3UU4A

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in the crystal in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu4A01
3C84A 4D01A 4TWDA 5L47A 2YKSA 2BYRA 2XQ6A 3RQWA 2WN9A 4UY2A 2WNCA 4UM3P 4IL9A 5J5GA 5AFJA 5J5IA 2YOEA 2XZ6A 4ZRUA 3U8MA 4LMJA 3RIAA 3C79A 5KZUA 4FRRA 3UUBA 5BW2A 4Z91A 4COFA 4UXUA 3ZKRA 4XHEA 2ZJUA 5FJVA 3WTNA 2XQ4A 3UU3A 1I9BA 4AFGA 2BG9C 4A98A 3WTHA 2WNLA 2PH9A 3SQ9A 3P50A 4TWFA 4HFIA 4HFBA 3SH1A 3T4MA 5BP0A 3U8JA 4QAAA 5J5FA 4TWHA 5CFBA 4AFTA 1UW6A 2XYTA 4ZK1A 5L4HA 3UU5A 3WTKA 4ALXA 2XQ9A 5AFNA 4HFCA 2BG9E 2BJ0A 4UM3A 4AFHA 4QH1A 2XNVA 2C9TA 5HEUA 2LKGA 4BQTA 1OEDC 4X5TA 4F8HA 3U8KA 2BR7A 2XQ3A 2BG9B 5HEOA 4ZK4A 5AFMB 3TLSA 3UU4A 5LG3A 4HFEA 2LLYA 3UQ4A 3WTIA 2KSRA 4TNVA 3TLWA 5AINA 4LMKA 2M6IA 5HEJA 2W8FA 2BR8A 3EI0A 3JADA 4B5DA 2XQ7A 2YN6A 4IREA 5BRXA 4ILBA 2XYSA 5IUXA 3UU8A 4EZ1A 1OEDE 2Y56A 3RIFA 3ZDGA 3UQ7A 4ZZBA 2M6BA 2XQAA 4NPPA 4TNWA 5L4EA 2W8GA 2XZ5A 5TVCA 3SIOA 3WIPA 3P4WA 1OEDB 1UX2A 3TLUA 5HEGA 5J5HA 5AFLA 2MAWA 5HCJA 3U8NA 3RHWA 3RI5A 2Y54A 2Y57A 2UZ6A 3U8LA 2XQ8A 4A97A 5SYOA 2X00A 4HFHA 4Z90A 3WTLA 4ILCA 5LXBA 2Y58A 3TLVA 4ILAA 2Y7YA 4UM3S 4NZBA 4IL4A 2ZJVA 3WTOA 4QH5A 3WTMA 5AFKA 4WV9A 3LSVA 2XNUA 3IGQA 3PMZA 5KE4A 4QH4A 5AFMA 2BG9A 3PEOA 2PGZA 3GUAA 2QC1B 5CO5A 2XQ5A 2YMEA 3ZDHA 5JMEA 2LKHA 4PIRA 3WTJA 3JAEA 5HEHA 2BYPA 2WNJA 4LMLA 2BYSA 4UM1A 2WZYA 2BYNA 3EAMA 5HCMA 2XNTA 4ZZCA 2BYQA 4DBMA 4QACA 3SQ6A 4QABA 2YMDA 3JAFA 3TLTA 4XK9A 2LM2A 5AFHA 3EHZA 5J0ZA 1UV6A 4ZJTA 4BFQA 4ZR6A 4ZJSA 4HQPA 1OEDA 3UU6A 4HFDA 2VL0A 2X00D 3RQUA
chains in the Genus database with same CATH superfamily
