3UU4A

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in the crystal in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu4A01
2UZ6A 3JADA 2BG9C 4QH1A 5J0ZA 5HCMA 2PGZA 3ZKRA 2XQ4A 3LSVA 3P50A 5CO5A 3T4MA 5SYOA 2YN6A 2M6IA 2Y54A 4FRRA 1UX2A 5AFJA 5HEHA 3TLWA 3PMZA 4AFTA 5JMEA 4F8HA 2ZJUA 3U8JA 2BJ0A 5KZUA 3EHZA 3RHWA 4XK9A 5AFNA 2BR7A 2XQ3A 4BFQA 4UM3P 4ZZBA 2M6BA 4TNVA 4PIRA 5BRXA 4HQPA 2XQ8A 3RIAA 1I9BA 4Z90A 4LMJA 4DBMA 3ZDHA 2W8FA 5J5HA 4ZR6A 3WTLA 3UU4A 4TWHA 4UY2A 4B5DA 2ZJVA 2LM2A 2WN9A 3U8KA 4COFA 2W8GA 2Y7YA 5HCJA 1OEDB 2LKGA 2X00A 3GUAA 4UXUA 3EAMA 3PEOA 3WTHA 3IGQA 5HEJA 3C84A 4HFBA 3WTJA 4EZ1A 4ILAA 3SQ6A 2XQ5A 1OEDE 3P4WA 5J5GA 5CFBA 3UUBA 3WTIA 4HFEA 5TVCA 1OEDA 3RQUA 5J5IA 4X5TA 3EI0A 3UQ7A 5J5FA 3RQWA 4QABA 2LLYA 4IL4A 3UQ4A 3TLSA 2MAWA 3U8LA 4IL9A 5AFHA 3UU3A 5L4EA 5BP0A 4QH5A 2XYSA 2Y56A 2XNVA 4QACA 4AFGA 4ZK4A 4A98A 5KE4A 5LG3A 4HFHA 4XHEA 4IREA 3JAFA 2WNJA 4A97A 3TLTA 2QC1B 2XYTA 2XZ6A 4QAAA 5IUXA 3SIOA 4BQTA 2XQ9A 5L4HA 3UU8A 4NZBA 2C9TA 2VL0A 2XZ5A 4ZZCA 2BG9B 4ZJSA 4UM3S 3WTNA 3RI5A 3WTKA 2BYPA 3UU6A 5LXBA 3RIFA 4AFHA 3SQ9A 1OEDC 2WNLA 2XNTA 4ALXA 4HFIA 4ZJTA 2BG9E 2WZYA 2LKHA 5L47A 2YMDA 4ILCA 5HEGA 2BYQA 4TWDA 2BYRA 3WTMA 2XQAA 2BG9A 4LMLA 4UM3A 5HEUA 4HFCA 4WV9A 5AFMB 2X00D 4ZRUA 2BYNA 2XNUA 5FJVA 5HEOA 4D01A 3U8MA 2WNCA 4TWFA 4ILBA 3JAEA 2KSRA 4LMKA 3WIPA 4QH4A 2Y57A 2YMEA 3TLUA 1UV6A 4TNWA 2BR8A 4Z91A 3UU5A 3TLVA 2BYSA 2YKSA 2Y58A 5BW2A 5AFMA 2XQ6A 5AFKA 3C79A 3U8NA 3WTOA 2PH9A 5AFLA 5AINA 4NPPA 1UW6A 4HFDA 3SH1A 4ZK1A 2YOEA 3ZDGA 2XQ7A 4UM1A
chains in the Genus database with same CATH superfamily
4JI2T 3E22E 3KFWX 1D0ZA 3GWHA 3KBTA 4AFTA 1M62A 2ZJUA 4XK9A 3AEEA 3RIUC 4UM3P 3UFEA 3LK2B 2OLTA 5LMNT 4GK5E 3MXZA 3P4PA 4ZS3A 3R84B 4DMVA 4PK6A 5AQPB 3I0QA 2YDQA 3WAKA 1T72A 4UXUA 1VOMA 2XJ7A 4KI0F 4QX8B 2X0YA 5IWAT 2CBJA 1Z8UA 2LLYA 4DUZT 5AQSB 4PFPA 5LG3A 2FBWA 4HWDA 3CX7B 1HX8A 2CPTA 3B13A 2BYPA 3NZQA 2YINA 4DVDA 3OJAA 5KXJA 4AFHA 1W09A 5HXEA 4DO0A 3U3IA 3WTMA 2Z6EA 2BYRA 1BR4A 4AKHA 4LFAT 3KBUA 2XY8B 5AQFB 3N5LA 2H88A 2WBLA 2CCQA 2PG8A 1D1BA 2WB5A 4B3RT 5BW2A 5JDGA 3CIRA 1FIOA 4Q25A 4HFDA 3K3OA 1U5PA 3ZDGA 2XQ7A 4MHCA 1W9RA 5IYZE 4PAGA 2B76A 2V1DB 4QH1A 2XQ4A 1MMDA 4DV1T 1UX2A 5LJMA 5DJQC 3AAIA 5JMEA 1YXRA 2VB6A 3LBXA 3RKGA 2WDRA 2W67A 3ZDHA 5FVLA 2LM2A 2Y7YA 5HCJA 1T98A 2X00A 2L8KA 3T1YT 2A3DA 2UUAT 2XASB 2XQ5A 3VHLA 2WY2A 4IL4A 3IA3A 2KNDA 2WZIA 4AFGA 5FKYA 2PJQA 3TLTA 5A1LA 2QC1B 4EGWA 1YW0A 4NZBA 3OYZA 3UUXB 2H7VC 1E7PA 3MACA 4EEBA 3WTKA 3SS1A 1US7B 1O3XA 4N78D 2C5IT 3PURA 3ZMVB 5HXRA 1BR0A 2H89A 3O4XE 3K1SA 2XQAA 2Q9QD 3K3QC 3N9PA 1IBMT 4OYJA 2G0UA 2RA1A 2KSRA 3V5SA 1HR0T 1YQ4A 3RYFE 4LFBT 3MZKB 5LG4A 3B57A 4EEDA 3MJXA 3SRZA 3PU8A 4X66T 1KNRA 3T4MA 4YSZA 3N9LA 2CE7A 5LB7B 4FRRA 5ABFA 4IDQA 2WWVA 3ZT6A 2NW8A 4U2ZA 4YHJA 3UT5E 2IAKA 4HTEA 4QWNB 2X0HA 2V6XA 3QK6A 2CMRA 1FMWA 2BS4A 2WSSV 1SA0E 4LFCT 5LYJE 3U8KA 3BQIA 4COFA 4WW0A 3N9MA 1HFAA 3PEOA 2D5UA 3O1HA 2PFVA 2VWAA 2W63A 4EAHA 5AFHA 4KHZF 2XNVA 4HFHA 3HR0A 3SFDA 2X66A 4AKIA 2DLRA 5L3CB 2C9TA 2X9YA 3UULA 3FXEB 5CA1E 2CBIA 2KXPB 2LSGA 2ACZA 3ZN1B 2BYNA 2JQHA 5HEOA 4DR6T 2KINB 4Z91A 3P8CD 3J9X1 5FY7A 2XQ6A 2WAUA 2HPLA 2MPKA 3WTOA 3SH1A 1R8IA 4J2CA 3ZYLA 2QRXA 2XZEA 4DBQA 3H3AA 2C0SA 3AE8A 2HPJA 5LBMA 5HAXA 2E9XB 3AEAA 2BR7A 5EZYE 2XQ3A 5BRXA 4ADZA 4WNKA 2Q9QB 5FNVE 5C2TA 2WDVA 3RRWA 2W8FA 3UTKA 2FUPA 3UU4A 1IBLT 3IHRA 5JDFA 3L8RA 3MA9A 2J1DG 4I4TE 3CWZB 3P4WA 3WTIA 5BR8T 1XMQT 2MYSA 2V8SV 4YSYA 3UQ4A 3CK6A 3TLSA 3WAJA 3Q5WA 3UU3A 4AI6A 3GN5A 2CM0A 2VURA 5LHGB 4IREA 5LHIB 4BAYB 2VKJA 2UUCT 4DR7T 3IBPA 3ZLIA 5ETWA 4JI5T 4O4IE 2MTQA 1OWAA 3UU6A 3AE9A 3BK9A 3RYHE 3PJAJ 2L3LA 2LKHA 2WZHA 4EZ1A 2XAGB 4TWDA 5AFUL 4CXYA 4QXBB 4HFCA 2LRLA 3PJAA 2BKOA 