A;  2BG9 E;  2YN6 A;  3EHZ A;  4X5T A;  4IL4 A;  2WNJ A;  3WTN A;  3UU4 A;  3UU6 A;  2Y56 A;  1UV6 A;  4UY2 A;  3RIF A;  4LML A;  4Z90 A;  4AFT A;  2LM2 A;  3EAM A;  3P50 A;  4HFD A;  4LMK A;  5TVC A;  2KSR A;  2YME A;  4HFC A;  2M6I A;  5J5F A;  1UX2 A;  4DBM A;  2WNC A;  2XZ5 A;  4QH4 A;  3TLT A;  3ZDH A;  3C79 A;  3RQU A;  3SQ6 A;  3WTH A;  4QAC A;  3JAD A;  4AFH A;  4LMJ A;  4ZJT A;  3JAF A;  3UQ7 A;  4ZK1 A;  5J5I A;  1OED A;  2BYP A;  2ZJU A;  3EI0 A;  4PIR A;  4BFQ A;  3U8K A;  2LLY A;  3WTI A;  4IL9 A;  2XYS A;  3GUA A;  4B5D A;  2LKG A;  5FJV A;  2C9T A;  2XNT A;  2XQ3 A;  3UU8 A;  4TWD A;  2YKS A;  2XZ6 A;  2XQA A;  4ZRU A;  5L4H A;  4QH5 A;  4ILC A;  2PGZ A;  4Z91 A;  5AFK A;  1OED C;  4QH1 A;  2BG9 B;  4NZB A;  3RHW A;  3P4W A;  1I9B A;  4AFG A;  2BYS A;  3UUB A;  3C84 A;  2Y54 A;  4A97 A;  2YOE A;  2BYN A;  5L4E A;  5HCM A;  5HEO A;  2Y57 A;  2WNL A;  3TLU A;  5SYO A;  2BR7 A;  1OED B;  3SQ9 A;  2XYT A;  4WV9 A;  4NPP A;  5AFJ A;  4ALX A;  5BW2 A;  3RIA A;  3TLV A;  3UU5 A;  2Y58 A;  5AFM A;  2MAW A;  4HFE A;  2BYR A;  5KE4 A;  5KZU A;  4ZZB A;  3WIP A;  3LSV A;  4EZ1 A;  3WTL A;  4QAA A;  2M6B A;  3ZKR A;  4A98 A;  3T4M A;  2BYQ A;  4FRR A;  4QAB A;  2VL0 A;  4HFB A;  2XNV A;  4ZK4 A;  3WTK A;  3U8M A;  2QC1 B;  3WTM A;  5AFH A;  2X00 A;  3RI5 A;  5J0Z A;  2XQ7 A;  2YMD A;  4TNW A;  2BR8 A;  4UM1 A;  5AFL A;  4TWH A;  3U8L A;  4HFH A;  4ILA A;  4BQT A;  2XQ4 A;  3WTO A;  2UZ6 A;  3UU3 A;  2WZY A;  2XNU A;  5BP0 A;  2XQ9 A; 
#chains in the Genus database with same CATH topology
 1JNR A;  2D2S A;  1UK5 A;  5LBQ B;  4LF9 T;  2DLR A;  1ZV4 X;  4IIJ E;  5CO5 A;  3L39 A;  3IGQ A;  5HXH A;  3RYI E;  4K0U A;  1UCU A;  3M3Z B;  3NWI A;  2SPC A;  2JQK A;  1T7S A;  5AQQ B;  5FY0 A;  5AQM B;  3AAI A;  4ZI3 C;  3AED A;  5JDL A;  3ZT7 A;  3BQL A;  4YHJ A;  4MLK A;  2BKO A;  2MTQ A;  5AQP B;  4O2B E;  5JQG E;  4UY2 A;  4PK5 A;  5TVC A;  4X64 T;  5KDM C;  2ODU A;  2UXD T;  2KWH A;  3RH3 A;  3ZC1 A;  4Q25 A;  2WWV A;  1HNZ T;  3CML A;  2XUE A;  3HKE E;  4HFV A;  3EVY A;  5EK3 A;  4PIR A;  5HAX A;  3U8K A;  2ZM6 T;  4HGA A;  4HWD A;  4DND