3UU4A

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in the crystal in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu4A01
4ZK1A 3SQ9A 2MAWA 5CFBA 4LMJA 3WIPA 4ZZCA 5AFJA 1OEDC 2BR8A 3WTLA 5LXBA 2Y57A 3PEOA 2BYQA 2M6IA 3EAMA 2WZYA 4TWHA 4ZK4A 4QABA 5FJVA 3WTKA 2KSRA 2XNTA 2YKSA 4PIRA 2ZJVA 3PMZA 5HEUA 2PGZA 3UU3A 4AFTA 4NPPA 2C9TA 2WNJA 2X00D 2XQ4A 2BYRA 3C84A 5J5IA 2YMEA 4ZR6A 3UQ7A 3TLTA 4TNWA 4ZJTA 2XQ9A 4UM1A 5CO5A 2BG9E 5BW2A 3JAFA 4ILAA 2YMDA 3U8JA 3RIFA 5KE4A 4ZZBA 5AINA 3TLSA 1OEDE 5HCJA 3C79A 5AFMA 2BG9C 3UUBA 5BRXA 2LLYA 4A97A 3WTMA 5TVCA 3T4MA 4F8HA 2BYNA 3UU5A 2XYSA 4ALXA 5AFLA 2W8FA 3SIOA 3U8MA 3UU8A 2XQ7A 2BG9B 4HFDA 1I9BA 4TWFA 4UM3S 4XK9A 2LKGA 3JADA 4HFCA 2WN9A 4ZJSA 2XZ5A 5J5HA 4QH4A 2XQ5A 1OEDB 4QH1A 3U8LA 3LSVA 4IL9A 3WTNA 5J5GA 2Y58A 1UW6A 3WTJA 4AFHA 5L4EA 3RI5A 2PH9A 2BR7A 3EHZA 3UQ4A 3ZKRA 3TLVA 5HEJA 2WNLA 4HFHA 3WTIA 4ZRUA 4AFGA 4TWDA 2BYSA 2M6BA 5JMEA 4HFEA 3GUAA 4NZBA 4LMLA 4TNVA 2XNVA 2YOEA 2BG9A 4DBMA 3UU6A 3U8KA 3RQWA 4X5TA 5HEGA 2XQ8A 2XQ3A 2Y54A 2XZ6A 3SQ6A 1OEDA 4HFIA 5HCMA 3EI0A 2BJ0A 5KZUA 4HFBA 3TLWA 4XHEA 4LMKA 2W8GA 2X00A 4ILCA 3JAEA 4Z90A 3WTOA 3TLUA 2WNCA 4QH5A 4A98A 4UM3A 2QC1B 5J0ZA 3P4WA 4BQTA 4QACA 4IL4A 4Z91A 5AFHA 3UU4A 2Y56A 2XQ6A 2YN6A 4UM3P 2LKHA 5L47A 4QAAA 3RQUA 3WTHA 5BP0A 4EZ1A 4ILBA 3RIAA 5HEHA 2BYPA 2Y7YA 5L4HA 4BFQA 3U8NA 2VL0A 4IREA 4FRRA 3ZDGA 5IUXA 2LM2A 5HEOA 5AFNA 1UX2A 3RHWA 2XNUA 2XYTA 4COFA 2ZJUA 3P50A 1UV6A 2XQAA 5LG3A 5SYOA 4B5DA 4D01A 5J5FA 4UY2A 4UXUA 2UZ6A 3IGQA 4HQPA 3ZDHA 5AFMB 3SH1A 5AFKA 4WV9A
chains in the Genus database with same CATH superfamily
2ZM6T 2X67A 2X68A 5FJVA 1MMAA 4PIRA 2YDQA 3U3IA 4NXNT 2BBHA 3CK6A 3ZMTB 2J1DG 1W0BA 3PUAA 4EXTA 3KVAA 3B5MA 3P7IA 2VB6A 3WAKA 2MBGA 2NR4A 3PUZF 2QGSA 3EDUA 4OK0A 2WWVA 3WI3A 5LMUT 2BKNA 3AEFA 1CHUA 4WYVA 5J2TE 4HFCA 3C51A 1NENA 2HH7A 1OWAA 4AQFC 4JEHB 3PU8A 3EHZA 5LXTE 3Q5XA 1IBLT 4AKIA 4ZI7E 4ERRA 4OYKA 4MALA 2ES0A 1XDOA 1OEDA 5KZUA 2OLTA 4XHEA 3AB3B 4LMKA 2W8GA 4ZXLA 3WTOA 3JAEA 3LDQB 4ZI3D 1IBMT 2PFVA 2L9QA 5LBMA 4DV4T 3ONXA 4KX6A 5L3CB 4IREA 2D9DA 3K3NA 3S4UA 2NP9A 4EV6A 1UX2A 2XJ7A 5E0OA 3JC6D 5AQOB 3AEEA 5JR9A 2UZ6A 3IGQA 1FIOA 3SQ9A 4ZZCA 1HR0T 2LEHA 5JREA 4Z8XA 1M7KA 4IIJE 4PAGA 2VK9A 4BAYB 2ZJVA 3IHRA 2CLYC 4FI5A 1LVFA 4IDOA 3RLFF 1I94T 5BW2A 4AKLA 4JEUB 2DCFA 3PUWF 4A97A 3LK2B 5EZYE 4UM3S 2ZM8A 3ZN0B 2X66A 3KV5A 4QH1A 1MMGA 1SA0E 1UW6A 4ISSA 5L4EA 3N9OA 1MMDA 3ZKRA 4TV9E 3ZYLA 1WYCA 3FXDB 4HFHA 4P1NA 4U72A 4UVCB 2XNVA 2YOEA 2BVLA 5AQPB 3R6NA 5HAXA 3AXJA 3AA6B 5JVDE 1FJGT 5KDMC 3RC3A 2LSGA 2V5DA 5L2LA 4OHFA 2NWBA 4BJMA 4DV0T 3C4ZA 4YXDA 2UXDT 3MK7C 4BQTA 2Y56A 2CXFA 2JIWA 5BP0A 3RRCA 3RQUA 3U78A 5LGUB 4H63V 2LM2A 4P0AA 4DR5T 3ETVA 2XAGB 4CXXA 2FJBA 4YSZA 2UUAT 5L3FB 2ZJUA 1ZP0A 2CWOA 3CQCB 3ZN1B 4O2BE 5HWYA 2DHRA 3RIUC 3SH1A 5CA1E 3MXZA 4DR3T 5AQSB 3WTKA 2BDEA 2W66A 5JDQA 1NWMX 2LHRA 3UTKA 4DR6T 3UU3A 3QK6A 2C9TA 4I55E 3MACA 3T1YT 4M1PA 4X1KE 4ZZBA 2V7MA 5BRXA 2UU9T 2BYNA 3UU5A 3I9WA 4J2CA 3SIOA 1UX5A 3ZMVB 3PUVF 3V5UA 3P4PA 4XK9A 2XZ5A 4DR7T 3LK42 5J5GA 4XZCA 2D2SA 4X1IE 3HKCE 2WDVA 2E5VA 2G0UA 3AE3A 3VR8A 3GUAA 2E9XB 3F31A 2CXDA 2UXXB 4U33A 3OVUA 3ZCIA 2V8SV 5AQMB 4JBWF 5LYJE 3DJBA 1UX4A 2XM2A 3AEDA 2XAHB 2X00A 2L8KA 3K3QC 2V6YA 2CPTA 5HWXA 1N36T 1XNRT 5L47A 2YEVC 2JMKA 4JI1T 1T8BA 2XY8B 5KXJA 4JI6T 4KHPT 2WQYA 1KK7A 3QB5A 5LNKA 2QYWA 4PW8A 3PJAJ 1MIVA 3CVRA 4B5DA 1HFAA 5LP6E 2LSJA 3AE4A 4DO0A 1JNRA 5FY7A 2Y57A 4QHOA 4TWHA 3UUMA 3BQIA 2UXCT 4CN4A 4WW0A 3ZSTA 4CZZB 4UF0B 3B13A 3VU7H 3C84A 2ZM2A 4ZJTA 2H3RA 4ILAA 4KMCA 2OA5A 2YMDA 3PUQA 1EZ3A 2BG9C 4DNDA 2VKJA 5JRCA 5AQFB 5AFLA 2KZ7B 2A2FX 4TUYE 5KX5E 2R6GF 3U8LA 2WDRA 2W62A 4UIGA 4AFHA 4XAXB 4DBQA 1VCSA 2YU2A 3HKDE 4HWDA 3ESLA 3FZLB 3ZC1A 3PU3A 2ACZA 4JI4T 2FJDA 1MNDA 1VCTA 2FJAA 2JQHA 3HKBE 3ZT5A 3RKGA 4DUZT 4ZI3C 2V26A 2BS3A 4L5GA 1XMOT 2NOXA 5LGNB 2CHNA 4IL4A 3SOLA 4YFSA 1ZHCA 2VVNA 4I43B 4E7SA 4LF7T 5J1GA 4GIWA 3JC6C 2IDOB 2J4GA 4TV8E 3AEGA 4COFA 5C8YE 3RX6A 2EHOB 3FBLA 4O4IE 4UXUA 3NWIA 4X1YE 1KF6A 2XM1A 3OYZA 5FP3A 3WTLA 1UURA 4CN6A 2KSRA 3L3PA 3Q9DA 2L3LA 2Q9QD 5FXZA 1N33T 2SPCA 4JYAT 3RYCE 2WBLA 3U8JA 3KFWX 2LOSA 5AFMA 2LLYA 3SFEA 3FBZA 3RIUA 3U8MA 2XHEB 2XQ7A 3NZQA 2W4XA 5DABA 4KBMB 5LMNT 2LSIA 3KVBA 2KWHA 3ZPOA 5H6RB 4C91A 4I0UA 2WNLA 2X51A 4P09A 4QX7B 4AFGA 3UUNA 3GN5B 4DIDB 2YDSA 2K3WA 4CN1A 4DV6T 1FEWA 3PE0A 1NAFA 4UEMA 2CHOA 5C3JA 4H9OC 5L3BB 5FXVA 2WZIA 4PJNA 4EZHA 4HFVA 4EZ1A 4ANJA 3X1DA 4EAHA 1O3XA 4DV3T 1MIYA 1KEYA 5LJNA 2YINA 2LJLA 4UXNB 1XMQT 2LRLA 4I50E 2WB5A 1WFDA 3ZMUB 2GK9A 5AFKA 2VWAA 3ONJA 4ZK1A 5TAOA 3TKLB 2DLRA 2I59A 1N32T 2WY2A 4ZOLE 5AQNB 1UCUA 2MPKA 5CO5A 4JI3T 2MTQA 4H9SE 4MBQA 2CEAA 3KV9A 3C50A 1HG5A 3L39A 1T72A 3GA8A 4QKNA 5IWAT 4ZHQE 2Q9QB 3RI5A 3EDVA 5CJ5A 2PH9A 4P0BA 1WR0A 2WAUA 2ODUA 1BR4A 4NZBA 4L0RA 2C5KT 3AEBA 2BG9A 2EHOC 4IE7A 3UU6A 3RQWA 1VOMA 3M3ZB 5HEGA 1HX8A 2WM9A 2XAJB 4HFBA 3TLWA 5LHHB 1X9BA 2WNCA 2VURA 4UM3A 5FVKA 4ADZA 4Z91A 3C4WA 2YN6A 4GKJT 2LKHA 2WU5A 3RIAA 2UXNB 4BFQA 2ZMAA 2MOZA 4PNIA 5DQWA 4CQIA 1QLBA 3HI2A 3N9PA 2Z6EA 3KV4A 3NBXX 1HNZT 4DR4T 4DR1T 2HHHT 3O1HA 4BA9A 4QX8B 5AQIB 1FMVA 5FL1A 2N1GA 2IIUA 3FZHB 2XQ9A 3H37A 1U4QA 4MHCA 1J1JA 4A5XA 5LA6E 3F2EA 4B3RT 2C5IT 4ZJSA 4JLEA 4K0UA 2K9AA 1IJ5A 4XBFB 1Y01A 3IBPA 2XAQB 1UUSA 2IC6A 1HX1B 2X0HA 2W0GA 5DQVA 2E9XD 3ZT6A 5L3GB 3VKGA 3O1IA 3QUJA 2CA5A 2ZM0A 1KFYA 4X5TA 3LJCA 2XQ3A 3ZMZB 2Y54A 2BKPA 4OYJA 2E2AA 1WYBA 2DNXA 4Z90A 4O2AE 3ZCJA 4LF5T 3UFEA 2XQ6A 2QVAA 5HXSA 4ILUA 2Y8DA 1LRZA 1GQEA 2WWUA 3HA4A 3ZDGA 4H63H 3OTOT 2LE8A 5CGMA 2WMOA 4HQPA 4IE0A 1UK5A 3T1HT 1IAPA 5AFJA 2BR8A 3RPUA 2M6IA 2Q9QC 3FB2A 3LBXA 4EYUA 4UELA 2BYRA 5JDHA 2VASA 3C4XA 1HTJF 5H6QB 3E0ZA 5AQQB 4GK5E 4GYSA 5AINA 2V6XA 2QA7A 1D1AA 4U31A 1LVKA 4U2ZA 2I0MA 2E5LT 3F57A 3AE7A 3AECA 4YY3T 4GOUA 1D1BA 1OEDB 3L8RA 3B57A 3WTJA 3A7MA 4ZS2A 3I1AA 4JI2T 3ANWA 2X9XA 3HL6A 2X0LB 2XASB 4IE5A 2C0SA 4TNVA 1WLXA 2Y48B 2XQ8A 4IE4A 5FXWA 4HFIA 3EABA 1HNXT 3AE6A 5JDFA 3QB5K 4KHZF 3UULA 1G73A 4YJ2E 4YHJA 4FRRA 4PK4A 2LSYA 3FZMB 2EHOD 3I9YA 4NUUA 1UV6A 1Z8UA 4KP3C 3CWZB 3Q5EA 4ZI2D 4DMWA 4WV9A 2ZLYA 4HE8A 3ZT7A 3AA7B 4AQFA 2AXDS 3PJAA 4EB6E 4EEBA 5LOVE 4V1Av 2X00D 3W15B 2K48A 1AJ3A 2LT3A 3JAFA 1XNQT 2D0UA 1OEDE 5FY1A 2CE7A 1YD8G 2X9HA 3UUBA 3PUXF 3QC9A 5BMVE 5TVCA 4F8HA 4NXMT 2XQYA 2XYSA 3I0QA 4ALXA 1HNWT 3UU8A 4DVDA 4EYYR 2WSSV 3AXJB 3VHLA 2XQ5A 5ETWA 2D5UA 3AE5A 3TLVA 5HEJA 3H3MA 2P9BA 2W2UA 4DBRA 3N9NA 2V5CA 2V7JA 2B76A 3ZYKA 3KINB 2XZ6A 2KXPB 4O4JE 5JTGA 1XZYA 3J7Yq 3P4SA 2W61A 4QH5A 3CX7B 2HPJA 2A3DA 3PV0F 2BS2A 4GKKT 3UUXB 1Z0PA 5EK3A 2Y7YA 5HEHA 5AQUB 4HGAA 5AQJB 3ZMSB 5CA0E 5IUXA 1FMWA 5AFNA 5M4YA 3O4XE 4HTEA 2XQAA 4LFAT 3V5SA 5FVLA 3AAAB 4AISA 4ZS3A 4OX9T 3ZDHA 2VL8A 1KNZA 5HXRA 2MAWA 4LMJA 3WIPA 1JNZA 4YTPA 3ABVA 1OEDC 5C2TA 3VR9A 4QABA 2JQ9A 3PMZA 5HEUA 2XAFB 1YQ3A 4JV5T 2DWGA 3A8YC 4EIWA 3QNUA 4X65T 4TNWA 4UM1A 1D1CA 5FL0A 1YXRA 3P8CD 3RIFA 3C79A 1ZOYA 5ABFA 4IHJE 3T4MA 2UXBT 1ZEEA 1BR0A 4IGUA 2WN9A 2NTYA 3CX8B 2H89A 3N2GE 4IL9A 3WTNA 3Q5WA 5F8PA 5BR8T 2V6YB 2E9XC 1WCRA 1HCIA 4PFOA 2VQFT 3GMIA 2M6BA 3RGLA 5FYMA 3GWHA 2KINB 3AE8A 3SQ6A 3PUYF 1IJ6A 2UUCT 4YSYA 2PJQA 4ILCA 1W09A 1YQ4A 4TN7B 2QC1B 5AFHA 4L9IA 4UM3P 3AA1B 2KNDA 4ASKA 2JQQA 2K24A 4QAAA 4LF9T 3U8NA 4U7YA 4CI2B 3LG7A 4U74A 4KUMB 1KNRA 5JDLA 3LFMA 3KDSE 2H7OA 3ZJ1A 5J5FA 4YSXA 3N5LA 4DMVA 4QXBB 5JRCB 3WAJA 1US7B 5LXBA 1ZV4X 4CXWA 3PEOA 2BYQA 4WZXA 2JQKA 4HKAA 3RH3A 4PJMA 5AQTB 4DV2T 2WNJA 2YMEA 4ZR6A 2M67A 3CQGB 1BR1A 5FY0A 5FNVE 4CXYA 5LG4A 5HXEA 