1FJGT 4ZRUA 2JQKA 4LF6T 2KZ7B 5JR9A 3Q5DA 4YJ3E 5JDQA 1IBKT 3HKDE 1BR1A 5JRCB 2YKSA 2V7MA 5L2LA 3C79A 3O1JA 1HF8A 5AFLA 5HCMA 3I9YA 4EB6E 3LSVA 4JI8T 5KMGP 2Y54A 5L3GB 4CI1B 5HEHA 4UR9A 4YHHT 2ZLYA 3RIAA 4MBQA 1I9BA 4NXMT 2KWHA 4EZHA 3RKOA 1OXZA 3E08A 4IE4A 3MK7C 5KDMC 1L0VA 3EUHA 4JLEA 3WTHA 5AQRB 2F4VT 3CMLA 3ZMTB 4UV9B 1UK5A 5ABGA 5CFBA 4UVBB 3N9QA 1FEWA 3HI2A 2JMHA 4QABA 3U8LA 3F2EA 1SUMB 2WQYA 1ZEEA 4EXTA 4A97A 5IUXA 2Q9QC 5L4HA 1WR0A 1XWMA 2D0TA 3UU8A 2BG9B 1IAPA 1MMGA 2LSJA 2X9WA 1XNQT 4PFOA 2WNLA 3LDQB 3N2GE 4QKNA 1HNZT 3P7IA 3ZMSB 1S35A 2X0LB 2W4XA 3AEDA 4TUYE 4D01A 1ZOYA 1KK7A 5CA0E 2ES0A 5ABEA 4DV4T 5FXXA 5EK3A 4DUYT 3RIUA 5AQTB 5AINA 3GA8A 4XBFB 2ZM8A 3AA6B 3OKQA 3H37A 1HS7A 1AJ3A 1N36T 3RYCE 5FL0A 2PGZA 1WYCA 2FJEA 3AA0B 3AEBA 2XSBA 1UURA 5AFJA 3HL6A 1VCTA 2Y48B 5FP3A 1XDOA 2UXXB 3F31A 2SPCA 4IT4A 2LSKA 4HQPA 1Y01A 3PV0F 2ZM6T 3ZN0B 3K3NA 3FXDB 2B1EA 5LBQB 2C5JA 5HXCA 2V6YA 4L9IA 4JUYA 3C51A 5H6QB 4EYYR 4QXHB 3FZHB 2WWUA 2J62A 5C3JA 4HEAA 5J5GA 4U33A 4X5TA 5HWYA 2XHEB 4DNDA 4IL9A 5CB4E 4QH5A 2WNJA 3NRYA 1HG5A 1N33T 1QUUA 3NVOA 3EDVA 4CZZB 1SHZC 3SQ9A 1VRBA 4TV8E 1MMNA 1YKEB 2X9XA 1NWMX 2X9HA 4ISSA 2VVSA 3QB5K 3PUZF 1HNXT 4KHPT 3LBXB 5KX5E 4TWFA 2LSIA 4ZI2D 2UXCT 4I50E 3CQCB 3WIPA 4L0RA 1UV6A 5AFMA 4HWCA 4EOZB 1WFDA 3EVYA 4G63A 2V7IA 2BG9C 2NW7A 2KT9A 1LVKA 4K0KT 3UUNA 3TKLB 4ISTA 3L09A 3EHZA 2LE8A 4OHFA 4CQIA 1UX5A 4DV0T 4A56A 5DQWA 2N1GA 1FMVA 4I43B 4EIWA 5JDLA 5HWXA 2W62A 2VKOA 2K5BB 2ZJVA 3AE6A 3L3PA 4U7YA 4YSXA 2WN9A 1T8BA 1XZYA 4OK0A 3Q9DA 2H3RA 2WP9A 4GOUA 4CN1A 5ADXL 4ILAA 4X20E 3UUBA 4NIQA 3C4ZA 2N9DA 4X64T 3PUGA 5J5IA 3MKDA 2CRBA 4H9OC 5L4EA 2BZBA 4YT0A 4WYVA 4QACA 3PUWF 4YTNA 4AQFC 2UXDT 4ERRA 3NBXX 3FHNA 3RGLA 2AE9A 5JTGA 3D0TA 2K3WA 2VL8A 4ZEYA 2CHNA 4NXNT 3Q2MA 1IJ6A 3DJBA 4I0UA 2IMLA 2AXDS 3RPUA 3JAEA 4O2AE 2ZM0A 3S4UA 4HGAA 2DNXA 1B7TA 2XAJB 2GK9A 5AFKA 4ILUA 2VASA 2LM9A 2E9XD 4ZK1A 3I9WA 3U78A 1KNPA 4E7SA 1MIWA 4JV5T 4U7IA 3P50A 3N9NA 3ESLA 2EHOD 4DIDB 1UX4A 2V5CA 1D0XA 1UCUA 4ASKA 2LEHA 3I1AA 2LHNA 5FXWA 3G06A 5AQJB 1MIVA 4Z90A 4DBMA 4X62T 2CA5A 2XPKA 4DR1T 3WTLA 1XNRT 2W8GA 1X79A 3PUAA 2LKGA 1CHUA 4DMWA 5AQGB 5HEJA 3SQ6A 4DV7T 2DCFA 4ZHQE 3QOFA 2QGSA 4UELA 2BBJA 1QSDA 4EZ4A 1MMAA 5TAOA 3OYXA 4HN9A 4X1KE 3RI5A 1KEYA 2BDEA 2BG9E 2WMOA 5JVDE 5JH7E 5JDHA 4TZ4C 2XSAA 4IDPA 3KVAA 3R6NA 4WBOA 4C90A 1KFYA 1KF6A 4JI6T 3ZCJA 2V7KA 2YMEA 2BR8A 4CI3B 2VQET 3ZJ1A 2YOEA 3ZT7A 3UFGA 4BFQA 2W0GA 5AQQB 2DWKA 3V5UA 3NKZA 3CKDA 2RP4A 3EABA 3TLWA 3C4WA 3RC3A 3RHWA 2WDQA 5LGNB 1KNZA 4ZZBA 3CVRA 5HYAA 2LSYA 2Y8DA 2ODUA 4GYSA 4O4LE 4U74A 4B3MT 3PUSA 4B5DA 4U72A 5EK4A 4ZOLE 2CLYB 4KUMB 4PJNA 1J1JA 4BJNA 2BVLA 3EAMA 2VKDA 2LJLA 2XAFB 2CHOA 2HN2A 2VVNA 5TVCA 3KDSE 1G73A 5J5FA 5AQNB 4ZK4A 2EHOB 5M4YA 4OX9T 4XHEA 3JAFA 2ACXA 5CGMA 3WI3A 2OV9A 2LRKA 2MOZA 2X67A 4QXCB 4H63H 4ZZCA 4ZI2C 4X65T 3H3MA 4O2BE 1JNZA 2WMNA 1IZNB 4YJ2E 3P4SA 3FB2A 5L47A 2E8IA 2YMDA 5HEGA 4UM3A 5L3DB 4WV9A 1YD8G 5AQHB 5FVKA 3QNUA 4NUVA 2J4GA 3M65A 4UEMA 2VQFT 4IDNA 1D1AA 3ANWB 2I6HA 2W00A 3C64A 2DHRA 3JADA 5EK2A 4JI1T 3BQLA 3JC6D 1MNDA 4AISA 2KMFA 4U31A 4H63V 4DV2T 2X68A 2PTFA 2XTLA 2LOSA 4FJOA 3LK3B 3LK42 4PIRA 2A2FX 4E7ZA 4LMJA 3LJCA 2E5LT 3AXJB 3ONJA 5AQMB 4LF8T 3OBVE 2BBHA 3VRBA 4U2YA 3PDYA 2Q9QA 2QVAA 1OEDB 1J5WA 3AECA 1GQEA 2KWIB 3RYIE 3SOLA 2NP9A 2YDSA 2K9AA 3AE4A 4ANJA 2I0MA 2D2SA 5KE4A 2XZ6A 4UVAB 5AQUB 2W61A 2NW9A 1CUNA 3AVRA 4GYRA 4PK4A 5JREA 2ODVA 4EV6A 2UU9T 2J47A 5LGTB 4EYUA 1H7CA 4AKGA 4AIUA 3HA4A 2E9XC 5HEUA 1MIYA 2X00D 3T1HT 2A72A 4ILBA 4LF7T 4QH4A 2Y57A 4ZI3D 3TLVA 1V9DA 2EHOC 2X51A 1I94T 4P0BA 4FI5A 2V6YB 4YXDA 4UM1A 4M1PA 3A8YC 2LOPA 3FZKB 2BKNA 2P9BA 5JRCA 3ZKRA 3JCFA 4G2AA 1NENA 5AQIB 2W66A 3RX6A 3B5MA 3ZMUB 4F8HA 2BJ0A 2N2NA 3C98B 4ZI7E 