A;  2LRL A;  2X66 A;  4DR2 T;  4EB6 E;  3AE1 A;  4DUZ T;  4UVC B;  1ZP0 A;  4ZS3 A;  1T72 A;  3PJA J;  3RYC E;  2CXD A;  2X0H A;  4BJN A;  1HFA A;  4A97 A;  2A3D A;  3Q5E A;  4EYY R;  3PUV F;  4ZEY A;  5L3E B;  3CX8 B;  3B57 A;  4BAY B;  4ZZB A;  1VOM A;  4AQY T;  3MXZ A;  1HX1 B;  4X66 T;  2VL0 A;  5IHY A;  4FRR A;  4WNK A;  2XAG B;  2QC1 B;  3VR9 A;  2W66 A;  3QUJ A;  4ZS2 A;  4OX9 T;  3ZN1 B;  5BP0 A;  3K1S A;  5JRC B;  5AQL B;  1Y64 B;  2XQ6 A;  1ZHC A;  2UXX B;  3AA1 B;  3WTJ A;  4PJM A;  4TUY E;  2Y7Y A;  4QX8 B;  2ZM0 A;  2V6Y A;  4AKH A;  5LXB A;  1NWM X;  4ZZC A;  5LJN A;  4COF A;  2LHR A;  5L47 A;  3OBV E;  4DV5 T;  3SOL A;  3RF1 A;  2VKJ A;  5LBM A;  1M62 A;  2V5C A;  1NAF A;  3FXD B;  3I0Q A;  2LE8 A;  2CXL A;  1T8B A;  5LA6 E;  3EDV A;  1ZOY A;  5LMU T;  4EV6 A;  3JAF A;  3CVR A;  4KMC A;  4F6R C;  4DR4 T;  3RC8 A;  2HN2 A;  4TWD A;  3ZMV B;  4QH5 A;  4O4I E;  4AKL A;  4CI3 B;  4DV6 T;  3N9Q A;  4AXP A;  3N9N A;  1U4Q A;  5AQH B;  3RIA A;  3TLV A;  3LJC A;  4CXW A;  3KIN B;  2E9X D;  3LSV A;  4A98 A;  3RKG A;  3AVS A;  4PFO A;  4O4L E;  4TWH A;  2XQ4 A;  2QYW A;  3KVB A;  2WZY A;  3Q5D A;  4H9Q C;  1VCT A;  4QXC B;  1L0V A;  1UX5 A;  2BG9 A;  2WU5 A;  2FJB A;  2DWG A;  2H3R A;  2XAQ B;  4GK5 E;  3MK7 C;  1QSD A;  1MMD A;  4TWF A;  2YDR A;  4HTE A;  2WB5 A;  3IHR A;  3U8N A;  1Z8U A;  5HEU A;  5JME A;  4MHC A;  3X1D A;  3PV0 F;  2W8F A;  2PH9 A;  2BG9 E;  3FHN A;  3AEC A;  3K3O A;  2VKO A;  5ABG A;  3UFG A;  3TKL B;  1LKX A;  3LK2 B;  4IDN A;  3PU3 A;  4E7S A;  3F2E A;  4C90 A;  5ABF A;  4DR3 T;  1HG5 A;  3FZK B;  4EGW A;  2Y48 B;  2WZI A;  2BS4 A;  3ZPO A;  3O1I A;  2ACX A;  4X1I E;  4O4H E;  3AE7 A;  2K3W A;  5ABE A;  3C4X A;  2Y54 A;  5H6R B;  1IAP A;  4JI5 T;  1XDO A;  2WP9 A;  5BR8 T;  4JEU B;  2V6Y B;  2X68 A;  5AQV B;  3LBX B;  1XWM A;  1KNR A;  5J0Z A;  2XQ7 A;  3NBX X;  5AQU B;  5AQF B;  4JI2 T;  2X9H A;  1OXZ A;  4FJO A;  3IEE A;  1D1A A;  2WMN A;  4UXU A;  4IHJ E;  1UW6 A;  3C51 A;  1HS7 A;  4MBQ A;  1MIV A;  2R6G F;  5CB4 E;  5AFN A;  2LEH A;  3AA6 B;  4UM3 S;  1T98 A;  2ZLY A;  2CPT A;  2MPK A;  1KFY A;  5HEJ A;  4JI3 T;  4YTN A;  1DU2 A;  4BJM A;  5HEH A;  3N9L A;  4JI4 T;  2X0L B;  5AQI B;  3HI2 A;  1D1B A;  2LM2 A;  1QLB A;  2VKD A;  4AQG A;  2MBG A;  4TV8 E;  4GKJ T;  3UFE A;  4C91 A;  3LFM A;  2ZJU A;  3CX6 B;  3A8Y C;  3O9X A;  3O4X E;  2W4X A;  4HWF A;  5FJV A;  2BKN A;  2VWA A;  2WAU A;  2WZH A;  2NTX A;  1ZKE A;  2CM0 A;  1MNE A;  2OA5 A;  1W09 A;  3N5L A;  5L3F B;  1HNW T;  3RHW A;  2K48 A;  3NZQ A;  2BS3 A;  1KNP A;  3K3Q C;  2HH7 A;  3ZEF B;  4H63 H;  4DR6 T;  2IC9 A;  5AFM A;  4UV8 B;  3RX6 A;  2LT3 A;  2J62 A;  4EZ1 A;  4QAA A;  5M4Y A;  4LF7 T;  4ZXL A;  2YMD A;  4G2A A;  4DMW A;  2UXC T;  2XNU A;  5AQN B;  3AE5 A;  4NUU A;  3FBL A;  3VRB A;  2N9D A;  2X0Y A;  3ZCJ A;  5FKY A;  1J5E T;  2C5J A;  4EED A;  4O2A E;  4XBF B;  3QOF A;  3R6N A;  3T8O A;  1FMW A;  3JAE A;  3UTK A;  2OLT A;  1YW0 A;  3VR8 A;  5BRX A;  3CK6 A;  5EK2 A;  1MMN A;  2W61 A;  4IL4 A;  3UU4 A;  5AQJ B;  4AFT A;  3EAM A;  3P50 A;  1SUM B;  3D0T A;  1UX2 A;  1D0X A;  3OYZ A;  4DO0 A;  4PJJ A;  1WFD A;  3UQ7 A;  3DJB A;  3N9M A;  2RP4 A;  3U3I A;  2UUB T;  2I59 A;  1XMO T;  5F8P A;  5GON E;  2RPA A;  4U2Z A;  1W9R A;  5L4H A;  2ACZ A;  2IAK A;  1IBK T;  1YQ4 A;  3ONL C;  3I1A A;  2WDQ A;  5ETW A;  1BR1 A;  3ZT6 A;  5JR9 B;  1IJ6 A;  4KX6 A;  3P4Q A;  5AQG B;  4XZC A;  3JC6 C;  1H7C A;  2Y58 A;  1IBM T;  2MAW A;  5KE4 A;  3WTL A;  2BDE A;  4QAB A;  2B1E A;  3WTK A;  3HL6 A;  3RI5 A;  2C5K T;  3ZMZ B;  3SS1 A;  2XQ9 A;  4ZHQ E;  2WDV A;  3RLF F;  3VHL A;  5A1L A;  3OTO T;  2CLY C;  2J4G A;  3AAA B;  2YU1 A;  2KLQ A;  5HEG A;  2WCA A;  5CFB A;  2NW7 A;  3PJA A;  2WN9 A;  3T1Y T;  2X00 D;  3WAK A;  5IYZ E;  3ZYL A;  4HEA A;  5LGU B;  2X51 A;  2E9X C;  3VU7 H;  4ANJ A;  2WNJ A;  3GN5 B;  4JV5 T;  3KV6 A;  2CMR A;  4IGU A;  3HKD E;  2OV9 A;  5LOV E;  4KHP T;  4U74 A;  2WNC A;  3ANW A;  2E9X B;  3TLT A;  5LCY A;  3UUN A;  4EYU A;  5FYM A;  2X67 A;  1AJ3 A;  1Z0P A;  2XNT A;  3GWH A;  2YKS A;  3IA3 A;  2A72 A;  4PW8 A;  3ETU A;  3KDS E;  4JBW F;  1HX8 A;  5LGN B;  4OYJ A;  3CKD A;  2KIN B;  4A56 A;  1N36 T;  3AE6 A;  2KT9 A;  3B13 A;  1LRZ A;  2L8K A;  1M7K A;  3RYF