5KE4A 2RPAA 3H3AA 2Y6XA 2D0TA 5F5WA 3JCFA 3MKDA 2YK0A 3AE2A 4HFDA 3RYIE 3RYHE 3E08A 4B6XA 5AQVB 2BR7A 2BKOA 1YKEB 3NVOA 3PDYA 4HWFA 4TWDA 1DU2A 2XZEA 2XPKA 4DBMA 4MLKA 4AKRB 1SE7A 5HCMA 3OYXA 3VRBA 1SUMB 1UGOA 3LK3B 3TLUA 2V7IA 2XSAA 1QUUA 2CWYA 1XDPA 5AQGB 4QACA 3UU4A 4CI1B 2CRBA 5HXHA 2BYPA 4LFCT 2LM9A 2VL0A 3J9X1 3BQKA 2WMNA 5FKYA 3RHWA 1V9DA 4IDQA 2FJEA 3CQXC 1X79A 4ZI2C 1MNEA 2XUEA 3Q2MA 5AFMB 4AI6A 5CFBA 2KT9A 3AEAA 2X9YA 4NUVA 4H9QC 2WP9A 3A5XA 2KLQA 3ZLIA 4QXHB 4PJJA 4Q25A 3RKOA 3P4RA 5LGTB 1G8XA 3TLTA 4NIQA 5LJMA 2LOPA 2LRKA 3WTMA 2H88A 2W8FA 4FJOA 3EVYA 2LKGA 3JADA 2DI4A 4H9RC 4PJLA 2CBIA 4QH4A 3NRYA 2Y58A 1LKXA 3HR0A 4F6RC 5AQKB 3KBUA 3AVSA 3BQLA 3DTOA 4UV9B 2JMHA 3RF1A 1W0AA 1BR2A 3N2KE 2BYSA 4U2YA 1D0ZA 1I6ZA 1D0YA 3Q5DA 2J47A 4JI5T 5ABGA 4CI3B 2IMLA 3P4QA 2JRKA 3OPCA 3FZFB 3MJXA 2WZHA 2IAKA 3N9LA 1KNPA 3NZPA 3I0OA 4ZEYA 4LFBT 4ILBA 4YTMA 2E9XA 4N78D 5JQGE 4I4TE 3N9QA 4UR9A 4YHHT 5IHYA 5LG3A 1MIWA 2A9UA 4MFRA 4DV5T 4LF8T 2PG8A 5EK4A 5LCYA 1H7CA 3PUSA 4EEDA 4ZK4A 3RYFE 4OFZA 4EOZB 4G2AA 3SS1A 3VRAA 4ISTA 5J5IA 2XQ4A 1VRBA 4G63A 2E8IA 2A72A 4TZ4C 2VKDA 4UVAB 3IF8B 3RC8A 2BG9B 5L3DB 1SHZC 4HN9A 5CB4E 2VKOA 1S94A 2WU2A 3CIRA 4JUYA 4UF0A 4IDNA 5HYAA 2XSBA 5LHIB 4EZ4A 4YTNA 2W00A 4X66T 3WTIA 5AQLB 2N9DA 3UT5E 3FZKB 4IDZA 3U8KA 2PTFA 2IHR1 3ZC0A 2F4VT 2NW7A 4A98A 2X0YA 3EUHA 2X9WA 3CX6B 3OKQA 1R8IA 3FHNA 2BBJA 2NW9A 3G06A 5JDMA 4DR2T 4O4LE 5LBQB 1CUNA 5A1LA 5HEOA 1E1HB 1HF8A 4JI7T 5FMNA 4YT0A 3C98B 2FBWA 2XTLA 4AKGA 5JR9B 1WR6A 1T7SA 3C64A 4IT4A 2V7KA 3AVRA 2KWIB 2ODVA 5J2UE 1U5PA 3EAMA 4C90A 2WZYA 5KMGP 2XNTA 2YKSA 3IA3A 4NPPA 1IBKT 4PFPA 2J62A 4AXPA 2EHOA 4JI8T 2BG9E 4H9PC 5JDGA 4IE6A 3KBTA 3KV6A 3TLSA 3PUGA 5HCJA 4LF6T 5GONE 2MYSA 3PTRB 2NW8A 2CBJA 5F3JA 1YKHB 3K1SA 2VKHA 3N9MA 4HWIB 4X62T 3OJAA 2BVMA 4K0KT 3UQ4A 3CMLA 2PBIA 3PURA 4KI0F 4YLHA 4B3ST 2DL1A 2BS4A 3AAEB 3N2OA 5JMEA 4HFEA 3BK9A 2VQET 2CXLA 5LHGB 2QRXA 3ONLC 2JPFA 3DP7A 5AQRB 4WNKA 2JJ9A 2LSKA 4WBOA 2BJ0A 3QOFA 4UV8B 3HKEE 4B3TT 4B3MT 3O1JA 1B7TA 4UVBB 4TX5A 3GN5A 3VKHA 3LBXB 5EK2A 4GYRA 2XYTA 4PK6A 3ZEFB 3O9XA 4D01A 4UY2A 2IW5B 1M62A 5ABEA 4AKHA 2W67A 1ZKEA 4U3CA 4QWNB 5LB7B 4WBNE 1YW0A 1QSDA 4X20E 2WCAA 2PGZA 3ZJ2A 4IDPA 1MMNA 1E7PA 3UQ7A 2YU1A 1S35A 1Y64B 2N2NA 2RA1A 3NKZA 3ANWB 4DUYT 2DWKA 4GK0E 3AE9A 5DJQC 5FXXA 3ETUA 1N34T 1D0XA 1WRDA 3ZYMA 2IC9A 5J5HA 1NEKA 3CKDA 4O4HE 2BZBA 1W9RA 2HPLA 3MZKB 3L09A 3AAIA 3AA0B 2CMRA 4HWCA 5HXCA 4YJ3E 4U7IA 1E2AA 1J5WA 3D0TA 4LF4T 2NTXA 5JR9C 4HEAA 2FUPA 3EI0A 5AQHB 2Q9QA 3MA9A 3P4WA 3R84B 1HG2A 3SRZA 2I6HA 2W63A 4EGWA 4DV1T 4AQYT 4JI0T 4AIUA 3OBVE 2C5JA 4E7ZA 2XNUA 2V7LA 5IYZE 3SFDA 3IEEA 2WDQA 1J5ET 4QXCB 4AFTA 5AFUL 2OV9A 3AE1A 2YDRA 4PK5A 3FXEB 2K5BB 3T8OA 1XWMA 5JDNA 4O8SA 1I9BA 4H9NC 4TWFA 3K8PC 1L0VA 2CCQA 5JH7E 2RP4A 3SWHA 3LSVA 2VVSA 2CLYB 2CM0A 2H7VC 2AE9A 2B1EA 3CPZA 4ZRUA 4HWHA 5ABHA 4LMLA 3NRXA 1HS7A 2HN1A 4X64T 3E22E 3UFGA 5ADXL 4DV7T 5L3EB 5J0ZA 1OXZA 2V1DB 3WTHA 3ZSSA 4AQGA 2UUBT 5L4HA 2KMFA 2IUBA 4A56A 2WS3A 4BJNA 1T98A 2HN2A 3M65A 1IZNB 3P50A 2ACXA 5SYOA 2LHNA 3RRWA 5ABFB 3K3OA
chains in the Genus database with same CATH topology
4ZK1A 3SQ9A 2MAWA 5CFBA 4LMJA 3WIPA 4ZZCA 5AFJA 1OEDC 2BR8A 3WTLA 5LXBA 2Y57A 3PEOA 2BYQA 2M6IA 3EAMA 2WZYA 4TWHA 4ZK4A 4QABA 5FJVA 3WTKA 2KSRA 2XNTA 2YKSA 4PIRA 2ZJVA 3PMZA 5HEUA 2PGZA 3UU3A 4AFTA 4NPPA 2C9TA 2WNJA 2X00D 2XQ4A 2BYRA 3C84A 5J5IA 2YMEA 4ZR6A 3UQ7A 3TLTA 4TNWA 4ZJTA 2XQ9A 4UM1A 5CO5A 2BG9E 5BW2A 3JAFA 4ILAA 2YMDA 3U8JA 3RIFA 5KE4A 4ZZBA 5AINA 3TLSA 1OEDE 5HCJA 3C79A 5AFMA 2BG9C 3UUBA 5BRXA 2LLYA 4A97A 3WTMA 5TVCA 3T4MA 4F8HA 2BYNA 3UU5A 2XYSA 4ALXA 5AFLA 2W8FA 3SIOA 3U8MA 3UU8A 2XQ7A 2BG9B 4HFDA 1I9BA 4TWFA 4UM3S 4XK9A 2LKGA 3JADA 4HFCA 2WN9A 4ZJSA 2XZ5A 5J5HA 