5FXZA 3W15B 4CN6A 2YU2A 4JI7T 2WS3A 3C50A 1ZV4X 3ZYKA 2IUBA 4O8SA 2ZM2A 3OTOT 4IE5A 4O4JE 1XDPA 1HNWT 4O4HE 4IDZA 2DWGA 3RC8A 3PE0A 1J5ET 3DTOA 2IIUA 2H7OA 4QHOA 3PUXF 5FXVA 3UQ7A 5JDNA 1WRDA 3HKEE 3ZC1A 2MAWA 3ZSTA 5GONE 4HWHA 2XYTA 2RPAA 5L3BB 4PJJA 2KLQA 2XZ5A 2NTXA 1VCSA 4ZJSA 1LVFA 3AE5A 5IHYA 4UF0A 1OEDC 4AQYT 4GK0E 3EDUA 1YKHB 3AB3B 2BG9A 3KV6A 4C91A 5F5WA 2XNUA 2WNCA 4IE6A 2V7JA 3PUVF 4V1Av 4TNWA 4JI0T 1N34T 5E0OA 2XM2A 2OA5A 4IIJE 3U8NA 3ETVA 4LF9T 3J7Yq 3ZYMA 4IDOA 4HKAA 3HKCE 4OYKA 4TN7B 3ZC0A 2YN6A 5JQGE 2M6IA 1JNRA 4JI4T 3HKBE 2CWOA 3U8JA 1ZHCA 4DR2T 5AFNA 2V26A 2M6BA 5L3EB 5CJ5A 5L3FB 2L9QA 5LJNA 3VKHA 3KINB 4UY2A 2UXNB 3N2OA 3FZFB 5LOVE 3AAAB 4P1NA 4AQFA 3A5XA 2XM1A 4PK5A 4MFRA 5J2TE 3F57A 1N32T 4YY3T 4OFZA 3CPZA 2XAQB 4H9SE 3K8PC 4DR3T 5BP0A 2I59A 2NR4A 4JBWF 2D9DA 4A98A 2BVMA 4QAAA 5BMVE 2E5VA 5HXSA 2QYWA 1W0BA 3ZMZB 4H9PC 4YFSA 5F8PA 4ALXA 5HXHA 1EZ3A 4WZXA 3N2KE 2NTYA 3SFEA 4LF4T 1SE7A 4TV9E 3RRCA 3N9OA 2JRKA 3JC6C 3LG7A 1WYBA 1M7KA 4QX7B 2K24A 4KMCA 2CXFA 4AXPA 4NPPA 2BKPA 3ZSSA 1YQ3A 4XAXB 3P4RA 5ABFB 2UZ6A 2XQYA 4H9QC 3GMIA 5CO5A 2W2UA 3AE7A 4H9RC 4PNIA 3AA1B 3Q5EA 3VR9A 2LT3A 1WCRA 3O1IA 5F3JA 4UV8B 2VK9A 2JQQA 4HFVA 5FMNA 1HG2A 4YTMA 5J5HA 1MNEA 3RLFF 4TWHA 3NZPA 2YDRA 4YTPA 5LGUB 3GUAA 5H6RB 2XAHB 3IGQA 2NOXA 4HFBA 1OEDE 2FJAA 3VR8A 2K48A 1WR6A 4KBMB 3EI0A 2YEVC 1E1HB 4ZS2A 4IHJE 4H9NC 1S94A 3LFMA 4DBRA 1HTJF 3KVBA 5LHHB 3ONXA 5DABA 4IE7A 3A7MA 4P09A 4CI2B 4ZI3C 3VKGA 4HFIA 3T8OA 4ZJTA 4B3ST 4ILCA 2BYQA 2YK0A 5AQKB 2JQ9A 4HWIB 1Z0PA 4DR4T 2WU2A 3AAEB 4CXWA 1DU2A 3CQXC 5FL1A 3UU5A 5LXTE 2BYSA 4UVCB 3PUQA 3ZCIA 4IE0A 1UW6A 3AE1A 2VKHA 4DV3T 2CXLA 2UUBT 4UXNB 1BR2A 5AQVB 2QA7A 3QUJA 3QC9A 2WCAA 3RH3A 5KZUA 3ZT5A 2IHR1 2WU5A 1G8XA 2Y6XA 3AVSA 4TNVA 2CWYA 4I55E 4K0UA 2ZMAA 3BQKA 1UGOA 2MBGA 3QB5A 1HCIA 3GN5B 5AQLB 3ZPOA 4HFEA 5LA6E 2IDOB 4LF5T 4HE8A 3IF8B 4L5GA 4GKKT 5LXBA 4IGUA 4AKRB 2C5KT 5JR9B 2XNTA 1LRZA 2JIWA 3ZJ2A 3VU7H 4AKLA 4LMLA 2FJDA 5C8YE 5J2UE 2FJBA 1ZKEA 4GKJT 2LHRA 1NAFA 3AE3A 3OVUA 1Y64B 3PTRB 4B3TT 4U3CA 5ABHA 4CXXA 2Y58A 1LKXA 2JMKA 3O9XA 3PU3A 2PH9A 2BS2A 2V5DA 4PJMA 3AEFA 5J0ZA 3NRXA 2V7LA 5SYOA 1WLXA 4PW8A 1D1CA 5DQVA 2XQ8A 2UXBT 5FYMA 3OPCA 2JPFA 3IEEA 3KV4A 3C84A 3WTJA 3ABVA 2D0UA 3CQGB 3RQUA 4WBNE 2CEAA 3KV5A 3P4QA 3RQWA 4Z8XA 3AE2A 2E9XA 2Y56A 1T7SA 3FZMB 4JEHB 4X1YE 4TX5A 2XQ9A 3FBLA 4PJLA 2HHHT 2PBIA 3WTNA 2DL1A 2EHOA 2HN1A 4MALA 1QLBA 4GIWA 3NWIA 4X1IE 4UIGA 1IJ5A 2E2AA 4NUUA 1I6ZA 1U4QA 4DV5T 5FJVA 3U8MA 2XUEA 4JEUB 3PUYF 4LMKA 5AQOB 3M3ZB 3TLUA 3RF1A 3CX6B 4DR5T 2IC9A 4JYAT 4A5XA 5LP6E 2CLYC 4AQGA 2NWBA 4BJMA 3ANWA 1W0AA 4F6RC 5JR9C 4XZCA 3PMZA 5J1GA 2IW5B 5FY0A 2BS3A 4ZXLA 1NEKA 3SWHA 1XMOT 3Q5XA 2A9UA 2YU1A 2WM9A 4ZR6A 4HWFA 4UF0B 4JI3T 4P0AA 1X9BA 4YLHA 3ONLC 3AXJA 3C4XA 3UUMA 2HH7A 3FBZA 5JDMA 3DP7A 1OEDA 4MLKA 3E0ZA 4BA9A 3ETUA 4KX6A 2XYSA 3KV9A 4KP3C 4DV6T 2IC6A 1E2AA 4BQTA 5LNKA 3SIOA 3AA7B 2VL0A 2JJ9A 2CXDA 4UM3S 3L39A 2R6GF 3RIFA 1UUSA 4B6XA 2WZYA 1D0YA 3FZLB 3X1DA 1ZP0A 5AFMB 5FY1A 3I0OA 1HX1B 4CN4A 2M67A 3ZEFB 5LMUT 3CX8B 3VRAA 2DI4A 5LCYA 3AEGA
chains in the Genus database with same CATH topology
2UZ6A 3JADA 2BG9C 4QH1A 5J0ZA 5HCMA 2PGZA 3ZKRA 2XQ4A 3LSVA 3P50A 5CO5A 3T4MA 5SYOA 2YN6A 2M6IA 2Y54A 4FRRA 1UX2A 5AFJA 5HEHA 3TLWA 3PMZA 4AFTA 5JMEA 4F8HA 2ZJUA 3U8JA 2BJ0A 5KZUA 3EHZA 3RHWA 4XK9A 5AFNA 2BR7A 2XQ3A 4BFQA 4UM3P 4ZZBA 2M6BA 4TNVA 4PIRA 5BRXA 4HQPA 2XQ8A 3RIAA 1I9BA 4Z90A 4LMJA 4DBMA 3ZDHA 2W8FA 5J5HA 4ZR6A 3WTLA 3UU4A 4TWHA 4UY2A 4B5DA 2ZJVA 2LM2A 2WN9A 3U8KA 4COFA 2W8GA 2Y7YA 5HCJA 1OEDB 2LKGA 2X00A 3GUAA 4UXUA 3EAMA 3PEOA 3WTHA 3IGQA 5HEJA 3C84A 4HFBA 3WTJA 4EZ1A 4ILAA 3SQ6A 2XQ5A 1OEDE 3P4WA 5J5GA 5CFBA 3UUBA 3WTIA 4HFEA 5TVCA 1OEDA 3RQUA 5J5IA 4X5TA 3EI0A 