3UU4A

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in the crystal in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu4A01
4ZR6A 4QACA 1I9BA 2XQ6A 2M6BA 5HCMA 3UU4A 5J5GA 4F8HA 2X00D 2BYRA 5BRXA 2XQ5A 2WNCA 2W8FA 3RIAA 5HEJA 2BYPA 5HEOA 2XQAA 3U8NA 5AFLA 3ZDGA 4Z90A 2XYTA 4HFIA 3TLWA 4TNWA 4AFTA 3RIFA 4XK9A 2YN6A 2Y57A 4QH4A 4TWDA 5L4HA 3JAEA 3U8MA 4ALXA 5BW2A 4UM3P 4HFEA 4ZRUA 3WTKA 3GUAA 3JAFA 3RI5A 1UW6A 3WTOA 4IREA 3WTJA 2WZYA 3UQ7A 3RQUA 4ZZCA 5AFMB 2BR7A 3U8KA 4DBMA 1UV6A 2LLYA 2MAWA 4TNVA 5AFJA 2XQ7A 3WTHA 2LKHA 2YMEA 5AFMA 2PH9A 3P4WA 4UXUA 4LMKA 2UZ6A 3PEOA 2KSRA 3JADA 4QABA 5KZUA 4UM3S 2Y56A 4HFCA 1OEDB 4NPPA 4X5TA 2XQ3A 3TLUA 4AFHA 3P50A 3UU6A 3T4MA 5HCJA 3UU5A 3WTLA 4ZK1A 4AFGA 5J0ZA 3IGQA 2ZJUA 2XQ9A 2BYQA 4EZ1A 4XHEA 5AFHA 2YMDA 3UU8A 2PGZA 5AFKA 2XNTA 2BG9A 4ILBA 4IL9A 4B5DA 4BQTA 2XNVA 3TLVA 5BP0A 2M6IA 2BG9E 5L47A 4UY2A 4PIRA 3TLSA 4LMJA 4LMLA 4ZZBA 4FRRA 3WTIA 4HFBA 3PMZA 4ZK4A 2BR8A 5HEUA 4ILCA 3RQWA 5FJVA 4QAAA 2BG9C 5J5FA 2BYNA 2YKSA 5TVCA 5CO5A 3U8JA 5J5IA 4Z91A 1OEDA 5AINA 4TWHA 5AFNA 5J5HA 3UU3A 2BJ0A 3SIOA 3U8LA 4UM3A 2Y58A 5CFBA 4WV9A 4ZJTA 4HFHA 2Y54A 3UUBA 2WNLA 3UQ4A 3WIPA 4UM1A 2XQ8A 5JMEA 1OEDE 2LKGA 1OEDC 4A97A 5HEHA 2ZJVA 4HQPA 5SYOA 2VL0A 1UX2A 3ZDHA 4D01A 5KE4A 4ZJSA 3EHZA 2WN9A 4TWFA 2X00A 3C84A 2LM2A 2C9TA 2WNJA 3C79A 5LXBA 4HFDA 3SQ6A 4ILAA 4QH1A 3RHWA 3TLTA 3ZKRA 3WTNA 4BFQA 2XYSA 2YOEA 3WTMA 4COFA 4IL4A 2BG9B 3EI0A 4QH5A 2W8GA 2XZ6A 5IUXA 3SH1A 3EAMA 3LSVA 5LG3A 4A98A 5L4EA 2QC1B 2BYSA 3SQ9A 2XQ4A 4NZBA 2Y7YA 2XZ5A 5HEGA 2XNUA
chains in the Genus database with same CATH superfamily
2A3DA 4ZR6A 4P0AA 2Q9QD 2CBJA 2CMRA 3PUZF 3A8YC 1OWAA 2JQQA 5AQVB 4KBMB 2JQHA 3RIFA 4XK9A 4TWDA 2LHNA 3JAEA 2CXLA 1QSDA 2XY8B 4EOZB 3WTOA 2X9HA 3UUMA 3WTJA 4LFAT 4WBOA 4UXUA 4CXWA 2CM0A 2E9XD 2Y8DA 1OEDB 3MA9A 3PUVF 1L0VA 4QHOA 3I0QA 2LM9A 1NWMX 3RRWA 2XQ9A 3OYXA 2PGZA 4ISTA 1O3XA 3RPUA 2HPJA 4TV9E 2MTQA 5LMUT 3FZLB 5LXTE 4X20E 4PIRA 3N2KE 3DJBA 3Q9DA 4LFCT 2D2SA 3N9LA 3OJAA 3PUWF 3T1YT 4YJ2E 5AFNA 4X66T 4H9NC 5AQOB 4UVCB 1H7CA 5LNKA 4AQGA 2D0UA 2JPFA 2DL1A 3EVYA 4U72A 3R6NA 3A5XA 4EV6A 5HWYA 3W15B 1WFDA 1HNWT 1KFYA 2XYSA 4V1Av 4PJJA 1VOMA 1X9BA 3NRYA 2RA1A 3AE8A 1HCIA 3AA1B 5ABGA 4WZXA 2E2AA 3DTOA 4KMCA 5H6QB 5HWXA 3ETUA 5AQGB 1MNEA 4L0RA 4CI3B 4AFTA 1W09A 3P7IA 1AJ3A 4PJMA 2IC6A 5AQHB 4IDZA 4HWHA 3UQ7A 4DV7T 2WZHA 5FY0A 2PH9A 2VVNA 3AXJA 3C64A 3N9MA 3QB5A 4JV5T 2KNDA 4AFGA 3VU7H 5J0ZA 2BG9A 4BQTA 1FMVA 1WYCA 2IW5B 4ZOLE 4AQFA 4UY2A 3L09A 3R84B 3PMZA 3IHRA 2AE9A 3H3MA 4B3ST 4M1PA 2YKSA 2C5IT 2WM9A 2UXBT 3ZYLA 4E7SA 4WW0A 5JMEA 1OEDE 3ZC1A 3PUAA 4ILUA 5KE4A 5C3JA 3AAAB 1MIVA 1U5PA 4BA9A 3UFGA 2E8IA 2CRBA 5L3CB 2IC9A 4QH5A 2XZ6A 2UUBT 1WLXA 5LGUB 2CXDA 3ZPOA 2WDRA 5IWAT 2X0HA 4GK0E 2X0LB 1MIWA 2IIUA 3GA8A 4JYAT 5HEOA 2V8SV 2I59A 2VQET 2L9QA 3C98B 3AXJB 1FIOA 4A5XA 3F2EA 3AEDA 1UW6A 1XWMA 2LKHA 3CIRA 2UZ6A 5LHIB 2UXCT 3CX7B 2KWIB 3E22E 4Q25A 4NPPA 2CBIA 3P4QA 4YFSA 4BJMA 5ADXL 3ESLA 2HHHT 3NBXX 2JQKA 1T8BA 2QVAA 2X9XA 5AQQB 4IDOA 3TLSA 3ZCJA 2XAQB 4FRRA 3ZJ2A 4OK0A 2BG9C 3RC3A 4DR6T 1UK5A 4Z91A 2LHRA 5HYAA 4UV9B 2JIWA 3LK3B 1FJGT 2XQ8A 1NAFA 1UX2A 2K9AA 4JI3T 4QXCB 3C84A 3C79A 4KP3C 3FBLA 4EXTA 5HXHA 4LF9T 3I9YA 3S4UA 2YU2A 5L3BB 3MACA 3VR9A 5JDNA 5JR9C 4IE4A 2PBIA 5EK2A 5FL1A 2DHRA 2XQ6A 2M6BA 3ZMTB 3SWHA 4F8HA 5BRXA 1W9RA 2ACZA 2YDQA 5HEJA 5ABFA 4MLKA 4DBQA 1CHUA 4TNWA 3RC8A 2YN6A 2V5CA 5ABHA 2WP9A 1T72A 4CXXA 3JAFA 2C0SA 4IE7A 2W4XA 2XSBA 2BR7A 2YEVC 4DR7T 3A7MA 2XQYA 3M3ZB 3GMIA 2Q9QB 4LMKA 3CQXC 2BS2A 4B3MT 4HFCA 2JMKA 4TV8E 4UF0A 1ZV4X 2ZJUA 4EAHA 2BYQA 5IHYA 5AFKA 4IDPA 3P8CD 4UEMA 2BBHA 5HXEA 2WZIA 3IA3A 5CA0E 4DV3T 4LMJA 2WU5A 3FBZA 4U2YA 4H9PC 2BR8A 4O2BE 1XNQT 2BYNA 1SUMB 4TWHA 4AKHA 4UVAB 