3C84A 2QA7A 2A72A 4V1Av 4JI5T 4H9RC 2QVAA 3U8MA 4LMJA 1MMDA 2XAJB 5FXXA 2ZLYA 2WSSV 2LE8A 4Z91A 2HN2A 3ZKRA 2ZJUA 2V6YA 2UU9T 5FP3A 4PAGA 5ABFB 2X0HA 2FUPA 4PJLA 2V7JA 5HYAA 2UXXB 2PTFA 1MMGA 5LB7B 5HEUA 4H9OC 2LLYA 5AINA 4PJJA 3AA7B 4L0RA 2D5UA 3B13A 5IUXA 5H6RB 5C3JA 3ZDGA 3V5SA 2JRKA 2CWYA 5LMUT 4LFAT 3OBVE 3TLUA 3LG7A 1IBMT 5ABFA 2UZ6A 2PJQA 5J1GA 3LBXB 2IAKA 5FVKA 2ZM8A 5LXBA 4PFOA 4IDQA 1YKHB 4GIWA 1IAPA 4HEAA 2C0SA 3AE6A 1H7CA 3GUAA 2QC1B 2WU2A 3N5LA 4UF0B 4EAHA 2HPJA 2BYQA 3JC6C 1HS7A 2ACZA 4ZJSA 2JQQA 1OXZA 1ZOYA 4ERRA 3PE0A 4H9SE 3WAKA 1YQ3A 3LBXA 3RF1A 4MFRA 3WTNA 3N9MA 2IHR1 4JLEA 2W0GA 2J1DG 3SQ9A 4KHZF 4HFIA 3RYHE 4UF0A 1XNRT 4EB6E 2XQ9A 4ZXLA 3HKBE 4X5TA 4N78D 4ZK4A 3PUGA 5LNKA 2ZM2A 4ILBA 4EZ1A 2YU2A 1HFAA 1KNPA 4UVAB 4JI2T 2WDRA 5LYJE 2WMOA 5L3BB 4GKJT 4CN6A 3N2OA 4YTPA 2Y54A 4CI2B 4UEMA 2J4GA 4O4JE 4CQIA 3AEFA 5KMGP 4ZOLE 3TLVA 4ILAA 2Q9QD 5LGNB 2W2UA 5KX5E 3AEBA 3AAEB 2E8IA 5FNVE 2YDRA 1R8IA 5CO5A 2CBJA 2JQ9A 1D0XA 3ONXA 3P8CD 2X68A 2DNXA 1BR2A 4QACA 4M1PA 3AEDA 5JR9C 2W4XA 1UV6A 3FXDB 2J47A 2KT9A 3RQUA 4PK4A 4NIQA 2C5JA 3MACA 3AE8A 2WDVA 4NUUA 2ODVA 3WTHA 3QOFA 4PJNA 4UELA 5LA6E 4UVCB 3HKCE 4YTMA 3RRCA 3ESLA 3E22E 3I0OA 2VKDA 3N2KE 1FMWA 2B1EA 4ISTA 2LEHA 3GA8A 3UU5A 2XYTA 3WTKA 4EV6A 5FL1A 3ETUA 1OEDC 3U8KA 5CJ5A 4YXDA 1UCUA 5FY7A 4E7SA 2X0LB 3A5XA 2M6BA 2BS3A 2XZ5A 5L4EA 5TVCA 2NTYA 3CKDA 3AE7A 1LVKA 3IEEA 4AXPA 5AQTB 2MBGA 1WFDA 3O1JA 4AKHA 3E0ZA 2F4VT 2FJDA 2CRBA 1WR0A 5EK2A 3RLFF 4DV5T 5KE4A 2H7VC 1HTJF 3VRAA 3CVRA 4DMVA 4LF4T 3HA4A 2V7KA 2N1GA 4ZZCA 2X51A 4P09A 4DBMA 1BR1A 4P0BA 3PUWF 1WCRA 2VL0A 4JI4T 1KFYA 4TWDA 3SWHA 5L47A 3KDSE 4HWHA 5JH7E 4UM3P 3LFMA 4L5GA 3I1AA 4U7IA 4AFGA 1FEWA 3UUNA 4DUYT 1LVFA 4DR6T 4O2AE 3HL6A 1MMNA 5AQLB 3SH1A 2VL8A 2BVLA 4KHPT 4DR4T 2YDSA 4K0KT 2XNVA 2R6GF 2LKGA 4Z8XA 4F8HA 4C90A 2BG9B 3Q2MA 2K9AA 2VK9A 4U31A 3TLWA 