3UQ7A 5J5FA 3RQWA 4QABA 2LLYA 4IL4A 3UQ4A 3TLSA 2MAWA 3U8LA 4IL9A 5AFHA 3UU3A 5L4EA 5BP0A 4QH5A 2XYSA 2Y56A 2XNVA 4QACA 4AFGA 4ZK4A 4A98A 5KE4A 5LG3A 4HFHA 4XHEA 4IREA 3JAFA 2WNJA 4A97A 3TLTA 2QC1B 2XYTA 2XZ6A 4QAAA 5IUXA 3SIOA 4BQTA 2XQ9A 5L4HA 3UU8A 4NZBA 2C9TA 2VL0A 2XZ5A 4ZZCA 2BG9B 4ZJSA 4UM3S 3WTNA 3RI5A 3WTKA 2BYPA 3UU6A 5LXBA 3RIFA 4AFHA 3SQ9A 1OEDC 2WNLA 2XNTA 4ALXA 4HFIA 4ZJTA 2BG9E 2WZYA 2LKHA 5L47A 2YMDA 4ILCA 5HEGA 2BYQA 4TWDA 2BYRA 3WTMA 2XQAA 2BG9A 4LMLA 4UM3A 5HEUA 4HFCA 4WV9A 5AFMB 2X00D 4ZRUA 2BYNA 2XNUA 5FJVA 5HEOA 4D01A 3U8MA 2WNCA 4TWFA 4ILBA 3JAEA 2KSRA 4LMKA 3WIPA 4QH4A 2Y57A 2YMEA 3TLUA 1UV6A 4TNWA 2BR8A 4Z91A 3UU5A 3TLVA 2BYSA 2YKSA 2Y58A 5BW2A 5AFMA 2XQ6A 5AFKA 3C79A 3U8NA 3WTOA 2PH9A 5AFLA 5AINA 4NPPA 1UW6A 4HFDA 3SH1A 4ZK1A 2YOEA 3ZDGA 2XQ7A 4UM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ6 A;  3JAD A;  2BG9 C;  4QH1 A;  5J0Z A;  5HCM A;  2PGZ A;  3ZKR A;  2XQ4 A;  3LSV A;  3P50 A;  5CO5 A;  3T4M A;  5SYO A;  2YN6 A;  2M6I A;  2Y54 A;  4FRR A;  1UX2 A;  5AFJ A;  5HEH A;  3TLW A;  3PMZ A;  4AFT A;  5JME A;  4F8H A;  2ZJU A;  3U8J A;  2BJ0 A;  5KZU A;  3EHZ A;  3RHW A;  4XK9 A;  5AFN A;  2BR7 A;  2XQ3 A;  4BFQ A;  4UM3 P;  4ZZB A;  2M6B A;  4TNV A;  4PIR A;  5BRX A;  4HQP A;  2XQ8 A;  3RIA A;  1I9B A;  4Z90 A;  4LMJ A;  4DBM A;  3ZDH A;  2W8F A;  5J5H A;  4ZR6 A;  3WTL A;  3UU4 A;  4TWH A;  4UY2 A;  4B5D A;  2ZJV A;  2LM2 A;  2WN9 A;  3U8K A;  4COF A;  2W8G A;  2Y7Y A;  5HCJ A;  1OED B;  2LKG A;  2X00 A;  3GUA A;  4UXU A;  3EAM A;  3PEO A;  3WTH A;  3IGQ A;  5HEJ A;  3C84 A;  4HFB A;  3WTJ A;  4EZ1 A;  4ILA A;  3SQ6 A;  2XQ5 A;  1OED E;  3P4W A;  5J5G A;  5CFB A;  3UUB A;  3WTI A;  4HFE A;  5TVC A;  1OED A;  3RQU A;  5J5I A;  4X5T A;  3EI0 A;  3UQ7 A;  5J5F A;  3RQW A;  4QAB A;  2LLY A;  4IL4 A;  3UQ4 A;  3TLS A;  2MAW A;  3U8L A;  4IL9 A;  5AFH A;  3UU3 A;  5L4E A;  5BP0 A;  4QH5 A;  2XYS A;  2Y56 A;  2XNV A;  4QAC A;  4AFG A;  4ZK4 A;  4A98 A;  5KE4 A;  5LG3 A;  4HFH A;  4XHE A;  4IRE A;  3JAF A;  2WNJ A;  4A97 A;  3TLT A;  2QC1 B;  2XYT A;  2XZ6 A;  4QAA A;  5IUX A;  3SIO A;  4BQT A;  2XQ9 A;  5L4H A;  3UU8 A;  4NZB A;  2C9T A;  2VL0 A;  2XZ5 A;  4ZZC A;  2BG9 B;  4ZJS A;  4UM3 S;  3WTN A;  3RI5 A;  3WTK A;  2BYP A;  3UU6 A;  5LXB A;  3RIF A;  4AFH A;  3SQ9 A;  1OED C;  2WNL A;  2XNT A;  4ALX A;  4HFI A;  4ZJT A;  2BG9 E;  2WZY A;  2LKH A;  5L47 A;  2YMD A;  4ILC A;  5HEG A;  2BYQ A;  4TWD A;  2BYR A;  3WTM A;  2XQA A;  2BG9 A;  4LML A;  4UM3 A;  5HEU A;  4HFC A;  4WV9 A;  5AFM B;  2X00 D;  4ZRU A;  2BYN A;  2XNU A;  5FJV A;  5HEO A;  4D01 A;  3U8M A;  2WNC A;  4TWF A;  4ILB A;  3JAE A;  2KSR A;  4LMK A;  3WIP A;  4QH4 A;  2Y57 A;  2YME A;  3TLU A;  1UV6 A;  4TNW A;  2BR8 A;  4Z91 A;  3UU5 A;  3TLV A;  2BYS A;  2YKS A;  2Y58 A;  5BW2 A;  5AFM A;  2XQ6 A;  5AFK A;  3C79 A;  3U8N A;  3WTO A;  2PH9 A;  5AFL A;  5AIN A;  4NPP A;  1UW6 A;  4HFD A;  3SH1 A;  4ZK1 A;  2YOE A;  3ZDG A;  2XQ7 A;  4UM1 A; 
#chains in the Genus database with same CATH topology
 4JI2 T;  3E22 E;  3KFW X;  1D0Z A;  3GWH A;  3KBT A;  4AFT A;  1M62 A;  2ZJU A;  4XK9 A;  3AEE A;  3RIU C;  4UM3 P;  3UFE A;  3LK2 B;  2OLT A;  5LMN T;  4GK5 E;  3MXZ A;  3P4P A;  4ZS3 A;  3R84 B;  4DMV A;  4PK6 A;  5AQP B;  3I0Q A;  2YDQ A;  3WAK A;  1T72 A;  4UXU A;  1VOM A;  2XJ7 A;  4KI0 F;  4QX8 B;  2X0Y A;  5IWA T;  2CBJ A;  1Z8U A;  2LLY A;  4DUZ T;  5AQS B;  4PFP A;  5LG3 A;  2FBW A;  4HWD A;  3CX7 B;  1HX8 A;  2CPT A;  3B13 A;  2BYP A;  3NZQ A;  2YIN A;  4DVD A;  3OJA A;  5KXJ A;  4AFH A;  1W09 A;  5HXE A;  4DO0 A;  3U3I A;  3WTM A;  2Z6E A;  2BYR A;  1BR4 A;  4AKH A;  4LFA T;  3KBU A;  2XY8 B;  5AQF B;  3N5L A;  2H88 A;  2WBL A;  2CCQ A;  