5KMGP 4NUUA 3C50A 2UUAT 3MJXA 2ZJVA 3ONLC 2X00A 3C4ZA 2LM2A 3NWIA 2CWYA 1Y01A 4QH1A 1DU2A 5FXWA 3AE6A 2WB5A 4YT0A 3BQIA 1OXZA 3I1AA 2LEHA 5J5GA 2J47A 2IAKA 4IT4A 2WNCA 2CPTA 5A1LA 3PV0F 2E9XA 1UURA 4A56A 2FJAA 4WBNE 1UX4A 2V6YB 3ZDGA 3AECA 4Z8XA 2WBLA 3AE5A 2LSKA 4YHHT 5BW2A 4ZRUA 2V7LA 4J2CA 2QGSA 3RYFE 4UV8B 3N9PA 3AA6B 2N2NA 4I4TE 5AFMA 4DV1T 1VCSA 3ONXA 1KNRA 4CN1A 3ZSTA 4EEBA 2BKOA 4AFHA 3TLUA 4O4IE 1X79A 3EDVA 3QUJA 2A9UA 3ZMZB 1IBKT 4ADZA 3CQCB 2XNTA 4HWFA 3Q5XA 2M67A 3VR8A 1W0AA 4ISSA 5BP0A 2M6IA 5JREA 2W63A 1YQ3A 2WY2A 3KVAA 1E1HB 5FJVA 4UF0B 4X65T 3ANWB 3WAJA 4WNKA 3AEBA 1OEDA 2JQ9A 3U8LA 2XJ7A 3OBVE 2DNXA 2ODUA 5LHHB 4X1YE 5AQFB 1ZEEA 1US7B 5J2TE 4IDNA 3O4XE 1WYBA 2H7OA 5LBQB 4BFQA 2E9XB 2BDEA 2BVMA 2W8GA 1HX1B 5LG3A 2MYSA 5CGMA 2WWUA 2Y7YA 1XNRT 1M62A 5AFUL 3UUXB 2XQ5A 3LFMA 5FY7A 1IBMT 3CX8B 5AQJB 1XZYA 1ZP0A 5LG4A 2XQAA 4ZHQE 5KXJA 1XMOT 5AFLA 3LK2B 4MFRA 1IAPA 1N32T 2WU2A 3LG7A 3WAKA 4QH4A 4LF7T 2KWHA 3RI5A 3PJAA 4HEAA 2VKDA 1D1AA 4QXBB 2LT3A 2W61A 3EUHA 4KI0F 3RKOA 2XM2A 1J5WA 1IJ6A 5JRCA 3FXDB 3AE3A 5C8YE 3F31A 5LYJE 4ZI3C 2LSYA 4JI0T 4CI2B 2D5UA 4YTNA 3UUNA 2V1DB 4YTMA 4GYSA 2FUPA 4CXYA 4HFBA 3AE4A 2VVSA 4I55E 3AEAA 3LK42 5J5IA 4ERRA 3IBPA 3HA4A 4PAGA 4QKNA 3Q2MA 5BR8T 2QYWA 3ZEFB 2ZM6T 2LKGA 2GK9A 2X0YA 3ZLIA 5L3EB 4EZHA 5DQVA 3SQ6A 5JTGA 3RHWA 4IL4A 4YHJA 3RLFF 3EAMA 3SQ9A 2ACXA 2HN1A 3ZJ1A 1KEYA 1JNRA 5HEGA 4PJLA 4DV0T 3PURA 2X67A 1FEWA 5FL0A 5JDQA 2BYPA 2ODVA 3LJCA 2LRKA 3RIUC 3ZMUB 1WR0A 2Y57A 3J7Yq 2Q9QC 3U8MA 4F6RC 5FNVE 3CX6B 2LLYA 2XQ7A 4ASKA 1B7TA 2V7IA 3PEOA 2HH7A 4NXNT 3KBTA 2I0MA 2VKJA 3BQLA 4CN4A 1YW0A 3UU6A 3PU3A 4AI6A 5FXVA 2W0GA 4YSXA 5JQGE 4DUYT 1IZNB 2I6HA 4YSYA 4TZ4C 4TN7B 1HS7A 1WR6A 2LE8A 3SIOA 2WNLA 2V5DA 5L3DB 3JC6D 3KV5A 5FY1A 3OPCA 5FVKA 3ZSSA 3M65A 2B1EA 1XDPA 4HFVA 2V7JA 2BBJA 2PJQA 3V5SA 2XSAA 3K8PC 4U33A 2EHOA 3O9XA 4AKIA 2BYSA 1EZ3A 4NZBA 4HTEA 4GIWA 4QACA 2UXDT 1SE7A 3UU4A 4CQIA 4DIDB 4IE6A 3FB2A 4PK5A 4U74A 4WYVA 4B3RT 2XM1A 3LBXB 2DWKA 5JDGA 4H63H 3JCFA 1KNPA 2NW8A 3NZQA 5H6RB 4DV6T 5F5WA 5L4HA 4FJOA 4ZEYA 2LJLA 4UM3P 3WTKA 1KK7A 1G8XA 1UCUA 2NW9A 3CWZB 4OYJA 2KT9A 1LVFA 2W00A 4OFZA 5AFJA 4O2AE 2MBGA 1VRBA 3AE9A 4P0BA 1BR1A 3E0ZA 5KZUA 2OV9A 2IHR1 3AVRA 3T4MA 2NP9A 2LOPA 4QWNB 2BVLA 4K0KT 2CEAA 1MIYA 1BR2A 2QRXA 5AFHA 4JI4T 1HR0T 3KV4A 4OYKA 4P09A 2CLYB 4DR4T 3G06A 2J1DG 2YK0A 2RPAA 2K5BB 4ZK4A 4ILCA 3ZT6A 2KINB 5F8PA 5AINA 2H89A 2XAHB 3ZYMA 1YXRA 3UU3A 1HFAA 2RP4A 4LF4T 4DBRA 2Y58A 2A72A 3UT5E 4DR1T 4JEHB 4TWFA 5LGTB 3QB5K 4DR5T 3VKHA 4JEUB 4UXNB 2Y6XA 3RRCA 2UUCT 3PU8A 3EABA 1W0BA 4I50E 3RIUA 2FBWA 4XAXB 3N9OA 2LSJA 2VKHA 4PK4A 5LHGB 2V6XA 3PDYA 1CUNA 3U8NA 3FZHB 1HNXT 3C4XA 1BR0A 4ZI2C 2BKNA 2J4GA 5J2UE 1S94A 4UM3S 1HTJF 3Q5EA 2X9WA 3ZCIA 4CN6A 1KNZA 3SOLA 5C2TA 3T8OA 2YMDA 4ILBA 5AQIB 3J9X1 3FZFB 1MMNA 2AXDS 3MK7C 4C90A 5GONE 3WTIA 3L39A 4QAAA 4YLHA 3FZMB 5TVCA 3N2GE 2KMFA 5ABEA 5JH7E 4UM3A 4K0UA 4CZZB 3UQ4A 1SA0E 4UR9A 2QA7A 2K48A 4HQPA 3NZPA 2VK9A 4H63V 1HF8A 4KHZF 2YDRA 2C9TA 2YU1A 1S35A 2ES0A 5LA6E 2LSGA 2WWVA 3Q5WA 4ILAA 3TLTA 3SRZA 3ZMSB 1E2AA 3I0OA 2X66A 5AQLB 1LKXA 1R8IA 3T1HT 1YKEB 3AEEA 1D0ZA 3VKGA 4PNIA 3P4RA 2WMNA 3K3OA 2H7VC 1UUSA 4AQYT 1J5ET 4G2AA 5CJ5A 4L9IA 3TLWA 1I94T 4JI1T 2XTLA 4ZZCA 1ZKEA 2MAWA 4TNVA 2KXPB 3WTHA 3QC9A 3X1DA 3AAEB 3NVOA 2Z6EA 2ZMAA 2E5LT 3UU5A 3WTLA 3UULA 3PJAJ 4JBWF 4EZ4A 2JMHA 1MNDA 5FVLA 4HWDA 3UU8A 2X51A 4ZS3A 2XNVA 3OTOT 2KZ7B 1IJ5A 4AKLA 4PW8A 5LOVE 3ANWA 2E9XC 3DP7A 4UIGA 4AQFC 5FKYA 5J5FA 4HKAA 5CO5A 2DI4A 4ZS2A 5CFBA 4ZJTA 4UM1A 5CA1E 2EHOC 3K3QC 2WN9A 3H3AA 2WAUA 3OKQA 3Q5DA 4KUMB 3KINB 3U78A 2IDOB 3MKDA 5CB4E 1D0XA 2WDQA 3N9NA 4H9SE 5HCMA 4DR3T 3D0TA 1U4QA 2C5JA 1YD8G 3HKCE 2WCAA 5HAXA 4X1KE 4C91A 4O4JE 3RYIE 4LF6T 5AQRB 4X1IE 3RQUA 