E;  4B3T T;  4HFE A;  3OVU A;  3ZKR A;  3U8M A;  3NRX A;  3MKD A;  4ZOL E;  1FJG T;  1SHZ C;  2HHH T;  5FVK A;  3N2O A;  5L3D B;  3ZSS A;  3C4Z A;  4UVA B;  2P9B A;  3FZH B;  4ZI7 E;  3TLS A;  4U7I A;  4I55 E;  2V6X A;  4GK0 E;  4B3M T;  4UXN B;  3QC9 A;  2PTF A;  4U2Y A;  4LFB T;  3Q5X A;  4YTM A;  3DP7 A;  1UUR A;  3ZYK A;  2LHN A;  4OYK A;  3SFD A;  4IRE A;  4U33 A;  2AXD S;  2XY8 B;  2H7V C;  2FUP A;  2BVL A;  4GYR A;  4X1Y E;  1BR2 A;  4DV0 T;  4FI5 A;  4QAC A;  2JMK A;  5LP6 E;  4LMJ A;  4PJL A;  5J5I A;  2BYP A;  1MMA A;  2LKG A;  2IW5 B;  4N78 D;  2XAS B;  2W00 A;  2XM2 A;  4Z91 A;  2EHO D;  4X65 T;  2WQY A;  2BYS A;  4B6X A;  4QWN B;  5FL0 A;  3P8C D;  3NZP A;  4EZ4 A;  5L3C B;  2WNL A;  3NKZ A;  4L9I A;  1OED B;  1D0Z A;  4YSY A;  4PK6 A;  4UF0 A;  3FXE B;  4M1P A;  1JNZ A;  2BR8 A;  3CQX C;  2LOP A;  4XAX B;  3WTO A;  4LF5 T;  3C50 A;  2VVS A;  4IDP A;  4V1A v;  2H88 A;  3PUX F;  2VQF T;  4ZJS A;  4AKI A;  2LKH A;  2CXF A;  4OK0 A;  2KND A;  3RRC A;  3FB2 A;  5LHH B;  1XNR T;  2VL8 A;  3ONX A;  2QVA A;  2Y8D A;  2XJ7 A;  2Q9Q B;  3CPZ A;  2VB6 A;  3PEO A;  4DBR A;  2JQQ A;  4UV9 B;  1E2A A;  4UIG A;  1S35 A;  2RA1 A;  4QXB B;  4HN9 A;  3VKG A;  5L2L A;  2G0U A;  2PFV A;  2Y6X A;  3LK4 2;  2L9Q A;  4DMV A;  3RGL A;  4G63 A;  3Q2M A;  4BFQ A;  3OJA A;  1V9D A;  3ZMT B;  3E08 A;  3EDU A;  4H9R C;  2V7I A;  4ILC A;  3MAC A;  4AIS A;  3PUQ A;  5AFK A;  1OED C;  3G06 A;  2V7M A;  1I9B A;  4B3R T;  4JI0 T;  2EHO A;  3UUX B;  2M67 A;  2ZM2 A;  3UUB A;  2BYN A;  2Y57 A;  3BQI A;  1UGO A;  4I43 B;  5SYO A;  4O8S A;  3N2K E;  2IDO B;  2CA5 A;  3W15 B;  2PJQ A;  3SWH A;  2E2A A;  2XPK A;  2WY2 A;  4IE5 A;  4CN4 A;  5LB7 B;  3U78 A;  2X00 A;  3AE2 A;  2NOX A;  3IBP A;  1GQE A;  4HWI B;  3UUM A;  4X62 T;  5J5G A;  4ZI2 C;  5E0O A;  3C4W A;  1WYB A;  3I0O A;  4DID B;  4TNV A;  3N9O A;  5KMG P;  2J1D G;  4PNI A;  4XK9 A;  3CWZ B;  4CZZ B;  4TZ4 C;  2BG9 C;  3SH1 A;  4X20 E;  3U8J A;  1IZN B;  3RC3 A;  5DJQ C;  5LG3 A;  3FZF B;  2E9X A;  4EZH A;  2E5V A;  1OED E;  4A5X A;  2H89 A;  2YN6 A;  4AIU A;  2VKH A;  4UEL A;  2KWI B;  4L0R A;  3B5M