2PG8 A;  1D1B A;  2WB5 A;  4B3R T;  5BW2 A;  5JDG A;  3CIR A;  1FIO A;  4Q25 A;  4HFD A;  3K3O A;  1U5P A;  3ZDG A;  2XQ7 A;  4MHC A;  1W9R A;  5IYZ E;  4PAG A;  2B76 A;  2V1D B;  4QH1 A;  2XQ4 A;  1MMD A;  4DV1 T;  1UX2 A;  5LJM A;  5DJQ C;  3AAI A;  5JME A;  1YXR A;  2VB6 A;  3LBX A;  3RKG A;  2WDR A;  2W67 A;  3ZDH A;  5FVL A;  2LM2 A;  2Y7Y A;  5HCJ A;  1T98 A;  2X00 A;  2L8K A;  3T1Y T;  2A3D A;  2UUA T;  2XAS B;  2XQ5 A;  3VHL A;  2WY2 A;  4IL4 A;  3IA3 A;  2KND A;  2WZI A;  4AFG A;  5FKY A;  2PJQ A;  3TLT A;  5A1L A;  2QC1 B;  4EGW A;  1YW0 A;  4NZB A;  3OYZ A;  3UUX B;  2H7V C;  1E7P A;  3MAC A;  4EEB A;  3WTK A;  3SS1 A;  1US7 B;  1O3X A;  4N78 D;  2C5I T;  3PUR A;  3ZMV B;  5HXR A;  1BR0 A;  2H89 A;  3O4X E;  3K1S A;  2XQA A;  2Q9Q D;  3K3Q C;  3N9P A;  1IBM T;  4OYJ A;  2G0U A;  2RA1 A;  2KSR A;  3V5S A;  1HR0 T;  1YQ4 A;  3RYF E;  4LFB T;  3MZK B;  5LG4 A;  3B57 A;  4EED A;  3MJX A;  3SRZ A;  3PU8 A;  4X66 T;  1KNR A;  3T4M A;  4YSZ A;  3N9L A;  2CE7 A;  5LB7 B;  4FRR A;  5ABF A;  4IDQ A;  2WWV A;  3ZT6 A;  2NW8 A;  4U2Z A;  4YHJ A;  3UT5 E;  2IAK A;  4HTE A;  4QWN B;  2X0H A;  2V6X A;  3QK6 A;  2CMR A;  1FMW A;  2BS4 A;  2WSS V;  1SA0 E;  4LFC T;  5LYJ E;  3U8K A;  3BQI A;  4COF A;  4WW0 A;  3N9M A;  1HFA A;  3PEO A;  2D5U A;  3O1H A;  2PFV A;  2VWA A;  2W63 A;  4EAH A;  5AFH A;  4KHZ F;  2XNV A;  4HFH A;  3HR0 A;  3SFD A;  2X66 A;  4AKI A;  2DLR A;  5L3C B;  2C9T A;  2X9Y A;  3UUL A;  3FXE B;  5CA1 E;  2CBI A;  2KXP B;  2LSG A;  2ACZ A;  3ZN1 B;  2BYN A;  2JQH A;  5HEO A;  4DR6 T;  2KIN B;  4Z91 A;  3P8C D;  3J9X 1;  5FY7 A;  2XQ6 A;  2WAU A;  2HPL A;  2MPK A;  3WTO A;  3SH1 A;  1R8I A;  4J2C A;  3ZYL A;  2QRX A;  2XZE A;  4DBQ A;  3H3A A;  2C0S A;  3AE8 A;  2HPJ A;  5LBM A;  5HAX A;  2E9X B;  3AEA A;  2BR7 A;  5EZY E;  2XQ3 A;  5BRX A;  4ADZ A;  4WNK A;  2Q9Q B;  5FNV E;  5C2T A;  2WDV A;  3RRW A;  2W8F A;  3UTK A;  2FUP A;  3UU4 A;  1IBL T;  3IHR A;  5JDF A;  3L8R A;  3MA9 A;  2J1D G;  4I4T E;  3CWZ B;  3P4W A;  3WTI A;  5BR8 T;  1XMQ T;  2MYS A;  2V8S V;  4YSY A;  3UQ4 A;  3CK6 A;  3TLS A;  3WAJ A;  3Q5W A;  3UU3 A;  4AI6 A;  3GN5 A;  2CM0 A;  2VUR A;  5LHG B;  4IRE A;  5LHI B;  4BAY B;  2VKJ A;  2UUC T;  4DR7 T;  3IBP A;  3ZLI A;  5ETW A;  4JI5 T;  4O4I E;  2MTQ A;  1OWA A;  3UU6 A;  3AE9 A;  3BK9 A;  3RYH E;  3PJA J;  2L3L A;  2LKH A;  2WZH A;  4EZ1 A;  2XAG B;  4TWD A;  5AFU L;  4CXY A;  4QXB B;  4HFC A;  2LRL A;  3PJA A;  2BKO A;  1FJG T;  4ZRU A;  2JQK A;  4LF6 T;  2KZ7 B;  5JR9 A;  3Q5D A;  4YJ3 E;  5JDQ A;  1IBK T;  3HKD E;  1BR1 A;  5JRC B;  2YKS A;  2V7M A;  5L2L A;  3C79 A;  3O1J A;  1HF8 A;  5AFL A;  5HCM A;  3I9Y A;  4EB6 E;  3LSV A;  4JI8 T;  5KMG P;  2Y54 A;  5L3G B;  4CI1 B;  5HEH A;  4UR9 A;  4YHH T;  2ZLY A;  3RIA A;  4MBQ A;  1I9B A;  4NXM T;  2KWH A;  4EZH A;  3RKO A;  1OXZ A;  3E08 A;  4IE4 A;  3MK7 C;  5KDM C;  1L0V A;  3EUH A;  4JLE A;  3WTH A;  5AQR B;  2F4V T;  3CML A;  3ZMT B;  4UV9 B;  1UK5 A;  5ABG A;  5CFB A;  4UVB B;  3N9Q A;  1FEW A;  3HI2 A;  2JMH A;  4QAB A;  3U8L A;  3F2E A;  1SUM B;  2WQY A;  1ZEE A;  4EXT A;  4A97 A;  5IUX A;  2Q9Q C;  5L4H A;  1WR0 A;  1XWM A;  2D0T A;  3UU8 A;  2BG9 B;  1IAP A;  1MMG A;  2LSJ A;  2X9W A;  1XNQ T;  4PFO A;  2WNL A;  3LDQ B;  3N2G E;  4QKN A;  1HNZ T;  3P7I A;  3ZMS B;  1S35 A;  2X0L B;  2W4X A;  3AED A;  4TUY E;  4D01 A;  1ZOY A;  1KK7 A;  5CA0 E;  2ES0 A;  5ABE A;  4DV4 T;  5FXX A;  5EK3 A;  4DUY T;  3RIU A;  5AQT B;  5AIN A;  3GA8 A;  4XBF B;  2ZM8 A;  3AA6 B;  3OKQ A;  3H37 A;  1HS7 A;  1AJ3 A;  1N36 T;  3RYC E;  5FL0 A;  2PGZ A;  1WYC A;  2FJE A;  3AA0 B;  3AEB A;  2XSB A;  1UUR A;  5AFJ A;  3HL6 A;  1VCT A;  2Y48 B;  5FP3 A;  1XDO A;  2UXX B;  