3C4WA 4HGAA 5EK3A 3QOFA 1BR4A 4KHPT 4QABA 4NIQA 3PUSA 2XQ3A 3P50A 2YDSA 5HCJA 2W67A 2X9YA 1MMDA 1Z0PA 4U7IA 2CHOA 2EHOB 4IDQA 5FXZA 4IIJE 3TLVA 1HNZT 1XDOA 3ONJA 4IE0A 4H9OC 1ZOYA 3B13A 4QX7B 2K3WA 4AKGA 2UXXB 4UVBB 3EDUA 4EYUA 2NTXA 4EIWA 2IUBA 1OEDC 1Z8UA 4PJNA 4GYRA 2P9BA 2WDVA 3H37A 2OA5A 2X68A 4JI2T 4YSZA 2NTYA 1SHZC 2Q9QA 5LCYA 5LB7B 3N5LA 5JDLA 5E0OA 4BJNA 2QC1B 2XQ4A 3HI2A 3AA7B 1N36T 2IMLA 1IBLT 3RYCE 3RX6A 2BYRA 4GKKT 2W8FA 5F3JA 4QX8B 2XYTA 4PFOA 3ZC0A 2PFVA 1FMWA 4HWCA 2A2FX 3P4SA 2W62A 4ALXA 5LMNT 5L2LA 3GN5A 4X62T 2XASB 3AE7A 2HPLA 3P4WA 2MOZA 1D1BA 4DVDA 2UU9T 4DMWA 2Y56A 3E08A 4ZI2D 3GWHA 2XAJB 5AQMB 5LJMA 4AISA 4LF8T 3SFEA 4B6XA 4B5DA 5IYZE 4IGUA 2XUEA 2D9DA 5L47A 2ZM8A 5L3GB 4DV5T 4ZI3D 3RH3A 3CPZA 4OHFA 4TUYE 3U8JA 3HR0A 4IHJE 3HKDE 2Y54A 3PUYF 2LRLA 4AXPA 4A97A 4TX5A 5EZYE 2NR4A 3ZDHA 3KV9A 5LXBA 2FJDA 2XZEA 3ZKRA 5HXCA 2XHEB 5JR9B 3CK6A 4JI7T 2YOEA 3KDSE 2BG9B 2F4VT 1J1JA 5L4EA 4FI5A 3V5UA 2XZ5A 4JI6T 4HE8A 5BMVE 4GK5E 2X00D 3ETVA 3NRXA 2FJBA 3AB3B 3AEFA 1I6ZA 1GQEA 5AQNB 3CMLA 3I9WA 3ZMVB 3AEGA 4YJ3E 4UELA 3ZN0B 2E5VA 3CVRA 4MHCA 1UV6A 5LBMA 2YMEA 4NXMT 1MMGA 4X64T 5LJNA 1WCRA 4G63A 4EZ1A 4AIUA 4IL9A 4LF5T 5EK4A 4HN9A 4H9RC 1HG5A 3OYZA 3MZKB 5AQTB 2WSSV 3KFWX 2WQYA 5HEUA 3VHLA 1N34T 3RQWA 1NENA 3OVUA 4DV2T 3VRBA 2CCQA 2UXNB 5AQPB 4HFHA 3AVSA 3WIPA 2K24A 2KLQA 1N33T 3P4PA 5L3FB 5SYOA 3N2OA 4ZJSA 5DABA 2VL8A 3L3PA 4O8SA 3WTNA 2XPKA 4COFA 2HN2A 1NEKA 3LSVA 1WRDA 2C5KT 4JI5T 3O1HA 1HX8A 2VKOA 4YTPA 1I9BA 3ZN1B 5FYMA 1QLBA 3F57A 4YXDA 3MXZA 3RIAA 1ZHCA 4Z90A 3BQKA 5M4YA 3RKGA 2CLYC 1Y64B 5TAOA 5FMNA 1G73A 4IREA 3B57A 2WZYA 4QXHB 2JRKA 5FP3A 2N9DA 4HWIB 4B3TT 5HXSA 3C51A 3IGQA 5KX5E 1QUUA 5JDFA 2BS4A 2OLTA 4ANJA 4GOUA 1M7KA 3ZYKA 4O4LE 2BG9E 4DNDA 2XAFB 2VB6A 3PTRB 1MMAA 4KX6A 3HL6A 4IE5A 5AQSB 3UUBA 5JDMA 4JUYA 4DV4T 3AA0B 4U31A 4JLEA 3EHZA 1XMQT 4I43B 1KF6A 3K1SA 4HFDA 2CHNA 2CXFA 1T7SA 4JI8T 3CQGB 2ZM0A 2CWOA 5ABFB 2W2UA 3WTMA 1UX5A 2V7MA 2V26A 3U3IA 1T98A 3ABVA 4U2ZA 2G0UA 3O1IA 3FZKB 5HXRA 2W66A 3PUGA 1VCTA 4BAYB 3O1JA 3UFEA 4DO0A 5AQKB 4DUZT 4OX9T 2SPCA 2BZBA 4O4HE 2H3RA 2ZLYA 4HFEA 5JVDE 2V7KA 3VRAA 5AFMB 1LVKA 4DBMA 4MALA 3FXEB 2NW7A 5JR9A 2KSRA 3JADA 2DCFA 2WS3A 4X5TA 3TKLB 4U3CA 2NOXA 3JC6C 4ZK1A 3ZT7A 3HKBE 3NKZA 3IEEA 2V6YA 4XHEA 2JJ9A 3LDQB 5FXXA 4LFBT 2CE7A 2B76A 4ZXLA 4ZZBA 4P1NA 5JRCB 2CA5A 5DJQC 4DR2T 1V9DA 2L3LA 4DMVA 4E7ZA 3IF8B 5J5HA 3K3NA 3RYHE 4EEDA 3KVBA 3PUQA 2BJ0A 4WV9A 2BS3A 3SS1A 2J62A 2BKPA 1E7PA 4D01A 3L8RA 1YKHB 5JDHA 2WNJA 3AAIA 4AKRB 4L5GA 5KDMC 4GKJT 1HG2A 3SFDA 4XZCA 5LGNB 3QNUA 4EYYR 3QK6A 2EHOD 3SH1A 3GN5B 4EGWA 4I0UA 3PUXF 2XNUA 4NUVA 3BK9A 2VURA 5J1GA 2VQFT 2WMOA 2DWGA 2LOSA 3HKEE 4CI1B 3CKDA 1LRZA 3RF1A 3PE0A 4HFIA 4H9QC 2L8KA 2YINA 4XBFB 2XAGB 3GUAA 3FHNA 2H88A 3U8KA 2PTFA 4EB6E 5AQUB 3ZT5A 1D0YA 2LSIA 3RGLA 4YY3T 2DLRA 3LBXA 2MPKA 4U7YA 3UTKA 2FJEA 1UGOA 2Y48B 1JNZA 4LMLA 2PG8A 2VWAA 2D0TA 2ZM2A 3AE2A 3B5MA 4PK6A 4N78D 4ZI7E 3KV6A 3AE1A 5HEHA 2VL0A 3WI3A 3KBUA 2VASA 5DQWA 5LP6E 3N9QA 4PFPA 4MBQA 2N1GA 5ETWA 3EI0A 5IUXA 2NWBA 4A98A 1D1CA 1YQ4A 2R6GF
chains in the Genus database with same CATH topology
4ZR6A 4QACA 1I9BA 2XQ6A 2M6BA 5HCMA 3UU4A 5J5GA 4F8HA 2X00D 2BYRA 5BRXA 2XQ5A 2WNCA 2W8FA 3RIAA 5HEJA 2BYPA 5HEOA 2XQAA 3U8NA 5AFLA 3ZDGA 4Z90A 2XYTA 4HFIA 3TLWA 4TNWA 4AFTA 3RIFA 4XK9A 2YN6A 2Y57A 4QH4A 4TWDA 5L4HA 3JAEA 3U8MA 4ALXA 5BW2A 4UM3P 4HFEA 4ZRUA 3WTKA 3GUAA 3JAFA 3RI5A 1UW6A 3WTOA 4IREA 3WTJA 2WZYA 3UQ7A 3RQUA 4ZZCA 5AFMB 2BR7A 3U8KA 4DBMA 1UV6A 2LLYA 2MAWA 4TNVA 5AFJA 2XQ7A 3WTHA 2LKHA 2YMEA 5AFMA 2PH9A 3P4WA 4UXUA 4LMKA 2UZ6A 3PEOA 2KSRA 3JADA 4QABA 5KZUA 4UM3S 2Y56A 4HFCA 1OEDB 4NPPA 4X5TA 2XQ3A 3TLUA 4AFHA 3P50A 3UU6A 3T4MA 5HCJA 3UU5A 3WTLA 4ZK1A 4AFGA 5J0ZA 3IGQA 