4QH4A 2XQ5A 1OEDB 4QH1A 3U8LA 3LSVA 4IL9A 3WTNA 5J5GA 2Y58A 1UW6A 3WTJA 4AFHA 5L4EA 3RI5A 2PH9A 2BR7A 3EHZA 3UQ4A 3ZKRA 3TLVA 5HEJA 2WNLA 4HFHA 3WTIA 4ZRUA 4AFGA 4TWDA 2BYSA 2M6BA 5JMEA 4HFEA 3GUAA 4NZBA 4LMLA 4TNVA 2XNVA 2YOEA 2BG9A 4DBMA 3UU6A 3U8KA 3RQWA 4X5TA 5HEGA 2XQ8A 2XQ3A 2Y54A 2XZ6A 3SQ6A 1OEDA 4HFIA 5HCMA 3EI0A 2BJ0A 5KZUA 4HFBA 3TLWA 4XHEA 4LMKA 2W8GA 2X00A 4ILCA 3JAEA 4Z90A 3WTOA 3TLUA 2WNCA 4QH5A 4A98A 4UM3A 2QC1B 5J0ZA 3P4WA 4BQTA 4QACA 4IL4A 4Z91A 5AFHA 3UU4A 2Y56A 2XQ6A 2YN6A 4UM3P 2LKHA 5L47A 4QAAA 3RQUA 3WTHA 5BP0A 4EZ1A 4ILBA 3RIAA 5HEHA 2BYPA 2Y7YA 5L4HA 4BFQA 3U8NA 2VL0A 4IREA 4FRRA 3ZDGA 5IUXA 2LM2A 5HEOA 5AFNA 1UX2A 3RHWA 2XNUA 2XYTA 4COFA 2ZJUA 3P50A 1UV6A 2XQAA 5LG3A 5SYOA 4B5DA 4D01A 5J5FA 4UY2A 4UXUA 2UZ6A 3IGQA 4HQPA 3ZDHA 5AFMB 3SH1A 5AFKA 4WV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK1 A;  3SQ9 A;  2MAW A;  5CFB A;  4LMJ A;  3WIP A;  4ZZC A;  5AFJ A;  1OED C;  2BR8 A;  3WTL A;  5LXB A;  2Y57 A;  3PEO A;  2BYQ A;  2M6I A;  3EAM A;  2WZY A;  4TWH A;  4ZK4 A;  4QAB A;  5FJV A;  3WTK A;  2KSR A;  2XNT A;  2YKS A;  4PIR A;  2ZJV A;  3PMZ A;  5HEU A;  2PGZ A;  3UU3 A;  4AFT A;  4NPP A;  2C9T A;  2WNJ A;  2X00 D;  2XQ4 A;  2BYR A;  3C84 A;  5J5I A;  2YME A;  4ZR6 A;  3UQ7 A;  3TLT A;  4TNW A;  4ZJT A;  2XQ9 A;  4UM1 A;  5CO5 A;  2BG9 E;  5BW2 A;  3JAF A;  4ILA A;  2YMD A;  3U8J A;  3RIF A;  5KE4 A;  4ZZB A;  5AIN A;  3TLS A;  1OED E;  5HCJ A;  3C79 A;  5AFM A;  2BG9 C;  3UUB A;  5BRX A;  2LLY A;  4A97 A;  3WTM A;  5TVC A;  3T4M A;  4F8H A;  2BYN A;  3UU5 A;  2XYS A;  4ALX A;  5AFL A;  2W8F A;  3SIO A;  3U8M A;  3UU8 A;  2XQ7 A;  2BG9 B;  4HFD A;  1I9B A;  4TWF A;  4UM3 S;  4XK9 A;  2LKG A;  3JAD A;  4HFC A;  2WN9 A;  4ZJS A;  2XZ5 A;  5J5H A;  4QH4 A;  2XQ5 A;  1OED B;  4QH1 A;  3U8L A;  3LSV A;  4IL9 A;  3WTN A;  5J5G A;  2Y58 A;  1UW6 A;  3WTJ A;  4AFH A;  5L4E A;  3RI5 A;  2PH9 A;  2BR7 A;  3EHZ A;  3UQ4 A;  3ZKR A;  3TLV A;  5HEJ A;  2WNL A;  4HFH A;  3WTI A;  4ZRU A;  4AFG A;  4TWD A;  2BYS A;  2M6B A;  5JME A;  4HFE A;  3GUA A;  4NZB A;  4LML A;  4TNV A;  2XNV A;  2YOE A;  2BG9 A;  4DBM A;  3UU6 A;  3U8K A;  3RQW A;  4X5T A;  5HEG A;  2XQ8 A;  2XQ3 A;  2Y54 A;  2XZ6 A;  3SQ6 A;  1OED A;  4HFI A;  5HCM A;  3EI0 A;  2BJ0 A;  5KZU A;  4HFB A;  3TLW A;  4XHE A;  4LMK A;  2W8G A;  2X00 A;  4ILC A;  3JAE A;  4Z90 A;  3WTO A;  3TLU A;  2WNC A;  4QH5 A;  4A98 A;  4UM3 A;  2QC1 B;  5J0Z A;  3P4W A;  4BQT A;  4QAC A;  4IL4 A;  4Z91 A;  5AFH A;  3UU4 A;  2Y56 A;  2XQ6 A;  2YN6 A;  4UM3 P;  2LKH A;  5L47 A;  4QAA A;  3RQU A;  3WTH A;  5BP0 A;  4EZ1 A;  4ILB A;  3RIA A;  5HEH A;  2BYP A;  2Y7Y A;  5L4H A;  4BFQ A;  3U8N A;  2VL0 A;  4IRE A;  4FRR A;  3ZDG A;  5IUX A;  2LM2 A;  5HEO A;  5AFN A;  1UX2 A;  3RHW A;  2XNU A;  2XYT A;  4COF A;  2ZJU A;  3P50 A;  1UV6 A;  2XQA A;  5LG3 A;  5SYO A;  4B5D A;  4D01 A;  5J5F A;  4UY2 A;  4UXU A;  2UZ6 A;  3IGQ A;  4HQP A;  3ZDH A;  5AFM B;  3SH1 A;  5AFK A;  4WV9 A; 
#chains in the Genus database with same CATH topology
 2ZM6 T;  2X67 A;  2X68 A;  5FJV A;  1MMA A;  4PIR A;  2YDQ A;  3U3I A;  4NXN T;  2BBH A;  3CK6 A;  3ZMT B;  2J1D G;  1W0B A;  3PUA A;  4EXT A;  3KVA A;  3B5M A;  3P7I A;  2VB6 A;  3WAK A;  2MBG A;  2NR4 A;  3PUZ F;  2QGS A;  3EDU A;  4OK0 A;  2WWV A;  3WI3 A;  5LMU T;  2BKN A;  3AEF A;  1CHU A;  4WYV A;  5J2T E;  4HFC A;  3C51 A;  1NEN A;  2HH7 A;  1OWA A;  4AQF C;  4JEH B;  3PU8 A;  3EHZ A;  5LXT E;  3Q5X A;  1IBL T;  4AKI A;  4ZI7 E;  4ERR A;  4OYK A;  4MAL A;  2ES0 A;  1XDO A;  1OED A;  5KZU A;  2OLT A;  4XHE A;  3AB3 B;  4LMK A;  2W8G A;  4ZXL A;  3WTO A;  3JAE A;  3LDQ B;  4ZI3 D;  1IBM T;  2PFV A;  2L9Q A;  5LBM A;  4DV4 T;  3ONX A;  4KX6 A;  