A;  4HFC A;  1W0A A;  2LRK A;  1YXR A;  5JR9 C;  2W63 A;  4AFH A;  4NXN T;  2V7L A;  1OED A;  3RRW A;  2DWK A;  5KX5 E;  2E8I A;  2C5I T;  2UUA T;  4GYS A;  4P1N A;  5FP3 A;  2XZ6 A;  5EK4 A;  3RPU A;  4LF8 T;  3HKB E;  2NW8 A;  4ZI2 D;  4K0K T;  3QNU A;  3ONJ A;  4HWC A;  2BZB A;  2WBL A;  5H6Q B;  3I9Y A;  2XQY A;  5L4E A;  3AA7 B;  4ILU A;  2CLY B;  4CN6 A;  2DL1 A;  4YJ3 E;  4P0B A;  2VVN A;  5HXR A;  3WTM A;  3UT5 E;  4L5G A;  3AEE A;  4ILA A;  3K8P C;  3FZM B;  2Q9Q D;  3NVO A;  3PUG A;  4EIW A;  4IST A;  3VKH A;  1NEN A;  5JTG A;  5LYJ E;  1KF6 A;  2CWO A;  4CI2 B;  5FXW A;  3ZC0 A;  4U7Y A;  3CQC B;  3ZLI A;  5J2T E;  3V5S A;  3PTR B;  3QB5 A;  3AAE B;  4PJN A;  4NXM T;  3PUY F;  4X1K E;  1J1J A;  4JI6 T;  2HPL A;  4YLH A;  5IUX A;  4LFC T;  5JR9 A;  3ZCI A;  5LHI B;  4TX5 A;  4UF0 B;  3P4R A;  2HPJ A;  4MAL A;  5DQW A;  4HQP A;  2UXB T;  1YKH B;  2FBW A;  4DVD A;  5AFU L;  5F3J A;  1VCS A;  3CIR A;  3F57 A;  3JC6 D;  2CHN A;  3AE4 A;  3M65 A;  2LSJ A;  3WTI A;  2KXP B;  3VRA A;  5LXT E;  2C9T A;  3ZYM A;  2V1D B;  3OYX A;  5FXV A;  2V7J A;  2XQA A;  3KV9 A;  2F4V T;  3KBU A;  2IML A;  3HKC E;  3P4W A;  2BS2 A;  2X9X A;  1SE7 A;  1HCI A;  3PE0 A;  4HKA A;  2X9W A;  3PUS A;  4ZK4 A;  2MOZ A;  5JDN A;  1E1H B;  5LJM A;  4EXT A;  4H63 V;  1XZY A;  1YKE B;  2UZ6 A;  3QB5 K;  2EHO C;  2CBI A;  1KNZ A;  2BJ0 A;  2CBJ A;  1XMQ T;  3BK9 A;  5FNV E;  5FL1 A;  3N2G E;  5AFM B;  2XQ8 A;  2ODV A;  1BR0 A;  3P4S A;  3H37 A;  2UU9 T;  2LSG A;  2YU2 A;  3GA8 A;  5LMN T;  4TN7 B;  3F31 A;  2W2U A;  2Q9Q A;  5KXJ A;  3P7I A;  4B3S T;  3GMI A;  4JUY A;  5AQR B;  4PFP A;  1MND A;  2KSR A;  4JI8 T;  2YME A;  2VQE T;  2LSY A;  1G8X A;  1WLX A;  4AI6 A;  1KEY A;  2FJA A;  2E5L T;  3C79 A;  3SFE A;  4IE7 A;  3R84 B;  3EI0 A;  2I6H A;  3GUA A;  3OKQ A;  4HWH A;  5HXE A;  3ZT5 A;  4DR5 T;  3IF8 B;  2V26 A;  2ES0 A;  5JDH A;  1ZEE A;  4H9N C;  4JEH B;  4J2C A;  4NZB A;  5J2U E;  4JLE A;  4YT0 A;  5JDG A;  2BVM A;  1J5W A;  4NUV A;  4TV9 E;  4YJ2 E;  4QXH B;  4IDO A;  4GOU A;  2WM9 A;  3E22 E;  1NEK A;  3O1H A;  4DBQ A;  3UUL A;  1CHU A;  2WDR A;  4QKN