2ZJUA 2XQ9A 2BYQA 4EZ1A 4XHEA 5AFHA 2YMDA 3UU8A 2PGZA 5AFKA 2XNTA 2BG9A 4ILBA 4IL9A 4B5DA 4BQTA 2XNVA 3TLVA 5BP0A 2M6IA 2BG9E 5L47A 4UY2A 4PIRA 3TLSA 4LMJA 4LMLA 4ZZBA 4FRRA 3WTIA 4HFBA 3PMZA 4ZK4A 2BR8A 5HEUA 4ILCA 3RQWA 5FJVA 4QAAA 2BG9C 5J5FA 2BYNA 2YKSA 5TVCA 5CO5A 3U8JA 5J5IA 4Z91A 1OEDA 5AINA 4TWHA 5AFNA 5J5HA 3UU3A 2BJ0A 3SIOA 3U8LA 4UM3A 2Y58A 5CFBA 4WV9A 4ZJTA 4HFHA 2Y54A 3UUBA 2WNLA 3UQ4A 3WIPA 4UM1A 2XQ8A 5JMEA 1OEDE 2LKGA 1OEDC 4A97A 5HEHA 2ZJVA 4HQPA 5SYOA 2VL0A 1UX2A 3ZDHA 4D01A 5KE4A 4ZJSA 3EHZA 2WN9A 4TWFA 2X00A 3C84A 2LM2A 2C9TA 2WNJA 3C79A 5LXBA 4HFDA 3SQ6A 4ILAA 4QH1A 3RHWA 3TLTA 3ZKRA 3WTNA 4BFQA 2XYSA 2YOEA 3WTMA 4COFA 4IL4A 2BG9B 3EI0A 4QH5A 2W8GA 2XZ6A 5IUXA 3SH1A 3EAMA 3LSVA 5LG3A 4A98A 5L4EA 2QC1B 2BYSA 3SQ9A 2XQ4A 4NZBA 2Y7YA 2XZ5A 5HEGA 2XNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZR6 A;  4QAC A;  1I9B A;  2XQ6 A;  2M6B A;  5HCM A;  3UU4 A;  5J5G A;  4F8H A;  2X00 D;  2BYR A;  5BRX A;  2XQ5 A;  2WNC A;  2W8F A;  3RIA A;  5HEJ A;  2BYP A;  5HEO A;  2XQA A;  3U8N A;  5AFL A;  3ZDG A;  4Z90 A;  2XYT A;  4HFI A;  3TLW A;  4TNW A;  4AFT A;  3RIF A;  4XK9 A;  2YN6 A;  2Y57 A;  4QH4 A;  4TWD A;  5L4H A;  3JAE A;  3U8M A;  4ALX A;  5BW2 A;  4UM3 P;  4HFE A;  4ZRU A;  3WTK A;  3GUA A;  3JAF A;  3RI5 A;  1UW6 A;  3WTO A;  4IRE A;  3WTJ A;  2WZY A;  3UQ7 A;  3RQU A;  4ZZC A;  5AFM B;  2BR7 A;  3U8K A;  4DBM A;  1UV6 A;  2LLY A;  2MAW A;  4TNV A;  5AFJ A;  2XQ7 A;  3WTH A;  2LKH A;  2YME A;  5AFM A;  2PH9 A;  3P4W A;  4UXU A;  4LMK A;  2UZ6 A;  3PEO A;  2KSR A;  3JAD A;  4QAB A;  5KZU A;  4UM3 S;  2Y56 A;  4HFC A;  1OED B;  4NPP A;  4X5T A;  2XQ3 A;  3TLU A;  4AFH A;  3P50 A;  3UU6 A;  3T4M A;  5HCJ A;  3UU5 A;  3WTL A;  4ZK1 A;  4AFG A;  5J0Z A;  3IGQ A;  2ZJU A;  2XQ9 A;  2BYQ A;  4EZ1 A;  4XHE A;  5AFH A;  2YMD A;  3UU8 A;  2PGZ A;  5AFK A;  2XNT A;  2BG9 A;  4ILB A;  4IL9 A;  4B5D A;  4BQT A;  2XNV A;  3TLV A;  5BP0 A;  2M6I A;  2BG9 E;  5L47 A;  4UY2 A;  4PIR A;  3TLS A;  4LMJ A;  4LML A;  4ZZB A;  4FRR A;  3WTI A;  4HFB A;  3PMZ A;  4ZK4 A;  2BR8 A;  5HEU A;  4ILC A;  3RQW A;  5FJV A;  4QAA A;  2BG9 C;  5J5F A;  2BYN A;  2YKS A;  5TVC A;  5CO5 A;  3U8J A;  5J5I A;  4Z91 A;  1OED A;  5AIN A;  4TWH A;  5AFN A;  5J5H A;  3UU3 A;  2BJ0 A;  3SIO A;  3U8L A;  4UM3 A;  2Y58 A;  5CFB A;  4WV9 A;  4ZJT A;  4HFH A;  2Y54 A;  3UUB A;  2WNL A;  3UQ4 A;  3WIP A;  4UM1 A;  2XQ8 A;  5JME A;  1OED E;  2LKG A;  1OED C;  4A97 A;  5HEH A;  2ZJV A;  4HQP A;  5SYO A;  2VL0 A;  1UX2 A;  3ZDH A;  4D01 A;  5KE4 A;  4ZJS A;  3EHZ A;  2WN9 A;  4TWF A;  2X00 A;  3C84 A;  2LM2 A;  2C9T A;  2WNJ A;  3C79 A;  5LXB A;  4HFD A;  3SQ6 A;  4ILA A;  4QH1 A;  3RHW A;  3TLT A;  3ZKR A;  3WTN A;  4BFQ A;  2XYS A;  2YOE A;  3WTM A;  4COF A;  4IL4 A;  2BG9 B;  3EI0 A;  4QH5 A;  2W8G A;  2XZ6 A;  5IUX A;  3SH1 A;  3EAM A;  3LSV A;  5LG3 A;  4A98 A;  5L4E A;  2QC1 B;  2BYS A;  3SQ9 A;  2XQ4 A;  4NZB A;  2Y7Y A;  2XZ5 A;  5HEG A;  2XNU A; 
#chains in the Genus database with same CATH topology
 2A3D A;  4ZR6 A;  4P0A A;  2Q9Q D;  2CBJ A;  2CMR A;  3PUZ F;  3A8Y C;  1OWA A;  2JQQ A;  5AQV B;  4KBM B;  2JQH A;  3RIF A;  4XK9 A;  4TWD A;  2LHN A;  3JAE A;  2CXL A;  1QSD A;  2XY8 B;  4EOZ B;  3WTO A;  2X9H A;  3UUM A;  3WTJ A;  4LFA T;  4WBO A;  4UXU A;  4CXW A;  2CM0 A;  2E9X D;  2Y8D A;  1OED B;  3MA9 A;  3PUV F;  1L0V A;  4QHO A;  3I0Q A;  2LM9 A;  1NWM X;  3RRW A;  2XQ9 A;  3OYX A;  2PGZ A;  4IST A;  1O3X A;  3RPU A;  2HPJ A;  4TV9 E;  2MTQ A;  5LMU T;  3FZL B;  5LXT E;  4X20 E;  4PIR A;  3N2K E;  3DJB A;  3Q9D A;  4LFC T;  2D2S A;  3N9L A;  3OJA A;  3PUW F;  3T1Y T;  4YJ2 E;  5AFN A;  4X66 T;  4H9N C;  5AQO B;  4UVC B;  1H7C A;  5LNK A;  