5L3C B;  4IRE A;  2D9D A;  3K3N A;  3S4U A;  2NP9 A;  4EV6 A;  1UX2 A;  2XJ7 A;  5E0O A;  3JC6 D;  5AQO B;  3AEE A;  5JR9 A;  2UZ6 A;  3IGQ A;  1FIO A;  3SQ9 A;  4ZZC A;  1HR0 T;  2LEH A;  5JRE A;  4Z8X A;  1M7K A;  4IIJ E;  4PAG A;  2VK9 A;  4BAY B;  2ZJV A;  3IHR A;  2CLY C;  4FI5 A;  1LVF A;  4IDO A;  3RLF F;  1I94 T;  5BW2 A;  4AKL A;  4JEU B;  2DCF A;  3PUW F;  4A97 A;  3LK2 B;  5EZY E;  4UM3 S;  2ZM8 A;  3ZN0 B;  2X66 A;  3KV5 A;  4QH1 A;  1MMG A;  1SA0 E;  1UW6 A;  4ISS A;  5L4E A;  3N9O A;  1MMD A;  3ZKR A;  4TV9 E;  3ZYL A;  1WYC A;  3FXD B;  4HFH A;  4P1N A;  4U72 A;  4UVC B;  2XNV A;  2YOE A;  2BVL A;  5AQP B;  3R6N A;  5HAX A;  3AXJ A;  3AA6 B;  5JVD E;  1FJG T;  5KDM C;  3RC3 A;  2LSG A;  2V5D A;  5L2L A;  4OHF A;  2NWB A;  4BJM A;  4DV0 T;  3C4Z A;  4YXD A;  2UXD T;  3MK7 C;  4BQT A;  2Y56 A;  2CXF A;  2JIW A;  5BP0 A;  3RRC A;  3RQU A;  3U78 A;  5LGU B;  4H63 V;  2LM2 A;  4P0A A;  4DR5 T;  3ETV A;  2XAG B;  4CXX A;  2FJB A;  4YSZ A;  2UUA T;  5L3F B;  2ZJU A;  1ZP0 A;  2CWO A;  3CQC B;  3ZN1 B;  4O2B E;  5HWY A;  2DHR A;  3RIU C;  3SH1 A;  5CA1 E;  3MXZ A;  4DR3 T;  5AQS B;  3WTK A;  2BDE A;  2W66 A;  5JDQ A;  1NWM X;  2LHR A;  3UTK A;  4DR6 T;  3UU3 A;  3QK6 A;  2C9T A;  4I55 E;  3MAC A;  3T1Y T;  4M1P A;  4X1K E;  4ZZB A;  2V7M A;  5BRX A;  2UU9 T;  2BYN A;  3UU5 A;  3I9W A;  4J2C A;  3SIO A;  1UX5 A;  3ZMV B;  3PUV F;  3V5U A;  3P4P A;  4XK9 A;  2XZ5 A;  4DR7 T;  3LK4 2;  5J5G A;  4XZC A;  2D2S A;  4X1I E;  3HKC E;  2WDV A;  2E5V A;  2G0U A;  3AE3 A;  3VR8 A;  3GUA A;  2E9X B;  3F31 A;  2CXD A;  2UXX B;  4U33 A;  3OVU A;  3ZCI A;  2V8S V;  5AQM B;  4JBW F;  5LYJ E;  3DJB A;  1UX4 A;  2XM2 A;  3AED A;  2XAH B;  2X00 A;  2L8K A;  3K3Q C;  2V6Y A;  2CPT A;  5HWX A;  1N36 T;  1XNR T;  5L47 A;  2YEV C;  2JMK A;  4JI1 T;  1T8B A;  2XY8 B;  5KXJ A;  4JI6 T;  4KHP T;  2WQY A;  1KK7 A;  3QB5 A;  5LNK A;  2QYW A;  4PW8 A;  3PJA J;  1MIV A;  3CVR A;  4B5D A;  1HFA A;  5LP6 E;  2LSJ A;  3AE4 A;  4DO0 A;  1JNR A;  5FY7 A;  2Y57 A;  4QHO A;  4TWH A;  3UUM A;  3BQI A;  2UXC T;  4CN4 A;  4WW0 A;  3ZST A;  4CZZ B;  4UF0 B;  3B13 A;  3VU7 H;  3C84 A;  2ZM2 A;  4ZJT A;  2H3R A;  4ILA A;  4KMC A;  2OA5 A;  2YMD A;  3PUQ A;  1EZ3 A;  2BG9 C;  4DND A;  2VKJ A;  5JRC A;  5AQF B;  5AFL A;  2KZ7 B;  2A2F X;  4TUY E;  5KX5 E;  2R6G F;  3U8L A;  2WDR A;  2W62 A;  4UIG A;  4AFH A;  4XAX B;  4DBQ A;  1VCS A;  2YU2 A;  3HKD E;  4HWD A;  3ESL A;  3FZL B;  3ZC1 A;  3PU3 A;  2ACZ A;  4JI4 T;  2FJD A;  1MND A;  1VCT A;  2FJA A;  2JQH A;  3HKB E;  3ZT5 A;  3RKG A;  4DUZ T;  4ZI3 C;  2V26 A;  2BS3 A;  4L5G A;  1XMO T;  2NOX A;  5LGN B;  2CHN A;  4IL4 A;  3SOL A;  4YFS A;  1ZHC A;  2VVN A;  4I43 B;  4E7S A;  4LF7 T;  5J1G A;  4GIW A;  3JC6 C;  2IDO B;  2J4G A;  4TV8 E;  3AEG A;  4COF A;  5C8Y E;  3RX6 A;  2EHO B;  3FBL A;  4O4I E;  4UXU A;  3NWI A;  4X1Y E;  1KF6 A;  2XM1 A;  3OYZ A;  5FP3 A;  3WTL A;  1UUR A;  4CN6 A;  2KSR A;  3L3P A;  3Q9D A;  2L3L A;  2Q9Q D;  5FXZ A;  1N33 T;  2SPC A;  4JYA T;  3RYC E;  2WBL A;  3U8J A;  3KFW X;  2LOS A;  5AFM A;  2LLY A;  3SFE A;  3FBZ A;  3RIU A;  3U8M A;  2XHE B;  2XQ7 A;  3NZQ A;  2W4X A;  5DAB A;  4KBM B;  5LMN T;  2LSI A;  3KVB A;  2KWH A;  3ZPO A;  5H6R B;  4C91 A;  4I0U A;  2WNL A;  2X51 A;  4P09 A;  4QX7 B;  4AFG A;  3UUN A;  3GN5 B;  4DID B;  2YDS A;  2K3W A;  4CN1 A;  4DV6 T;  1FEW A;  3PE0 A;  1NAF A;  4UEM A;  2CHO A;  5C3J A;  4H9O C;  5L3B B;  5FXV A;  2WZI A;  4PJN A;  4EZH A;  4HFV A;  4EZ1 A;  4ANJ A;  3X1D A;  4EAH A;  1O3X A;  4DV3 T;  1MIY A;  1KEY A;  5LJN A;  2YIN A;  2LJL A;  4UXN B;  1XMQ T;  2LRL A;  4I50 E;  2WB5 A;  1WFD A;  3ZMU B;  2GK9 A;  5AFK A;  2VWA A;  3ONJ A;  4ZK1 A;  5TAO A;  