A;  4KI0 F;  1HNX T;  3KFW X;  4YXD A;  3PUA A;  4DUY T;  2EHO B;  4HFB A;  2XNV A;  3DTO A;  4GKK T;  5FY1 A;  2LOS A;  2W0G A;  5C2T A;  5CJ5 A;  2B76 A;  2WMO A;  4DV3 T;  1HR0 T;  4BQT A;  2JJ9 A;  3UU3 A;  5JDM A;  3Q9D A;  3SRZ A;  3MJX A;  3AEG A;  1HG2 A;  2K5B B;  3MZK B;  3SIO A;  2YDS A;  5JDF A;  1XDP A;  4PK4 A;  3RQW A;  2XHE B;  1W0B A;  4CQI A;  3TLW A;  1KK7 A;  2JIW A;  4ILB A;  3QK6 A;  3S4U A;  3JCF A;  2H7O A;  2XM1 A;  4WZX A;  2CCQ A;  5LGT B;  1WR0 A;  4DV7 T;  1FEW A;  3AEB A;  2A9U A;  5BMV E;  1UV6 A;  4Z90 A;  1WCR A;  4IE0 A;  4H9P C;  5JH7 E;  4Z8X A;  1WYC A;  5J5F A;  2BBJ A;  3ZST A;  3AXJ B;  3A7M A;  3JAD A;  2I0M A;  4HE8 A;  4IDQ A;  4GIW A;  2CWY A;  3AEF A;  4B5D A;  2JRK A;  3MA9 A;  3AE3 A;  4I4T E;  3RIU A;  5F5W A;  2K24 A;  3AVR A;  1FMV A;  4CXX A;  4H9S E;  3PU8 A;  2YOE A;  5HYA A;  1X79 A;  2Q9Q C;  3KV4 A;  2JQ9 A;  1R8I A;  4NPP A;  4ALX A;  1MIY A;  3L3P A;  1EZ3 A;  1U5P A;  1D0Y A;  2BYQ A;  2UXN B;  5EZY E;  4HFH A;  1IBL T;  3J7Y q;  2JQH A;  1OWA A;  2YDQ A;  2W8G A;  3NRY A;  4DR1 T;  3L8R A;  3C64 A;  3ESL A;  1S94 A;  2D0T A;  2KZ7 B;  2NTY A;  3UQ4 A;  2NP9 A;  4YFS A;  1YQ3 A;  3ZMU B;  1N32 T;  4UM3 A;  4D01 A;  4DR7 T;  4CN1 A;  4KUM B;  3FBZ A;  2W62 A;  3RIF A;  4OFZ A;  3GN5 A;  2N1G A;  4IE6 A;  3K3N A;  4LFA T;  2XZ5 A;  3WTH A;  1BR4 A;  3ABV A;  5LHG B;  4ZK1 A;  3PUR A;  1WR6 A;  4AKG A;  4P0A A;  2C0S A;  4IL9 A;  3RYH E;  3KVA A;  3HA4 A;  3P4P A;  5LNK A;  4DV2 T;  1US7 B;  2VUR A;  3PDY A;  4IE4 A;  3ZJ1 A;  5L3B B;  2QGS A;  4QH1 A;  2XTL A;  1B7T A;  2BG9 B;  1O3X A;  5CA0 E;  4YSZ A;  2WU2 A;  3OPC A;  3TLU A;  1SA0 E;  2KMF A;  5FXZ A;  3SQ9 A;  2VAS A;  4ADZ A;  4YY3 T;  2XYT A;  3WI3 A;  3UU5 A;  4JI1 T;  4DV1 T;  3I9W A;  5ABH A;  2D5U A;  1E7P A;  2LM9 A;  2IIU A;  3LDQ B;  1UUS A;  3RIU C;  4DV4 T;  5JRC A;  3ETV A;  3J9X 1;  2QRX A;  2WWU A;  1Y01 A;  3PUW F;  3PMZ A;  4U3C A;  5JDQ A;  5J5H A;  4PAG A;  4WW0 A;  2X9Y A;  4NIQ A;  4QX7 B;  1IJ5 A;  3H3M A;  5HWX A;  2WS3 A;  3A5X A;  3BQK A;  5AQT B;  2ZJV A;  5ADX L;  3KV5 A;  5AQO B;  1I94 T;  2PBI