4AQG A;  2D0U A;  2JPF A;  2DL1 A;  3EVY A;  4U72 A;  3R6N A;  3A5X A;  4EV6 A;  5HWY A;  3W15 B;  1WFD A;  1HNW T;  1KFY A;  2XYS A;  4V1A v;  4PJJ A;  1VOM A;  1X9B A;  3NRY A;  2RA1 A;  3AE8 A;  1HCI A;  3AA1 B;  5ABG A;  4WZX A;  2E2A A;  3DTO A;  4KMC A;  5H6Q B;  5HWX A;  3ETU A;  5AQG B;  1MNE A;  4L0R A;  4CI3 B;  4AFT A;  1W09 A;  3P7I A;  1AJ3 A;  4PJM A;  2IC6 A;  5AQH B;  4IDZ A;  4HWH A;  3UQ7 A;  4DV7 T;  2WZH A;  5FY0 A;  2PH9 A;  2VVN A;  3AXJ A;  3C64 A;  3N9M A;  3QB5 A;  4JV5 T;  2KND A;  4AFG A;  3VU7 H;  5J0Z A;  2BG9 A;  4BQT A;  1FMV A;  1WYC A;  2IW5 B;  4ZOL E;  4AQF A;  4UY2 A;  3L09 A;  3R84 B;  3PMZ A;  3IHR A;  2AE9 A;  3H3M A;  4B3S T;  4M1P A;  2YKS A;  2C5I T;  2WM9 A;  2UXB T;  3ZYL A;  4E7S A;  4WW0 A;  5JME A;  1OED E;  3ZC1 A;  3PUA A;  4ILU A;  5KE4 A;  5C3J A;  3AAA B;  1MIV A;  1U5P A;  4BA9 A;  3UFG A;  2E8I A;  2CRB A;  5L3C B;  2IC9 A;  4QH5 A;  2XZ6 A;  2UUB T;  1WLX A;  5LGU B;  2CXD A;  3ZPO A;  2WDR A;  5IWA T;  2X0H A;  4GK0 E;  2X0L B;  1MIW A;  2IIU A;  3GA8 A;  4JYA T;  5HEO A;  2V8S V;  2I59 A;  2VQE T;  2L9Q A;  3C98 B;  3AXJ B;  1FIO A;  4A5X A;  3F2E A;  3AED A;  1UW6 A;  1XWM A;  2LKH A;  3CIR A;  2UZ6 A;  5LHI B;  2UXC T;  3CX7 B;  2KWI B;  3E22 E;  4Q25 A;  4NPP A;  2CBI A;  3P4Q A;  4YFS A;  4BJM A;  5ADX L;  3ESL A;  2HHH T;  3NBX X;  2JQK A;  1T8B A;  2QVA A;  2X9X A;  5AQQ B;  4IDO A;  3TLS A;  3ZCJ A;  2XAQ B;  4FRR A;  3ZJ2 A;  4OK0 A;  2BG9 C;  3RC3 A;  4DR6 T;  1UK5 A;  4Z91 A;  2LHR A;  5HYA A;  4UV9 B;  2JIW A;  3LK3 B;  1FJG T;  2XQ8 A;  1NAF A;  1UX2 A;  2K9A A;  4JI3 T;  4QXC B;  3C84 A;  3C79 A;  4KP3 C;  3FBL A;  4EXT A;  5HXH A;  4LF9 T;  3I9Y A;  3S4U A;  2YU2 A;  5L3B B;  3MAC A;  3VR9 A;  5JDN A;  5JR9 C;  4IE4 A;  2PBI A;  5EK2 A;  5FL1 A;  2DHR A;  2XQ6 A;  2M6B A;  3ZMT B;  3SWH A;  4F8H A;  5BRX A;  1W9R A;  2ACZ A;  2YDQ A;  5HEJ A;  5ABF A;  4MLK A;  4DBQ A;  1CHU A;  4TNW A;  3RC8 A;  2YN6 A;  2V5C A;  5ABH A;  2WP9 A;  1T72 A;  4CXX A;  3JAF A;  2C0S A;  4IE7 A;  2W4X A;  2XSB A;  2BR7 A;  2YEV C;  4DR7 T;  3A7M A;  2XQY A;  3M3Z B;  3GMI A;  2Q9Q B;  4LMK A;  3CQX C;  2BS2 A;  4B3M T;  4HFC A;  2JMK A;  4TV8 E;  4UF0 A;  1ZV4 X;  2ZJU A;  4EAH A;  2BYQ A;  5IHY A;  5AFK A;  4IDP A;  3P8C D;  4UEM A;  2BBH A;  5HXE A;  2WZI A;  3IA3 A;  5CA0 E;  4DV3 T;  4LMJ A;  2WU5 A;  3FBZ A;  4U2Y A;  4H9P C;  2BR8 A;  4O2B E;  1XNQ T;  2BYN A;  1SUM B;  4TWH A;  4AKH A;  4UVA B;  5KMG P;  4NUU A;  3C50 A;  2UUA T;  3MJX A;  2ZJV A;  3ONL C;  2X00 A;  3C4Z A;  2LM2 A;  3NWI A;  2CWY A;  1Y01 A;  4QH1 A;  1DU2 A;  5FXW A;  3AE6 A;  2WB5 A;  4YT0 A;  3BQI A;  1OXZ A;  3I1A A;  2LEH A;  5J5G A;  2J47 A;  2IAK A;  4IT4 A;  2WNC A;  2CPT A;  5A1L A;  3PV0 F;  2E9X A;  1UUR A;  4A56 A;  2FJA A;  4WBN E;  1UX4 A;  2V6Y B;  3ZDG A;  3AEC A;  4Z8X A;  2WBL A;  3AE5 A;  2LSK A;  4YHH T;  5BW2 A;  4ZRU A;  2V7L A;  4J2C A;  2QGS A;  3RYF E;  4UV8 B;  3N9P A;  3AA6 B;  2N2N A;  4I4T E;  5AFM A;  4DV1 T;  1VCS A;  3ONX A;  1KNR A;  4CN1 A;  3ZST A;  4EEB A;  2BKO A;  4AFH A;  3TLU A;  4O4I E;  1X79 A;  3EDV A;  3QUJ A;  2A9U A;  3ZMZ B;  1IBK T;  4ADZ A;  3CQC B;  2XNT A;  4HWF A;  3Q5X A;  2M67 A;  3VR8 A;  1W0A A;  4ISS A;  5BP0 A;  2M6I A;  5JRE A;  2W63 A;  1YQ3 A;  2WY2 A;  3KVA A;  1E1H B;  5FJV A;  4UF0 B;  4X65 T;  3ANW B;  3WAJ A;  4WNK A;  3AEB A;  1OED A;  2JQ9 A;  3U8L A;  2XJ7 A;  3OBV E;  2DNX A;  2ODU A;  5LHH B;  4X1Y E;  5AQF B;  1ZEE A;  1US7 B;  5J2T E;  4IDN A;  3O4X E;  1WYB A;  2H7O A;  5LBQ B;  4BFQ A;  2E9X B;  2BDE A;  2BVM A;  2W8G A;  1HX1 B;  5LG3 A;  2MYS A;  5CGM A;  2WWU A;  2Y7Y A;  1XNR T;  1M62 A;  5AFU L;  3UUX B;  2XQ5 A;  3LFM A;  5FY7 