3TKL B;  2DLR A;  2I59 A;  1N32 T;  2WY2 A;  4ZOL E;  5AQN B;  1UCU A;  2MPK A;  5CO5 A;  4JI3 T;  2MTQ A;  4H9S E;  4MBQ A;  2CEA A;  3KV9 A;  3C50 A;  1HG5 A;  3L39 A;  1T72 A;  3GA8 A;  4QKN A;  5IWA T;  4ZHQ E;  2Q9Q B;  3RI5 A;  3EDV A;  5CJ5 A;  2PH9 A;  4P0B A;  1WR0 A;  2WAU A;  2ODU A;  1BR4 A;  4NZB A;  4L0R A;  2C5K T;  3AEB A;  2BG9 A;  2EHO C;  4IE7 A;  3UU6 A;  3RQW A;  1VOM A;  3M3Z B;  5HEG A;  1HX8 A;  2WM9 A;  2XAJ B;  4HFB A;  3TLW A;  5LHH B;  1X9B A;  2WNC A;  2VUR A;  4UM3 A;  5FVK A;  4ADZ A;  4Z91 A;  3C4W A;  2YN6 A;  4GKJ T;  2LKH A;  2WU5 A;  3RIA A;  2UXN B;  4BFQ A;  2ZMA A;  2MOZ A;  4PNI A;  5DQW A;  4CQI A;  1QLB A;  3HI2 A;  3N9P A;  2Z6E A;  3KV4 A;  3NBX X;  1HNZ T;  4DR4 T;  4DR1 T;  2HHH T;  3O1H A;  4BA9 A;  4QX8 B;  5AQI B;  1FMV A;  5FL1 A;  2N1G A;  2IIU A;  3FZH B;  2XQ9 A;  3H37 A;  1U4Q A;  4MHC A;  1J1J A;  4A5X A;  5LA6 E;  3F2E A;  4B3R T;  2C5I T;  4ZJS A;  4JLE A;  4K0U A;  2K9A A;  1IJ5 A;  4XBF B;  1Y01 A;  3IBP A;  2XAQ B;  1UUS A;  2IC6 A;  1HX1 B;  2X0H A;  2W0G A;  5DQV A;  2E9X D;  3ZT6 A;  5L3G B;  3VKG A;  3O1I A;  3QUJ A;  2CA5 A;  2ZM0 A;  1KFY A;  4X5T A;  3LJC A;  2XQ3 A;  3ZMZ B;  2Y54 A;  2BKP A;  4OYJ A;  2E2A A;  1WYB A;  2DNX A;  4Z90 A;  4O2A E;  3ZCJ A;  4LF5 T;  3UFE A;  2XQ6 A;  2QVA A;  5HXS A;  4ILU A;  2Y8D A;  1LRZ A;  1GQE A;  2WWU A;  3HA4 A;  3ZDG A;  4H63 H;  3OTO T;  2LE8 A;  5CGM A;  2WMO A;  4HQP A;  4IE0 A;  1UK5 A;  3T1H T;  1IAP A;  5AFJ A;  2BR8 A;  3RPU A;  2M6I A;  2Q9Q C;  3FB2 A;  3LBX A;  4EYU A;  4UEL A;  2BYR A;  5JDH A;  2VAS A;  3C4X A;  1HTJ F;  5H6Q B;  3E0Z A;  5AQQ B;  4GK5 E;  4GYS A;  5AIN A;  2V6X A;  2QA7 A;  1D1A A;  4U31 A;  1LVK A;  4U2Z A;  2I0M A;  2E5L T;  3F57 A;  3AE7 A;  3AEC A;  4YY3 T;  4GOU A;  1D1B A;  1OED B;  3L8R A;  3B57 A;  3WTJ A;  3A7M A;  4ZS2 A;  3I1A A;  4JI2 T;  3ANW A;  2X9X A;  3HL6 A;  2X0L B;  2XAS B;  4IE5 A;  2C0S A;  4TNV A;  1WLX A;  2Y48 B;  2XQ8 A;  4IE4 A;  5FXW A;  4HFI A;  3EAB A;  1HNX T;  3AE6 A;  5JDF A;  3QB5 K;  4KHZ F;  3UUL A;  1G73 A;  4YJ2 E;  4YHJ A;  4FRR A;  4PK4 A;  2LSY A;  3FZM B;  2EHO D;  3I9Y A;  4NUU A;  1UV6 A;  1Z8U A;  4KP3 C;  3CWZ B;  3Q5E A;  4ZI2 D;  4DMW A;  4WV9 A;  2ZLY A;  4HE8 A;  3ZT7 A;  3AA7 B;  4AQF A;  2AXD S;  3PJA A;  4EB6 E;  4EEB A;  5LOV E;  4V1A v;  2X00 D;  3W15 B;  2K48 A;  1AJ3 A;  2LT3 A;  3JAF A;  1XNQ T;  2D0U A;  1OED E;  5FY1 A;  2CE7 A;  1YD8 G;  2X9H A;  3UUB A;  3PUX F;  3QC9 A;  5BMV E;  5TVC A;  4F8H A;  4NXM T;  2XQY A;  2XYS A;  3I0Q A;  4ALX A;  1HNW T;  3UU8 A;  4DVD A;  4EYY R;  2WSS V;  3AXJ B;  3VHL A;  2XQ5 A;  5ETW A;  2D5U A;  3AE5 A;  3TLV A;  5HEJ A;  3H3M A;  2P9B A;  2W2U A;  4DBR A;  3N9N A;  2V5C A;  2V7J A;  2B76 A;  3ZYK A;  3KIN B;  2XZ6 A;  2KXP B;  4O4J E;  5JTG A;  1XZY A;  3J7Y q;  3P4S A;  2W61 A;  4QH5 A;  3CX7 B;  2HPJ A;  2A3D A;  3PV0 F;  2BS2 A;  4GKK T;  3UUX B;  1Z0P A;  5EK3 A;  2Y7Y A;  5HEH A;  5AQU B;  4HGA A;  5AQJ B;  3ZMS B;  5CA0 E;  5IUX A;  1FMW A;  5AFN A;  5M4Y A;  3O4X E;  4HTE A;  2XQA A;  4LFA T;  3V5S A;  5FVL A;  3AAA B;  4AIS A;  4ZS3 A;  4OX9 T;  3ZDH A;  2VL8 A;  1KNZ A;  5HXR A;  2MAW A;  4LMJ A;  3WIP A;  1JNZ A;  4YTP A;  3ABV A;  1OED C;  5C2T A;  3VR9 A;  4QAB A;  2JQ9 A;  3PMZ A;  5HEU A;  2XAF B;  1YQ3 A;  4JV5 T;  2DWG A;  3A8Y C;  4EIW A;  3QNU A;  4X65 T;  4TNW A;  4UM1 A;  1D1C A;  5FL0 A;  1YXR A;  3P8C D;  3RIF A;  3C79 A;  1ZOY A;  5ABF A;  4IHJ E;  3T4M A;  2UXB T;  1ZEE A;  1BR0 A;  4IGU A;  2WN9 A;  2NTY A;  3CX8 B;  2H89 A;  3N2G E;  4IL9 A;  3WTN A;  3Q5W A;  5F8P A;  5BR8 T;  2V6Y B;  2E9X C;  1WCR A;  1HCI A;  4PFO A;  2VQF T;  3GMI A;  2M6B A;  3RGL A;  5FYM A;  3GWH