A;  3HR0 A;  4ISS A;  3LBX A;  2NW9 A;  3EUH A;  2JMH A;  2XQ5 A;  2V5D A;  2Y56 A;  4LML A;  4UR9 A;  4HFD A;  4LMK A;  3ANW B;  3V5U A;  5CA1 E;  1CUN A;  2IUB A;  4QH4 A;  2YK0 A;  2D0U A;  1WRD A;  5AQK B;  2YIN A;  2D9D A;  4WYV A;  2XQ3 A;  3AXJ A;  2A2F X;  4YHH T;  4AFG A;  5HXC A;  4AQF C;  4ERR A;  3CQG B;  3C84 A;  5JVD E;  5HCM A;  4LF6 T;  2BR7 A;  2NWB A;  4WV9 A;  5BW2 A;  2K9A A;  4OHF A;  4O4J E;  2PG8 A;  2BYR A;  4CXY A;  1YD8 G;  2UUC T;  2J47 A;  3ZMS B;  5AFH A;  3AE8 A;  4KBM B;  4JYA T;  5AFL A;  4TNW A;  4WBN E;  1D1C A;  4ZI3 D;  3N9P A;  4KHZ F;  1N33 T;  3ZDG A;  2DHR A;  4EEB A;  4HFI A;  3FZL B;  4LF4 T;  2NR4 A;  5IWA T;  1HF8 A;  4QHO A;  5AIN A;  4P09 A;  4UM3 P;  3KBT A;  3AB3 B;  4XHE A;  2DNX A;  2AE9 A;  4BA9 A;  2BKP A;  3EHZ A;  4IT4 A;  4EAH A;  3ZJ2 A;  3WTN A;  2FJE A;  4YTP A;  4E7Z A;  5C8Y E;  2CE7 A;  4EOZ B;  2XSA A;  1VRB A;  1XNQ T;  4DBM A;  4H9O C;  3SQ6 A;  5J1G A;  2XSB A;  1HTJ F;  5FMN A;  2LLY A;  2ZM8 A;  4JI7 T;  2IHR 1;  2XAJ B;  2XYS A;  2WSS V;  2LJL A;  5FY7 A;  3UU8 A;  3C98 B;  4I0U A;  2V8S V;  3WAJ A;  2BBH A;  4KP3 C;  2QA7 A;  4AKR B;  1MMG A;  1QUU A;  2MYS A;  2ZMA A;  2IC6 A;  5LG4 A;  2XAF B;  3Q5W A;  5DAB A;  4WBO A;  2YEV C;  5CGM A;  3RKO A;  5TAO A;  2DI4 A;  1LVF A;  3O1J A;  3WIP A;  4U72 A;  4I50 E;  1LVK A;  5HWY A;  4IDZ A;  1MIW A;  2FJD A;  3EAB A;  4ZR6 A;  3LK3 B;  1N34 T;  4F8H A;  2XAH B;  5HCJ A;  3ZN0 B;  3PUZ F;  5ABF B;  2LSI A;  1G73 A;  3AA0 B;  2HN1 A;  5JRE A;  2CEA A;  2GK9 A;  4X5T A;  3UU6 A;  1I6Z A;  5AQS B;  3L09 A;  3AEA A;  2M6I A;  5DQV A;  4MFR A;  3ZDH A;  3RQU A;  4ZJT A;  3T1H T;  4CI1 B;  3H3A A;  2L3L A;  2W67 A;  4ZRU A;  2VK9 A;  2PGZ A;  5L3G B;  4UVB B;  3AE9 A;  2LSK A;  2N2N A;  4U31 A;  3E0Z A;  2Z6E A;  5C3J A;  5HEO A;  1X9B A;  2XZE A;  1UX4 A;  5HXS A;  2JPF A;  2DCF A;  5AFJ A;  4UEM A;  3LG7 A;  5KZU A;  3CX7 B;  2CRB A;  2M6B A;  3T4M A;  4ASK A;  5FXX A;  2CHO A;  2V7K A;  4YSX A;  4UM1 A;  1FIO A;  5FVL A;  3U8L A;  4AQF A; 
#chains in the Genus database with same CATH homology