A;  1IBM T;  3CX8 B;  5AQJ B;  1XZY A;  1ZP0 A;  5LG4 A;  2XQA A;  4ZHQ E;  5KXJ A;  1XMO T;  5AFL A;  3LK2 B;  4MFR A;  1IAP A;  1N32 T;  2WU2 A;  3LG7 A;  3WAK A;  4QH4 A;  4LF7 T;  2KWH A;  3RI5 A;  3PJA A;  4HEA A;  2VKD A;  1D1A A;  4QXB B;  2LT3 A;  2W61 A;  3EUH A;  4KI0 F;  3RKO A;  2XM2 A;  1J5W A;  1IJ6 A;  5JRC A;  3FXD B;  3AE3 A;  5C8Y E;  3F31 A;  5LYJ E;  4ZI3 C;  2LSY A;  4JI0 T;  4CI2 B;  2D5U A;  4YTN A;  3UUN A;  2V1D B;  4YTM A;  4GYS A;  2FUP A;  4CXY A;  4HFB A;  3AE4 A;  2VVS A;  4I55 E;  3AEA A;  3LK4 2;  5J5I A;  4ERR A;  3IBP A;  3HA4 A;  4PAG A;  4QKN A;  3Q2M A;  5BR8 T;  2QYW A;  3ZEF B;  2ZM6 T;  2LKG A;  2GK9 A;  2X0Y A;  3ZLI A;  5L3E B;  4EZH A;  5DQV A;  3SQ6 A;  5JTG A;  3RHW A;  4IL4 A;  4YHJ A;  3RLF F;  3EAM A;  3SQ9 A;  2ACX A;  2HN1 A;  3ZJ1 A;  1KEY A;  1JNR A;  5HEG A;  4PJL A;  4DV0 T;  3PUR A;  2X67 A;  1FEW A;  5FL0 A;  5JDQ A;  2BYP A;  2ODV A;  3LJC A;  2LRK A;  3RIU C;  3ZMU B;  1WR0 A;  2Y57 A;  3J7Y q;  2Q9Q C;  3U8M A;  4F6R C;  5FNV E;  3CX6 B;  2LLY A;  2XQ7 A;  4ASK A;  1B7T A;  2V7I A;  3PEO A;  2HH7 A;  4NXN T;  3KBT A;  2I0M A;  2VKJ A;  3BQL A;  4CN4 A;  1YW0 A;  3UU6 A;  3PU3 A;  4AI6 A;  5FXV A;  2W0G A;  4YSX A;  5JQG E;  4DUY T;  1IZN B;  2I6H A;  4YSY A;  4TZ4 C;  4TN7 B;  1HS7 A;  1WR6 A;  2LE8 A;  3SIO A;  2WNL A;  2V5D A;  5L3D B;  3JC6 D;  3KV5 A;  5FY1 A;  3OPC A;  5FVK A;  3ZSS A;  3M65 A;  2B1E A;  1XDP A;  4HFV A;  2V7J A;  2BBJ A;  2PJQ A;  3V5S A;  2XSA A;  3K8P C;  4U33 A;  2EHO A;  3O9X A;  4AKI A;  2BYS A;  1EZ3 A;  4NZB A;  4HTE A;  4GIW A;  4QAC A;  2UXD T;  1SE7 A;  3UU4 A;  4CQI A;  4DID B;  4IE6 A;  3FB2 A;  4PK5 A;  4U74 A;  4WYV A;  4B3R T;  2XM1 A;  3LBX B;  2DWK A;  5JDG A;  4H63 H;  3JCF A;  1KNP A;  2NW8 A;  3NZQ A;  5H6R B;  4DV6 T;  5F5W A;  5L4H A;  4FJO A;  4ZEY A;  2LJL A;  4UM3 P;  3WTK A;  1KK7 A;  1G8X A;  1UCU A;  2NW9 A;  3CWZ B;  4OYJ A;  2KT9 A;  1LVF A;  2W00 A;  4OFZ A;  5AFJ A;  4O2A E;  2MBG A;  1VRB A;  3AE9 A;  4P0B A;  1BR1 A;  3E0Z A;  5KZU A;  2OV9 A;  2IHR 1;  3AVR A;  3T4M A;  2NP9 A;  2LOP A;  4QWN B;  2BVL A;  4K0K T;  2CEA A;  1MIY A;  1BR2 A;  2QRX A;  5AFH A;  4JI4 T;  1HR0 T;  3KV4 A;  4OYK A;  4P09 A;  2CLY B;  4DR4 T;  3G06 A;  2J1D G;  2YK0 A;  2RPA A;  2K5B B;  4ZK4 A;  4ILC A;  3ZT6 A;  2KIN B;  5F8P A;  5AIN A;  2H89 A;  2XAH B;  3ZYM A;  1YXR A;  3UU3 A;  1HFA A;  2RP4 A;  4LF4 T;  4DBR A;  2Y58 A;  2A72 A;  3UT5 E;  4DR1 T;  4JEH B;  4TWF A;  5LGT B;  3QB5 K;  4DR5 T;  3VKH A;  4JEU B;  4UXN B;  2Y6X A;  3RRC A;  2UUC T;  3PU8 A;  3EAB A;  1W0B A;  4I50 E;  3RIU A;  2FBW A;  4XAX B;  3N9O A;  2LSJ A;  2VKH A;  4PK4 A;  5LHG B;  2V6X A;  3PDY A;  1CUN A;  3U8N A;  3FZH B;  1HNX T;  3C4X A;  1BR0 A;  4ZI2 C;  2BKN A;  2J4G A;  5J2U E;  1S94 A;  4UM3 S;  1HTJ F;  3Q5E A;  2X9W A;  3ZCI A;  4CN6 A;  1KNZ A;  3SOL A;  5C2T A;  3T8O A;  2YMD A;  4ILB A;  5AQI B;  3J9X 1;  3FZF B;  1MMN A;  2AXD S;  3MK7 C;  4C90 A;  5GON E;  3WTI A;  3L39 A;  4QAA A;  4YLH A;  3FZM B;  5TVC A;  3N2G E;  2KMF A;  5ABE A;  5JH7 E;  4UM3 A;  4K0U A;  4CZZ B;  3UQ4 A;  1SA0 E;  4UR9 A;  2QA7 A;  2K48 A;  4HQP A;  3NZP A;  2VK9 A;  4H63 V;  1HF8 A;  4KHZ F;  2YDR A;  2C9T A;  2YU1 A;  1S35 A;  2ES0 A;  5LA6 E;  2LSG A;  2WWV A;  3Q5W A;  4ILA A;  3TLT A;  3SRZ A;  3ZMS B;  1E2A A;  3I0O A;  2X66 A;  5AQL B;  1LKX A;  1R8I A;  3T1H T;  1YKE B;  3AEE A;  1D0Z A;  3VKG A;  4PNI A;  3P4R A;  2WMN A;  3K3O A;  2H7V C;  1UUS A;  4AQY T;  1J5E T;  4G2A A;  5CJ5 A;  4L9I A;  3TLW A;  1I94 T;  4JI1 T;  2XTL A;  4ZZC A;  1ZKE A;  2MAW A;  4TNV A;  2KXP B;  3WTH A;  3QC9 A;  3X1D A;  3AAE B;  3NVO A;  2Z6E A;  2ZMA A;  2E5L T;  3UU5 A;  3WTL A;  3UUL