A;  2KIN B;  3AE8 A;  3SQ6 A;  3PUY F;  1IJ6 A;  2UUC T;  4YSY A;  2PJQ A;  4ILC A;  1W09 A;  1YQ4 A;  4TN7 B;  2QC1 B;  5AFH A;  4L9I A;  4UM3 P;  3AA1 B;  2KND A;  4ASK A;  2JQQ A;  2K24 A;  4QAA A;  4LF9 T;  3U8N A;  4U7Y A;  4CI2 B;  3LG7 A;  4U74 A;  4KUM B;  1KNR A;  5JDL A;  3LFM A;  3KDS E;  2H7O A;  3ZJ1 A;  5J5F A;  4YSX A;  3N5L A;  4DMV A;  4QXB B;  5JRC B;  3WAJ A;  1US7 B;  5LXB A;  1ZV4 X;  4CXW A;  3PEO A;  2BYQ A;  4WZX A;  2JQK A;  4HKA A;  3RH3 A;  4PJM A;  5AQT B;  4DV2 T;  2WNJ A;  2YME A;  4ZR6 A;  2M67 A;  3CQG B;  1BR1 A;  5FY0 A;  5FNV E;  4CXY A;  5LG4 A;  5HXE A;  5KE4 A;  2RPA A;  3H3A A;  2Y6X A;  2D0T A;  5F5W A;  3JCF A;  3MKD A;  2YK0 A;  3AE2 A;  4HFD A;  3RYI E;  3RYH E;  3E08 A;  4B6X A;  5AQV B;  2BR7 A;  2BKO A;  1YKE B;  3NVO A;  3PDY A;  4HWF A;  4TWD A;  1DU2 A;  2XZE A;  2XPK A;  4DBM A;  4MLK A;  4AKR B;  1SE7 A;  5HCM A;  3OYX A;  3VRB A;  1SUM B;  1UGO A;  3LK3 B;  3TLU A;  2V7I A;  2XSA A;  1QUU A;  2CWY A;  1XDP A;  5AQG B;  4QAC A;  3UU4 A;  4CI1 B;  2CRB A;  5HXH A;  2BYP A;  4LFC T;  2LM9 A;  2VL0 A;  3J9X 1;  3BQK A;  2WMN A;  5FKY A;  3RHW A;  1V9D A;  4IDQ A;  2FJE A;  3CQX C;  1X79 A;  4ZI2 C;  1MNE A;  2XUE A;  3Q2M A;  5AFM B;  4AI6 A;  5CFB A;  2KT9 A;  3AEA A;  2X9Y A;  4NUV A;  4H9Q C;  2WP9 A;  3A5X A;  2KLQ A;  3ZLI A;  4QXH B;  4PJJ A;  4Q25 A;  3RKO A;  3P4R A;  5LGT B;  1G8X A;  3TLT A;  4NIQ A;  5LJM A;  2LOP A;  2LRK A;  3WTM A;  2H88 A;  2W8F A;  4FJO A;  3EVY A;  2LKG A;  3JAD A;  2DI4 A;  4H9R C;  4PJL A;  2CBI A;  4QH4 A;  3NRY A;  2Y58 A;  1LKX A;  3HR0 A;  4F6R C;  5AQK B;  3KBU A;  3AVS A;  3BQL A;  3DTO A;  4UV9 B;  2JMH A;  3RF1 A;  1W0A A;  1BR2 A;  3N2K E;  2BYS A;  4U2Y A;  1D0Z A;  1I6Z A;  1D0Y A;  3Q5D A;  2J47 A;  4JI5 T;  5ABG A;  4CI3 B;  2IML A;  3P4Q A;  2JRK A;  3OPC A;  3FZF B;  3MJX A;  2WZH A;  2IAK A;  3N9L A;  1KNP A;  3NZP A;  3I0O A;  4ZEY A;  4LFB T;  4ILB A;  4YTM A;  2E9X A;  4N78 D;  5JQG E;  4I4T E;  3N9Q A;  4UR9 A;  4YHH T;  5IHY A;  5LG3 A;  1MIW A;  2A9U A;  4MFR A;  4DV5 T;  4LF8 T;  2PG8 A;  5EK4 A;  5LCY A;  1H7C A;  3PUS A;  4EED A;  4ZK4 A;  3RYF E;  4OFZ A;  4EOZ B;  4G2A A;  3SS1 A;  3VRA A;  4IST A;  5J5I A;  2XQ4 A;  1VRB A;  4G63 A;  2E8I A;  2A72 A;  4TZ4 C;  2VKD A;  4UVA B;  3IF8 B;  3RC8 A;  2BG9 B;  5L3D B;  1SHZ C;  4HN9 A;  5CB4 E;  2VKO A;  1S94 A;  2WU2 A;  3CIR A;  4JUY A;  4UF0 A;  4IDN A;  5HYA A;  2XSB A;  5LHI B;  4EZ4 A;  4YTN A;  2W00 A;  4X66 T;  3WTI A;  5AQL B;  2N9D A;  3UT5 E;  3FZK B;  4IDZ A;  3U8K A;  2PTF A;  2IHR 1;  3ZC0 A;  2F4V T;  2NW7 A;  4A98 A;  2X0Y A;  3EUH A;  2X9W A;  3CX6 B;  3OKQ A;  1R8I A;  3FHN A;  2BBJ A;  2NW9 A;  3G06 A;  5JDM A;  4DR2 T;  4O4L E;  5LBQ B;  1CUN A;  5A1L A;  5HEO A;  1E1H B;  1HF8 A;  4JI7 T;  5FMN A;  4YT0 A;  3C98 B;  2FBW A;  2XTL A;  4AKG A;  5JR9 B;  1WR6 A;  1T7S A;  3C64 A;  4IT4 A;  2V7K A;  3AVR A;  2KWI B;  2ODV A;  5J2U E;  1U5P A;  3EAM A;  4C90 A;  2WZY A;  5KMG P;  2XNT A;  2YKS A;  3IA3 A;  4NPP A;  1IBK T;  4PFP A;  2J62 A;  4AXP A;  2EHO A;  4JI8 T;  2BG9 E;  4H9P C;  5JDG A;  4IE6 A;  3KBT A;  3KV6 A;  3TLS A;  3PUG A;  5HCJ A;  4LF6 T;  5GON E;  2MYS A;  3PTR B;  2NW8 A;  2CBJ A;  5F3J A;  1YKH B;  3K1S A;  2VKH A;  3N9M A;  4HWI B;  4X62 T;  3OJA A;  2BVM A;  4K0K T;  3UQ4 A;  3CML A;  2PBI A;  3PUR A;  4KI0 F;  4YLH A;  4B3S T;  2DL1 A;  2BS4 A;  3AAE B;  3N2O A;  5JME A;  4HFE A;  3BK9 A;  2VQE T;  2CXL A;  5LHG B;  2QRX A;  3ONL C;  2JPF A;  3DP7 A;  5AQR B;  4WNK A;  2JJ9 A;  2LSK A;  4WBO A;  2BJ0 A;  3QOF A;  4UV8 B;  3HKE E;  4B3T T;  4B3M T;  3O1J A;  1B7T A;  4UVB B;  4TX5 A;  3GN5 A;  3VKH A;  3LBX B;  5EK2 A;  4GYR A;  2XYT A;  