3F31 A;  2SPC A;  4IT4 A;  2LSK A;  4HQP A;  1Y01 A;  3PV0 F;  2ZM6 T;  3ZN0 B;  3K3N A;  3FXD B;  2B1E A;  5LBQ B;  2C5J A;  5HXC A;  2V6Y A;  4L9I A;  4JUY A;  3C51 A;  5H6Q B;  4EYY R;  4QXH B;  3FZH B;  2WWU A;  2J62 A;  5C3J A;  4HEA A;  5J5G A;  4U33 A;  4X5T A;  5HWY A;  2XHE B;  4DND A;  4IL9 A;  5CB4 E;  4QH5 A;  2WNJ A;  3NRY A;  1HG5 A;  1N33 T;  1QUU A;  3NVO A;  3EDV A;  4CZZ B;  1SHZ C;  3SQ9 A;  1VRB A;  4TV8 E;  1MMN A;  1YKE B;  2X9X A;  1NWM X;  2X9H A;  4ISS A;  2VVS A;  3QB5 K;  3PUZ F;  1HNX T;  4KHP T;  3LBX B;  5KX5 E;  4TWF A;  2LSI A;  4ZI2 D;  2UXC T;  4I50 E;  3CQC B;  3WIP A;  4L0R A;  1UV6 A;  5AFM A;  4HWC A;  4EOZ B;  1WFD A;  3EVY A;  4G63 A;  2V7I A;  2BG9 C;  2NW7 A;  2KT9 A;  1LVK A;  4K0K T;  3UUN A;  3TKL B;  4IST A;  3L09 A;  3EHZ A;  2LE8 A;  4OHF A;  4CQI A;  1UX5 A;  4DV0 T;  4A56 A;  5DQW A;  2N1G A;  1FMV A;  4I43 B;  4EIW A;  5JDL A;  5HWX A;  2W62 A;  2VKO A;  2K5B B;  2ZJV A;  3AE6 A;  3L3P A;  4U7Y A;  4YSX A;  2WN9 A;  1T8B A;  1XZY A;  4OK0 A;  3Q9D A;  2H3R A;  2WP9 A;  4GOU A;  4CN1 A;  5ADX L;  4ILA A;  4X20 E;  3UUB A;  4NIQ A;  3C4Z A;  2N9D A;  4X64 T;  3PUG A;  5J5I A;  3MKD A;  2CRB A;  4H9O C;  5L4E A;  2BZB A;  4YT0 A;  4WYV A;  4QAC A;  3PUW F;  4YTN A;  4AQF C;  2UXD T;  4ERR A;  3NBX X;  3FHN A;  3RGL A;  2AE9 A;  5JTG A;  3D0T A;  2K3W A;  2VL8 A;  4ZEY A;  2CHN A;  4NXN T;  3Q2M A;  1IJ6 A;  3DJB A;  4I0U A;  2IML A;  2AXD S;  3RPU A;  3JAE A;  4O2A E;  2ZM0 A;  3S4U A;  4HGA A;  2DNX A;  1B7T A;  2XAJ B;  2GK9 A;  5AFK A;  4ILU A;  2VAS A;  2LM9 A;  2E9X D;  4ZK1 A;  3I9W A;  3U78 A;  1KNP A;  4E7S A;  1MIW A;  4JV5 T;  4U7I A;  3P50 A;  3N9N A;  3ESL A;  2EHO D;  4DID B;  1UX4 A;  2V5C A;  1D0X A;  1UCU A;  4ASK A;  2LEH A;  3I1A A;  2LHN A;  5FXW A;  3G06 A;  5AQJ B;  1MIV A;  4Z90 A;  4DBM A;  4X62 T;  2CA5 A;  2XPK A;  4DR1 T;  3WTL A;  1XNR T;  2W8G A;  1X79 A;  3PUA A;  2LKG A;  1CHU A;  4DMW A;  5AQG B;  5HEJ A;  3SQ6 A;  4DV7 T;  2DCF A;  4ZHQ E;  3QOF A;  2QGS A;  4UEL A;  2BBJ A;  1QSD A;  4EZ4 A;  1MMA A;  5TAO A;  3OYX A;  4HN9 A;  4X1K E;  3RI5 A;  1KEY A;  2BDE A;  2BG9 E;  2WMO A;  5JVD E;  5JH7 E;  5JDH A;  4TZ4 C;  2XSA A;  4IDP A;  3KVA A;  3R6N A;  4WBO A;  4C90 A;  1KFY A;  1KF6 A;  4JI6 T;  3ZCJ A;  2V7K A;  2YME A;  2BR8 A;  4CI3 B;  2VQE T;  3ZJ1 A;  2YOE A;  3ZT7 A;  3UFG A;  4BFQ A;  2W0G A;  5AQQ B;  2DWK A;  3V5U A;  3NKZ A;  3CKD A;  2RP4 A;  3EAB A;  3TLW A;  3C4W A;  3RC3 A;  3RHW A;  2WDQ A;  5LGN B;  1KNZ A;  4ZZB A;  3CVR A;  5HYA A;  2LSY A;  2Y8D A;  2ODU A;  4GYS A;  4O4L E;  4U74 A;  4B3M T;  3PUS A;  4B5D A;  4U72 A;  5EK4 A;  4ZOL E;  2CLY B;  4KUM B;  4PJN A;  1J1J A;  4BJN A;  2BVL A;  3EAM A;  2VKD A;  2LJL A;  2XAF B;  2CHO A;  2HN2 A;  2VVN A;  5TVC A;  3KDS E;  1G73 A;  5J5F A;  5AQN B;  4ZK4 A;  2EHO B;  5M4Y A;  4OX9 T;  4XHE A;  3JAF A;  2ACX A;  5CGM A;  3WI3 A;  2OV9 A;  2LRK A;  2MOZ A;  2X67 A;  4QXC B;  4H63 H;  4ZZC A;  4ZI2 C;  4X65 T;  3H3M A;  4O2B E;  1JNZ A;  2WMN A;  1IZN B;  4YJ2 E;  3P4S A;  3FB2 A;  5L47 A;  2E8I A;  2YMD A;  5HEG A;  4UM3 A;  5L3D B;  4WV9 A;  1YD8 G;  5AQH B;  5FVK A;  3QNU A;  4NUV A;  2J4G A;  3M65 A;  4UEM A;  2VQF T;  4IDN A;  1D1A A;  3ANW B;  2I6H A;  2W00 A;  3C64 A;  2DHR A;  3JAD A;  5EK2 A;  4JI1 T;  3BQL A;  3JC6 D;  1MND A;  4AIS A;  2KMF A;  4U31 A;  4H63 V;  4DV2 T;  2X68 A;  2PTF A;  2XTL A;  2LOS A;  4FJO A;  3LK3 B;  3LK4 2;  4PIR A;  2A2F X;  4E7Z A;  4LMJ A;  3LJC A;  2E5L T;  3AXJ B;  3ONJ A;  5AQM B;  4LF8 T;  3OBV E;  2BBH A;  3VRB A;  4U2Y A;  3PDY A;  2Q9Q A;  2QVA A;  1OED B;  1J5W A;  3AEC A;  1GQE A;  2KWI B;  3RYI E;  3SOL A;  2NP9 A;  2YDS A;  2K9A A;  3AE4 