A;  3PJA J;  4JBW F;  4EZ4 A;  2JMH A;  1MND A;  5FVL A;  4HWD A;  3UU8 A;  2X51 A;  4ZS3 A;  2XNV A;  3OTO T;  2KZ7 B;  1IJ5 A;  4AKL A;  4PW8 A;  5LOV E;  3ANW A;  2E9X C;  3DP7 A;  4UIG A;  4AQF C;  5FKY A;  5J5F A;  4HKA A;  5CO5 A;  2DI4 A;  4ZS2 A;  5CFB A;  4ZJT A;  4UM1 A;  5CA1 E;  2EHO C;  3K3Q C;  2WN9 A;  3H3A A;  2WAU A;  3OKQ A;  3Q5D A;  4KUM B;  3KIN B;  3U78 A;  2IDO B;  3MKD A;  5CB4 E;  1D0X A;  2WDQ A;  3N9N A;  4H9S E;  5HCM A;  4DR3 T;  3D0T A;  1U4Q A;  2C5J A;  1YD8 G;  3HKC E;  2WCA A;  5HAX A;  4X1K E;  4C91 A;  4O4J E;  3RYI E;  4LF6 T;  5AQR B;  4X1I E;  3RQU A;  3C4W A;  4HGA A;  5EK3 A;  3QOF A;  1BR4 A;  4KHP T;  4QAB A;  4NIQ A;  3PUS A;  2XQ3 A;  3P50 A;  2YDS A;  5HCJ A;  2W67 A;  2X9Y A;  1MMD A;  1Z0P A;  4U7I A;  2CHO A;  2EHO B;  4IDQ A;  5FXZ A;  4IIJ E;  3TLV A;  1HNZ T;  1XDO A;  3ONJ A;  4IE0 A;  4H9O C;  1ZOY A;  3B13 A;  4QX7 B;  2K3W A;  4AKG A;  2UXX B;  4UVB B;  3EDU A;  4EYU A;  2NTX A;  4EIW A;  2IUB A;  1OED C;  1Z8U A;  4PJN A;  4GYR A;  2P9B A;  2WDV A;  3H37 A;  2OA5 A;  2X68 A;  4JI2 T;  4YSZ A;  2NTY A;  1SHZ C;  2Q9Q A;  5LCY A;  5LB7 B;  3N5L A;  5JDL A;  5E0O A;  4BJN A;  2QC1 B;  2XQ4 A;  3HI2 A;  3AA7 B;  1N36 T;  2IML A;  1IBL T;  3RYC E;  3RX6 A;  2BYR A;  4GKK T;  2W8F A;  5F3J A;  4QX8 B;  2XYT A;  4PFO A;  3ZC0 A;  2PFV A;  1FMW A;  4HWC A;  2A2F X;  3P4S A;  2W62 A;  4ALX A;  5LMN T;  5L2L A;  3GN5 A;  4X62 T;  2XAS B;  3AE7 A;  2HPL A;  3P4W A;  2MOZ A;  1D1B A;  4DVD A;  2UU9 T;  4DMW A;  2Y56 A;  3E08 A;  4ZI2 D;  3GWH A;  2XAJ B;  5AQM B;  5LJM A;  4AIS A;  4LF8 T;  3SFE A;  4B6X A;  4B5D A;  5IYZ E;  4IGU A;  2XUE A;  2D9D A;  5L47 A;  2ZM8 A;  5L3G B;  4DV5 T;  4ZI3 D;  3RH3 A;  3CPZ A;  4OHF A;  4TUY E;  3U8J A;  3HR0 A;  4IHJ E;  3HKD E;  2Y54 A;  3PUY F;  2LRL A;  4AXP A;  4A97 A;  4TX5 A;  5EZY E;  2NR4 A;  3ZDH A;  3KV9 A;  5LXB A;  2FJD A;  2XZE A;  3ZKR A;  5HXC A;  2XHE B;  5JR9 B;  3CK6 A;  4JI7 T;  2YOE A;  3KDS E;  2BG9 B;  2F4V T;  1J1J A;  5L4E A;  4FI5 A;  3V5U A;  2XZ5 A;  4JI6 T;  4HE8 A;  5BMV E;  4GK5 E;  2X00 D;  3ETV A;  3NRX A;  2FJB A;  3AB3 B;  3AEF A;  1I6Z A;  1GQE A;  5AQN B;  3CML A;  3I9W A;  3ZMV B;  3AEG A;  4YJ3 E;  4UEL A;  3ZN0 B;  2E5V A;  3CVR A;  4MHC A;  1UV6 A;  5LBM A;  2YME A;  4NXM T;  1MMG A;  4X64 T;  5LJN A;  1WCR A;  4G63 A;  4EZ1 A;  4AIU A;  4IL9 A;  4LF5 T;  5EK4 A;  4HN9 A;  4H9R C;  1HG5 A;  3OYZ A;  3MZK B;  5AQT B;  2WSS V;  3KFW X;  2WQY A;  5HEU A;  3VHL A;  1N34 T;  3RQW A;  1NEN A;  3OVU A;  4DV2 T;  3VRB A;  2CCQ A;  2UXN B;  5AQP B;  4HFH A;  3AVS A;  3WIP A;  2K24 A;  2KLQ A;  1N33 T;  3P4P A;  5L3F B;  5SYO A;  3N2O A;  4ZJS A;  5DAB A;  2VL8 A;  3L3P A;  4O8S A;  3WTN A;  2XPK A;  4COF A;  2HN2 A;  1NEK A;  3LSV A;  1WRD A;  2C5K T;  4JI5 T;  3O1H A;  1HX8 A;  2VKO A;  4YTP A;  1I9B A;  3ZN1 B;  5FYM A;  1QLB A;  3F57 A;  4YXD A;  3MXZ A;  3RIA A;  1ZHC A;  4Z90 A;  3BQK A;  5M4Y A;  3RKG A;  2CLY C;  1Y64 B;  5TAO A;  5FMN A;  1G73 A;  4IRE A;  3B57 A;  2WZY A;  4QXH B;  2JRK A;  5FP3 A;  2N9D A;  4HWI B;  4B3T T;  5HXS A;  3C51 A;  3IGQ A;  5KX5 E;  1QUU A;  5JDF A;  2BS4 A;  2OLT A;  4ANJ A;  4GOU A;  1M7K A;  3ZYK A;  4O4L E;  2BG9 E;  4DND A;  2XAF B;  2VB6 A;  3PTR B;  1MMA A;  4KX6 A;  3HL6 A;  4IE5 A;  5AQS B;  3UUB A;  5JDM A;  4JUY A;  4DV4 T;  3AA0 B;  4U31 A;  4JLE A;  3EHZ A;  1XMQ T;  4I43 B;  1KF6 A;  3K1S A;  4HFD A;  2CHN A;  2CXF A;  1T7S A;  4JI8 T;  3CQG B;  2ZM0 A;  2CWO A;  5ABF B;  2W2U A;  3WTM A;  1UX5 A;  2V7M A;  2V26 A;  3U3I A;  1T98 A;  3ABV A;  4U2Z A;  2G0U A;  3O1I A;  3FZK B;  5HXR A;  2W66 A;  3PUG A;  1VCT A;  4BAY B;  3O1J A;  3UFE A;  4DO0 A;  5AQK B;  4DUZ T;  