4PK6 A;  3ZEF B;  3O9X A;  4D01 A;  4UY2 A;  2IW5 B;  1M62 A;  5ABE A;  4AKH A;  2W67 A;  1ZKE A;  4U3C A;  4QWN B;  5LB7 B;  4WBN E;  1YW0 A;  1QSD A;  4X20 E;  2WCA A;  2PGZ A;  3ZJ2 A;  4IDP A;  1MMN A;  1E7P A;  3UQ7 A;  2YU1 A;  1S35 A;  1Y64 B;  2N2N A;  2RA1 A;  3NKZ A;  3ANW B;  4DUY T;  2DWK A;  4GK0 E;  3AE9 A;  5DJQ C;  5FXX A;  3ETU A;  1N34 T;  1D0X A;  1WRD A;  3ZYM A;  2IC9 A;  5J5H A;  1NEK A;  3CKD A;  4O4H E;  2BZB A;  1W9R A;  2HPL A;  3MZK B;  3L09 A;  3AAI A;  3AA0 B;  2CMR A;  4HWC A;  5HXC A;  4YJ3 E;  4U7I A;  1E2A A;  1J5W A;  3D0T A;  4LF4 T;  2NTX A;  5JR9 C;  4HEA A;  2FUP A;  3EI0 A;  5AQH B;  2Q9Q A;  3MA9 A;  3P4W A;  3R84 B;  1HG2 A;  3SRZ A;  2I6H A;  2W63 A;  4EGW A;  4DV1 T;  4AQY T;  4JI0 T;  4AIU A;  3OBV E;  2C5J A;  4E7Z A;  2XNU A;  2V7L A;  5IYZ E;  3SFD A;  3IEE A;  2WDQ A;  1J5E T;  4QXC B;  4AFT A;  5AFU L;  2OV9 A;  3AE1 A;  2YDR A;  4PK5 A;  3FXE B;  2K5B B;  3T8O A;  1XWM A;  5JDN A;  4O8S A;  1I9B A;  4H9N C;  4TWF A;  3K8P C;  1L0V A;  2CCQ A;  5JH7 E;  2RP4 A;  3SWH A;  3LSV A;  2VVS A;  2CLY B;  2CM0 A;  2H7V C;  2AE9 A;  2B1E A;  3CPZ A;  4ZRU A;  4HWH A;  5ABH A;  4LML A;  3NRX A;  1HS7 A;  2HN1 A;  4X64 T;  3E22 E;  3UFG A;  5ADX L;  4DV7 T;  5L3E B;  5J0Z A;  1OXZ A;  2V1D B;  3WTH A;  3ZSS A;  4AQG A;  2UUB T;  5L4H A;  2KMF A;  2IUB A;  4A56 A;  2WS3 A;  4BJN A;  1T98 A;  2HN2 A;  3M65 A;  1IZN B;  3P50 A;  2ACX A;  5SYO A;  2LHN A;  3RRW A;  5ABF B;  3K3O A; 
#chains in the Genus database with same CATH homology
 4ZK1 A;  3SQ9 A;  2MAW A;  5CFB A;  4LMJ A;  3WIP A;  4ZZC A;  5AFJ A;  1OED C;  2BR8 A;  3WTL A;  5LXB A;  2Y57 A;  3PEO A;  2BYQ A;  2M6I A;  3EAM A;  2WZY A;  4TWH A;  4ZK4 A;  4QAB A;  5FJV A;  3WTK A;  2KSR A;  2XNT A;  2YKS A;  4PIR A;  2ZJV A;  3PMZ A;  5HEU A;  2PGZ A;  3UU3 A;  4AFT A;  4NPP A;  2C9T A;  2WNJ A;  2X00 D;  2XQ4 A;  2BYR A;  3C84 A;  5J5I A;  2YME A;  4ZR6 A;  3UQ7 A;  3TLT A;  4TNW A;  4ZJT A;  2XQ9 A;  4UM1 A;  5CO5 A;  2BG9 E;  5BW2 A;  3JAF A;  4ILA A;  2YMD A;  3U8J A;  3RIF A;  5KE4 A;  4ZZB A;  5AIN A;  3TLS A;  1OED E;  5HCJ A;  3C79 A;  5AFM A;  2BG9 C;  3UUB A;  5BRX A;  2LLY A;  4A97 A;  3WTM A;  5TVC A;  3T4M A;  4F8H A;  2BYN A;  3UU5 A;  2XYS A;  4ALX A;  5AFL A;  2W8F A;  3SIO A;  3U8M A;  3UU8 A;  2XQ7 A;  2BG9 B;  4HFD A;  1I9B A;  4TWF A;  4UM3 S;  4XK9 A;  2LKG A;  3JAD A;  4HFC A;  2WN9 A;  4ZJS A;  2XZ5 A;  5J5H A;  4QH4 A;  2XQ5 A;  1OED B;  4QH1 A;  3U8L A;  3LSV A;  4IL9 A;  3WTN A;  5J5G A;  2Y58 A;  1UW6 A;  3WTJ A;  4AFH A;  5L4E A;  3RI5 A;  2PH9 A;  2BR7 A;  3EHZ A;  3UQ4 A;  3ZKR A;  3TLV A;  5HEJ A;  2WNL A;  4HFH A;  3WTI A;  4ZRU A;  4AFG A;  4TWD A;  2BYS A;  2M6B A;  5JME A;  4HFE A;  3GUA A;  4NZB A;  4LML A;  4TNV A;  2XNV A;  2YOE A;  2BG9 A;  4DBM A;  3UU6 A;  3U8K A;  3RQW A;  4X5T A;  5HEG A;  2XQ8 A;  2XQ3 A;  2Y54 A;  2XZ6 A;  3SQ6 A;  1OED A;  4HFI A;  5HCM A;  3EI0 A;  2BJ0 A;  5KZU A;  4HFB A;  3TLW A;  4XHE A;  4LMK A;  2W8G A;  2X00 A;  4ILC A;  3JAE A;  4Z90 A;  3WTO A;  3TLU A;  2WNC A;  4QH5 A;  4A98 A;  4UM3 A;  2QC1 B;  5J0Z A;  3P4W A;  4BQT A;  4QAC A;  4IL4 A;  4Z91 A;  5AFH A;  3UU4 A;  2Y56 A;  2XQ6 A;  2YN6 A;  4UM3 P;  2LKH A;  5L47 A;  4QAA A;  3RQU A;  3WTH A;  5BP0 A;  4EZ1 A;  4ILB A;  3RIA A;  5HEH A;  2BYP A;  2Y7Y A;  5L4H A;  4BFQ A;  3U8N A;  2VL0 A;  4IRE A;  4FRR A;  3ZDG A;  5IUX A;  2LM2 A;  5HEO A;  5AFN A;  1UX2 A;  3RHW A;  2XNU A;  2XYT A;  4COF A;  2ZJU A;  3P50 A;  1UV6 A;  2XQA A;  5LG3 A;  5SYO A;  4B5D A;  4D01 A;  5J5F A;  4UY2 A;  4UXU A;  2UZ6 A;  3IGQ A;  4HQP A;  3ZDH A;  5AFM B;  3SH1 A;  5AFK A;  4WV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...