 3ZDG A;  5J5G A;  2XQ6 A;  4ZR6 A;  2BJ0 A;  2W8G A;  3PMZ A;  4UXU A;  4F8H A;  4TNV A;  1UW6 A;  5CO5 A;  3SIO A;  4HFI A;  3WTJ A;  5J5H A;  4ZJS A;  2Y7Y A;  2LKH A;  3IGQ A;  2BG9 A;  5HEG A;  3RQW A;  5AIN A;  3TLS A;  4XK9 A;  5AFM B;  2XQ8 A;  5CFB A;  5HCJ A;  5LXB A;  4UM3 P;  3UQ4 A;  3TLW A;  5AFN A;  4ZZC A;  2BG9 C;  2WN9 A;  2ZJV A;  4TWF A;  2X00 D;  3SH1 A;  3U8J A;  4COF A;  4XHE A;  4UM3 S;  5L47 A;  4ILB A;  3U8N A;  5IUX A;  5HEJ A;  5LG3 A;  5HEU A;  4UM3 A;  5JME A;  3JAE A;  2XQ5 A;  3PEO A;  5HEH A;  4D01 A;  1OED E;  2W8F A;  4IRE A;  2PH9 A;  5BRX A;  4HQP A;  2BG9 E;  2YN6 A;  3EHZ A;  4X5T A;  4IL4 A;  2WNJ A;  3WTN A;  3UU4 A;  3UU6 A;  2Y56 A;  1UV6 A;  4UY2 A;  3RIF A;  4LML A;  4Z90 A;  4AFT A;  2LM2 A;  3EAM A;  3P50 A;  4HFD A;  4LMK A;  5TVC A;  2KSR A;  2YME A;  4HFC A;  2M6I A;  5J5F A;  1UX2 A;  4DBM A;  2WNC A;  2XZ5 A;  4QH4 A;  3TLT A;  3ZDH A;  3C79 A;  3RQU A;  3SQ6 A;  3WTH A;  4QAC A;  3JAD A;  4AFH A;  4LMJ A;  4ZJT A;  3JAF A;  3UQ7 A;  4ZK1 A;  5J5I A;  1OED A;  2BYP A;  2ZJU A;  3EI0 A;  4PIR A;  4BFQ A;  3U8K A;  2LLY A;  3WTI A;  4IL9 A;  2XYS A;  3GUA A;  4B5D A;  2LKG A;  5FJV A;  2C9T A;  2XNT A;  2XQ3 A;  3UU8 A;  4TWD A;  2YKS A;  2XZ6 A;  2XQA A;  4ZRU A;  5L4H A;  4QH5 A;  4ILC A;  2PGZ A;  4Z91 A;  5AFK A;  1OED C;  4QH1 A;  2BG9 B;  4NZB A;  3RHW A;  3P4W A;  1I9B A;  4AFG A;  2BYS A;  3UUB A;  3C84 A;  2Y54 A;  4A97 A;  2YOE A;  2BYN A;  5L4E A;  5HCM A;  5HEO A;  2Y57 A;  2WNL A;  3TLU A;  5SYO A;  2BR7 A;  1OED B;  3SQ9 A;  2XYT A;  4WV9 A;  4NPP A;  5AFJ A;  4ALX A;  5BW2 A;  3RIA A;  3TLV A;  3UU5 A;  2Y58 A;  5AFM A;  2MAW A;  4HFE A;  2BYR A;  5KE4 A;  5KZU A;  4ZZB A;  3WIP A;  3LSV A;  4EZ1 A;  3WTL A;  4QAA A;  2M6B A;  3ZKR A;  4A98 A;  3T4M A;  2BYQ A;  4FRR A;  4QAB A;  2VL0 A;  4HFB A;  2XNV A;  4ZK4 A;  3WTK A;  3U8M A;  2QC1 B;  3WTM A;  5AFH A;  2X00 A;  3RI5 A;  5J0Z A;  2XQ7 A;  2YMD A;  4TNW A;  2BR8 A;  4UM1 A;  5AFL A;  4TWH A;  3U8L A;  4HFH A;  4ILA A;  4BQT A;  2XQ4 A;  3WTO A;  2UZ6 A;  3UU3 A;  2WZY A;  2XNU A;  5BP0 A;  2XQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...