A;  4ANJ A;  2I0M A;  2D2S A;  5KE4 A;  2XZ6 A;  4UVA B;  5AQU B;  2W61 A;  2NW9 A;  1CUN A;  3AVR A;  4GYR A;  4PK4 A;  5JRE A;  2ODV A;  4EV6 A;  2UU9 T;  2J47 A;  5LGT B;  4EYU A;  1H7C A;  4AKG A;  4AIU A;  3HA4 A;  2E9X C;  5HEU A;  1MIY A;  2X00 D;  3T1H T;  2A72 A;  4ILB A;  4LF7 T;  4QH4 A;  2Y57 A;  4ZI3 D;  3TLV A;  1V9D A;  2EHO C;  2X51 A;  1I94 T;  4P0B A;  4FI5 A;  2V6Y B;  4YXD A;  4UM1 A;  4M1P A;  3A8Y C;  2LOP A;  3FZK B;  2BKN A;  2P9B A;  5JRC A;  3ZKR A;  3JCF A;  4G2A A;  1NEN A;  5AQI B;  2W66 A;  3RX6 A;  3B5M A;  3ZMU B;  4F8H A;  2BJ0 A;  2N2N A;  3C98 B;  4ZI7 E;  5FXZ A;  3W15 B;  4CN6 A;  2YU2 A;  4JI7 T;  2WS3 A;  3C50 A;  1ZV4 X;  3ZYK A;  2IUB A;  4O8S A;  2ZM2 A;  3OTO T;  4IE5 A;  4O4J E;  1XDP A;  1HNW T;  4O4H E;  4IDZ A;  2DWG A;  3RC8 A;  3PE0 A;  1J5E T;  3DTO A;  2IIU A;  2H7O A;  4QHO A;  3PUX F;  5FXV A;  3UQ7 A;  5JDN A;  1WRD A;  3HKE E;  3ZC1 A;  2MAW A;  3ZST A;  5GON E;  4HWH A;  2XYT A;  2RPA A;  5L3B B;  4PJJ A;  2KLQ A;  2XZ5 A;  2NTX A;  1VCS A;  4ZJS A;  1LVF A;  3AE5 A;  5IHY A;  4UF0 A;  1OED C;  4AQY T;  4GK0 E;  3EDU A;  1YKH B;  3AB3 B;  2BG9 A;  3KV6 A;  4C91 A;  5F5W A;  2XNU A;  2WNC A;  4IE6 A;  2V7J A;  3PUV F;  4V1A v;  4TNW A;  4JI0 T;  1N34 T;  5E0O A;  2XM2 A;  2OA5 A;  4IIJ E;  3U8N A;  3ETV A;  4LF9 T;  3J7Y q;  3ZYM A;  4IDO A;  4HKA A;  3HKC E;  4OYK A;  4TN7 B;  3ZC0 A;  2YN6 A;  5JQG E;  2M6I A;  1JNR A;  4JI4 T;  3HKB E;  2CWO A;  3U8J A;  1ZHC A;  4DR2 T;  5AFN A;  2V26 A;  2M6B A;  5L3E B;  5CJ5 A;  5L3F B;  2L9Q A;  5LJN A;  3VKH A;  3KIN B;  4UY2 A;  2UXN B;  3N2O A;  3FZF B;  5LOV E;  3AAA B;  4P1N A;  4AQF A;  3A5X A;  2XM1 A;  4PK5 A;  4MFR A;  5J2T E;  3F57 A;  1N32 T;  4YY3 T;  4OFZ A;  3CPZ A;  2XAQ B;  4H9S E;  3K8P C;  4DR3 T;  5BP0 A;  2I59 A;  2NR4 A;  4JBW F;  2D9D A;  4A98 A;  2BVM A;  4QAA A;  5BMV E;  2E5V A;  5HXS A;  2QYW A;  1W0B A;  3ZMZ B;  4H9P C;  4YFS A;  5F8P A;  4ALX A;  5HXH A;  1EZ3 A;  4WZX A;  3N2K E;  2NTY A;  3SFE A;  4LF4 T;  1SE7 A;  4TV9 E;  3RRC A;  3N9O A;  2JRK A;  3JC6 C;  3LG7 A;  1WYB A;  1M7K A;  4QX7 B;  2K24 A;  4KMC A;  2CXF A;  4AXP A;  4NPP A;  2BKP A;  3ZSS A;  1YQ3 A;  4XAX B;  3P4R A;  5ABF B;  2UZ6 A;  2XQY A;  4H9Q C;  3GMI A;  5CO5 A;  2W2U A;  3AE7 A;  4H9R C;  4PNI A;  3AA1 B;  3Q5E A;  3VR9 A;  2LT3 A;  1WCR A;  3O1I A;  5F3J A;  4UV8 B;  2VK9 A;  2JQQ A;  4HFV A;  5FMN A;  1HG2 A;  4YTM A;  5J5H A;  1MNE A;  3RLF F;  4TWH A;  3NZP A;  2YDR A;  4YTP A;  5LGU B;  3GUA A;  5H6R B;  2XAH B;  3IGQ A;  2NOX A;  4HFB A;  1OED E;  2FJA A;  3VR8 A;  2K48 A;  1WR6 A;  4KBM B;  3EI0 A;  2YEV C;  1E1H B;  4ZS2 A;  4IHJ E;  4H9N C;  1S94 A;  3LFM A;  4DBR A;  1HTJ F;  3KVB A;  5LHH B;  3ONX A;  5DAB A;  4IE7 A;  3A7M A;  4P09 A;  4CI2 B;  4ZI3 C;  3VKG A;  4HFI A;  3T8O A;  4ZJT A;  4B3S T;  4ILC A;  2BYQ A;  2YK0 A;  5AQK B;  2JQ9 A;  4HWI B;  1Z0P A;  4DR4 T;  2WU2 A;  3AAE B;  4CXW A;  1DU2 A;  3CQX C;  5FL1 A;  3UU5 A;  5LXT E;  2BYS A;  4UVC B;  3PUQ A;  3ZCI A;  4IE0 A;  1UW6 A;  3AE1 A;  2VKH A;  4DV3 T;  2CXL A;  2UUB T;  4UXN B;  1BR2 A;  5AQV B;  2QA7 A;  3QUJ A;  3QC9 A;  2WCA A;  3RH3 A;  5KZU A;  3ZT5 A;  2IHR 1;  2WU5 A;  1G8X A;  2Y6X A;  3AVS A;  4TNV A;  2CWY A;  4I55 E;  4K0U A;  2ZMA A;  3BQK A;  1UGO A;  2MBG A;  3QB5 A;  1HCI A;  3GN5 B;  5AQL B;  3ZPO A;  4HFE A;  5LA6 E;  2IDO B;  4LF5 T;  4HE8 A;  3IF8 B;  4L5G A;  4GKK T;  5LXB A;  4IGU A;  4AKR B;  2C5K T;  5JR9 B;  2XNT A;  1LRZ A;  2JIW A;  3ZJ2 A;  3VU7 H;  4AKL A;  4LML A;  2FJD A;  5C8Y E;  5J2U E;  2FJB A;  1ZKE A;  4GKJ T;  2LHR A;  1NAF A;  3AE3 A;  3OVU A;  1Y64 B;  3PTR B;  4B3T T;  4U3C A;  5ABH A;  4CXX A;  2Y58 A;  1LKX A;  