4OX9 T;  2SPC A;  2BZB A;  4O4H E;  2H3R A;  2ZLY A;  4HFE A;  5JVD E;  2V7K A;  3VRA A;  5AFM B;  1LVK A;  4DBM A;  4MAL A;  3FXE B;  2NW7 A;  5JR9 A;  2KSR A;  3JAD A;  2DCF A;  2WS3 A;  4X5T A;  3TKL B;  4U3C A;  2NOX A;  3JC6 C;  4ZK1 A;  3ZT7 A;  3HKB E;  3NKZ A;  3IEE A;  2V6Y A;  4XHE A;  2JJ9 A;  3LDQ B;  5FXX A;  4LFB T;  2CE7 A;  2B76 A;  4ZXL A;  4ZZB A;  4P1N A;  5JRC B;  2CA5 A;  5DJQ C;  4DR2 T;  1V9D A;  2L3L A;  4DMV A;  4E7Z A;  3IF8 B;  5J5H A;  3K3N A;  3RYH E;  4EED A;  3KVB A;  3PUQ A;  2BJ0 A;  4WV9 A;  2BS3 A;  3SS1 A;  2J62 A;  2BKP A;  1E7P A;  4D01 A;  3L8R A;  1YKH B;  5JDH A;  2WNJ A;  3AAI A;  4AKR B;  4L5G A;  5KDM C;  4GKJ T;  1HG2 A;  3SFD A;  4XZC A;  5LGN B;  3QNU A;  4EYY R;  3QK6 A;  2EHO D;  3SH1 A;  3GN5 B;  4EGW A;  4I0U A;  3PUX F;  2XNU A;  4NUV A;  3BK9 A;  2VUR A;  5J1G A;  2VQF T;  2WMO A;  2DWG A;  2LOS A;  3HKE E;  4CI1 B;  3CKD A;  1LRZ A;  3RF1 A;  3PE0 A;  4HFI A;  4H9Q C;  2L8K A;  2YIN A;  4XBF B;  2XAG B;  3GUA A;  3FHN A;  2H88 A;  3U8K A;  2PTF A;  4EB6 E;  5AQU B;  3ZT5 A;  1D0Y A;  2LSI A;  3RGL A;  4YY3 T;  2DLR A;  3LBX A;  2MPK A;  4U7Y A;  3UTK A;  2FJE A;  1UGO A;  2Y48 B;  1JNZ A;  4LML A;  2PG8 A;  2VWA A;  2D0T A;  2ZM2 A;  3AE2 A;  3B5M A;  4PK6 A;  4N78 D;  4ZI7 E;  3KV6 A;  3AE1 A;  5HEH A;  2VL0 A;  3WI3 A;  3KBU A;  2VAS A;  5DQW A;  5LP6 E;  3N9Q A;  4PFP A;  4MBQ A;  2N1G A;  5ETW A;  3EI0 A;  5IUX A;  2NWB A;  4A98 A;  1D1C A;  1YQ4 A;  2R6G F; 
#chains in the Genus database with same CATH homology
 4ZR6 A;  4QAC A;  1I9B A;  2XQ6 A;  2M6B A;  5HCM A;  3UU4 A;  5J5G A;  4F8H A;  2X00 D;  2BYR A;  5BRX A;  2XQ5 A;  2WNC A;  2W8F A;  3RIA A;  5HEJ A;  2BYP A;  5HEO A;  2XQA A;  3U8N A;  5AFL A;  3ZDG A;  4Z90 A;  2XYT A;  4HFI A;  3TLW A;  4TNW A;  4AFT A;  3RIF A;  4XK9 A;  2YN6 A;  2Y57 A;  4QH4 A;  4TWD A;  5L4H A;  3JAE A;  3U8M A;  4ALX A;  5BW2 A;  4UM3 P;  4HFE A;  4ZRU A;  3WTK A;  3GUA A;  3JAF A;  3RI5 A;  1UW6 A;  3WTO A;  4IRE A;  3WTJ A;  2WZY A;  3UQ7 A;  3RQU A;  4ZZC A;  5AFM B;  2BR7 A;  3U8K A;  4DBM A;  1UV6 A;  2LLY A;  2MAW A;  4TNV A;  5AFJ A;  2XQ7 A;  3WTH A;  2LKH A;  2YME A;  5AFM A;  2PH9 A;  3P4W A;  4UXU A;  4LMK A;  2UZ6 A;  3PEO A;  2KSR A;  3JAD A;  4QAB A;  5KZU A;  4UM3 S;  2Y56 A;  4HFC A;  1OED B;  4NPP A;  4X5T A;  2XQ3 A;  3TLU A;  4AFH A;  3P50 A;  3UU6 A;  3T4M A;  5HCJ A;  3UU5 A;  3WTL A;  4ZK1 A;  4AFG A;  5J0Z A;  3IGQ A;  2ZJU A;  2XQ9 A;  2BYQ A;  4EZ1 A;  4XHE A;  5AFH A;  2YMD A;  3UU8 A;  2PGZ A;  5AFK A;  2XNT A;  2BG9 A;  4ILB A;  4IL9 A;  4B5D A;  4BQT A;  2XNV A;  3TLV A;  5BP0 A;  2M6I A;  2BG9 E;  5L47 A;  4UY2 A;  4PIR A;  3TLS A;  4LMJ A;  4LML A;  4ZZB A;  4FRR A;  3WTI A;  4HFB A;  3PMZ A;  4ZK4 A;  2BR8 A;  5HEU A;  4ILC A;  3RQW A;  5FJV A;  4QAA A;  2BG9 C;  5J5F A;  2BYN A;  2YKS A;  5TVC A;  5CO5 A;  3U8J A;  5J5I A;  4Z91 A;  1OED A;  5AIN A;  4TWH A;  5AFN A;  5J5H A;  3UU3 A;  2BJ0 A;  3SIO A;  3U8L A;  4UM3 A;  2Y58 A;  5CFB A;  4WV9 A;  4ZJT A;  4HFH A;  2Y54 A;  3UUB A;  2WNL A;  3UQ4 A;  3WIP A;  4UM1 A;  2XQ8 A;  5JME A;  1OED E;  2LKG A;  1OED C;  4A97 A;  5HEH A;  2ZJV A;  4HQP A;  5SYO A;  2VL0 A;  1UX2 A;  3ZDH A;  4D01 A;  5KE4 A;  4ZJS A;  3EHZ A;  2WN9 A;  4TWF A;  2X00 A;  3C84 A;  2LM2 A;  2C9T A;  2WNJ A;  3C79 A;  5LXB A;  4HFD A;  3SQ6 A;  4ILA A;  4QH1 A;  3RHW A;  3TLT A;  3ZKR A;  3WTN A;  4BFQ A;  2XYS A;  2YOE A;  3WTM A;  4COF A;  4IL4 A;  2BG9 B;  3EI0 A;  4QH5 A;  2W8G A;  2XZ6 A;  5IUX A;  3SH1 A;  3EAM A;  3LSV A;  5LG3 A;  4A98 A;  5L4E A;  2QC1 B;  2BYS A;  3SQ9 A;  2XQ4 A;  4NZB A;  2Y7Y A;  2XZ5 A;  5HEG A;  2XNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...