2JMK A;  3O9X A;  3PU3 A;  2PH9 A;  2BS2 A;  2V5D A;  4PJM A;  3AEF A;  5J0Z A;  3NRX A;  2V7L A;  5SYO A;  1WLX A;  4PW8 A;  1D1C A;  5DQV A;  2XQ8 A;  2UXB T;  5FYM A;  3OPC A;  2JPF A;  3IEE A;  3KV4 A;  3C84 A;  3WTJ A;  3ABV A;  2D0U A;  3CQG B;  3RQU A;  4WBN E;  2CEA A;  3KV5 A;  3P4Q A;  3RQW A;  4Z8X A;  3AE2 A;  2E9X A;  2Y56 A;  1T7S A;  3FZM B;  4JEH B;  4X1Y E;  4TX5 A;  2XQ9 A;  3FBL A;  4PJL A;  2HHH T;  2PBI A;  3WTN A;  2DL1 A;  2EHO A;  2HN1 A;  4MAL A;  1QLB A;  4GIW A;  3NWI A;  4X1I E;  4UIG A;  1IJ5 A;  2E2A A;  4NUU A;  1I6Z A;  1U4Q A;  4DV5 T;  5FJV A;  3U8M A;  2XUE A;  4JEU B;  3PUY F;  4LMK A;  5AQO B;  3M3Z B;  3TLU A;  3RF1 A;  3CX6 B;  4DR5 T;  2IC9 A;  4JYA T;  4A5X A;  5LP6 E;  2CLY C;  4AQG A;  2NWB A;  4BJM A;  3ANW A;  1W0A A;  4F6R C;  5JR9 C;  4XZC A;  3PMZ A;  5J1G A;  2IW5 B;  5FY0 A;  2BS3 A;  4ZXL A;  1NEK A;  3SWH A;  1XMO T;  3Q5X A;  2A9U A;  2YU1 A;  2WM9 A;  4ZR6 A;  4HWF A;  4UF0 B;  4JI3 T;  4P0A A;  1X9B A;  4YLH A;  3ONL C;  3AXJ A;  3C4X A;  3UUM A;  2HH7 A;  3FBZ A;  5JDM A;  3DP7 A;  1OED A;  4MLK A;  3E0Z A;  4BA9 A;  3ETU A;  4KX6 A;  2XYS A;  3KV9 A;  4KP3 C;  4DV6 T;  2IC6 A;  1E2A A;  4BQT A;  5LNK A;  3SIO A;  3AA7 B;  2VL0 A;  2JJ9 A;  2CXD A;  4UM3 S;  3L39 A;  2R6G F;  3RIF A;  1UUS A;  4B6X A;  2WZY A;  1D0Y A;  3FZL B;  3X1D A;  1ZP0 A;  5AFM B;  5FY1 A;  3I0O A;  1HX1 B;  4CN4 A;  2M67 A;  3ZEF B;  5LMU T;  3CX8 B;  3VRA A;  2DI4 A;  5LCY A;  3AEG A; 
#chains in the Genus database with same CATH homology
 2UZ6 A;  3JAD A;  2BG9 C;  4QH1 A;  5J0Z A;  5HCM A;  2PGZ A;  3ZKR A;  2XQ4 A;  3LSV A;  3P50 A;  5CO5 A;  3T4M A;  5SYO A;  2YN6 A;  2M6I A;  2Y54 A;  4FRR A;  1UX2 A;  5AFJ A;  5HEH A;  3TLW A;  3PMZ A;  4AFT A;  5JME A;  4F8H A;  2ZJU A;  3U8J A;  2BJ0 A;  5KZU A;  3EHZ A;  3RHW A;  4XK9 A;  5AFN A;  2BR7 A;  2XQ3 A;  4BFQ A;  4UM3 P;  4ZZB A;  2M6B A;  4TNV A;  4PIR A;  5BRX A;  4HQP A;  2XQ8 A;  3RIA A;  1I9B A;  4Z90 A;  4LMJ A;  4DBM A;  3ZDH A;  2W8F A;  5J5H A;  4ZR6 A;  3WTL A;  3UU4 A;  4TWH A;  4UY2 A;  4B5D A;  2ZJV A;  2LM2 A;  2WN9 A;  3U8K A;  4COF A;  2W8G A;  2Y7Y A;  5HCJ A;  1OED B;  2LKG A;  2X00 A;  3GUA A;  4UXU A;  3EAM A;  3PEO A;  3WTH A;  3IGQ A;  5HEJ A;  3C84 A;  4HFB A;  3WTJ A;  4EZ1 A;  4ILA A;  3SQ6 A;  2XQ5 A;  1OED E;  3P4W A;  5J5G A;  5CFB A;  3UUB A;  3WTI A;  4HFE A;  5TVC A;  1OED A;  3RQU A;  5J5I A;  4X5T A;  3EI0 A;  3UQ7 A;  5J5F A;  3RQW A;  4QAB A;  2LLY A;  4IL4 A;  3UQ4 A;  3TLS A;  2MAW A;  3U8L A;  4IL9 A;  5AFH A;  3UU3 A;  5L4E A;  5BP0 A;  4QH5 A;  2XYS A;  2Y56 A;  2XNV A;  4QAC A;  4AFG A;  4ZK4 A;  4A98 A;  5KE4 A;  5LG3 A;  4HFH A;  4XHE A;  4IRE A;  3JAF A;  2WNJ A;  4A97 A;  3TLT A;  2QC1 B;  2XYT A;  2XZ6 A;  4QAA A;  5IUX A;  3SIO A;  4BQT A;  2XQ9 A;  5L4H A;  3UU8 A;  4NZB A;  2C9T A;  2VL0 A;  2XZ5 A;  4ZZC A;  2BG9 B;  4ZJS A;  4UM3 S;  3WTN A;  3RI5 A;  3WTK A;  2BYP A;  3UU6 A;  5LXB A;  3RIF A;  4AFH A;  3SQ9 A;  1OED C;  2WNL A;  2XNT A;  4ALX A;  4HFI A;  4ZJT A;  2BG9 E;  2WZY A;  2LKH A;  5L47 A;  2YMD A;  4ILC A;  5HEG A;  2BYQ A;  4TWD A;  2BYR A;  3WTM A;  2XQA A;  2BG9 A;  4LML A;  4UM3 A;  5HEU A;  4HFC A;  4WV9 A;  5AFM B;  2X00 D;  4ZRU A;  2BYN A;  2XNU A;  5FJV A;  5HEO A;  4D01 A;  3U8M A;  2WNC A;  4TWF A;  4ILB A;  3JAE A;  2KSR A;  4LMK A;  3WIP A;  4QH4 A;  2Y57 A;  2YME A;  3TLU A;  1UV6 A;  4TNW A;  2BR8 A;  4Z91 A;  3UU5 A;  3TLV A;  2BYS A;  2YKS A;  2Y58 A;  5BW2 A;  5AFM A;  2XQ6 A;  5AFK A;  3C79 A;  3U8N A;  3WTO A;  2PH9 A;  5AFL A;  5AIN A;  4NPP A;  1UW6 A;  4HFD A;  3SH1 A;  4ZK1 A;  2YOE A;  3ZDG A;  2XQ7 A;  4UM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...