3HKDE 2XYSA 3ZJ1A 3OYXA 2X9YA 3B57A 4PJMA 4TNWA 1NWMX 3J9X1 3HI2A 2UXCT 4ZEYA 4ZI7E 4YFSA 1N36T 5FL0A 3KBTA 2DL1A 3EVYA 3ONJA 3SFEA 3UUXB 4KMCA 2I0MA 4JI3T 4NZBA 5LG4A 3L09A 1US7B 3FHNA 3FXEB 4UXNB 4DNDA 2BG9A 3M65A 3I0QA 5L3CB 2WDQA 2JIWA 2MOZA 4ZI3C 5JDNA 5AFHA 3F2EA 1FIOA 1SA0E 5FXVA 2Q9QB 2CHOA 2E2AA 1U5PA 2V1DB 2KMFA 2YOEA 3KVBA 4X1KE 4ZI3D 4IIJE 4YT0A 3ZYMA 5JDHA 3RKGA 2W00A 3RC8A 5DJQC 3UFEA 3RYFE 4HFBA 3K3QC 5J5FA 2VVNA 3KFWX 5AQOB 3NRYA 4HFCA 3FZKB 2YK0A 3FBZA 3D0TA 4OHFA 4YHJA 4I55E 5H6QB 4TNVA 4YJ2E 2Q9QA 2DCFA 3VR8A 2W8FA 4X1IE 2YN6A 4HGAA 4DBQA 2XSBA 1EZ3A 4UR9A 4NPPA 5DABA 4GYRA 2SPCA 3W15B 3Q9DA 3RI5A 3WI3A 3N2GE 3OPCA 5L3FB 4IDZA 3RX6A 1MIWA 3KVAA 4F6RC 4BAYB 3LSVA 4U74A 2B76A 3AE1A 3CWZB 3PEOA 3C4WA 3ZMVB 2X9WA 1VCSA 4BJMA 2BKNA 4IE6A 2V8SV 2CE7A 5ETWA 2MPKA 3A7MA 2JQKA 4B3TT 1HF8A 1S94A 4QX8B 4ZR6A 3GN5B 4HWIB 3KBUA 3PURA 1J5ET 3EABA 4YLHA 2WBLA 3CPZA 3L3PA 4P1NA 3N9LA 2WN9A 4OK0A 2MTQA 3DTOA 2HN1A 5AQNB 2H88A 4U3CA 2KZ7B 5JQGE 2BZBA 2Y6XA 4PW8A 4X20E 4HKAA 2I59A 4LF6T 2CHNA 4AISA 2VWAA 4TUYE 1LKXA 4O2BE 4QAAA 4TWHA 2V5CA 3NKZA 1W09A 2XM1A 2BKOA 2KWHA 2KXPB 3UULA 4DBRA 2MYSA 4ZHQE 2LSYA 2VKOA 1X9BA 5FMNA 3SOLA 1UGOA 1UUSA 2YEVC 3UQ7A 4EEDA 2W8GA 5HWYA 2FJEA 4LF5T 4YSYA 2D0TA 5DQWA 4DR2T 5LJMA 3ANWB 2WZIA 5HEGA 2WWUA 3ZMTB 3P4QA 2XAHB 2UUBT 5BMVE 3PJAA 3DP7A 4EGWA 3WTLA 5AQKB 4UM3S 5AFKA 3EUHA 3I9WA 3AAAB 3ZDHA 3WTJA 2X0YA 2WNJA 3IF8B 3EAMA 4H63V 1UX5A 3RH3A 3JAFA 2H89A 3UU6A 3ANWA 3X1DA 2CLYC 1T7SA 3O9XA 3RQWA 1HNXT 2LHNA 3NZQA 4YY3T 5AQQB 4AFHA 1Z0PA 4IE4A 2DI4A 4ILUA 2XQYA 2BG9C 2IC6A 3NVOA 3ZN0B 1HNWT 3EDVA 2BDEA 4HN9A 2X67A 4DR1T 3O1HA 4B3ST 4PK5A 2XSAA 3R6NA 4ZI2D 4DV1T 2UXBT 4U2ZA 3F31A 3UU4A 4DO0A 3WTIA 4C91A 4LMKA 5HWXA 4YJ3E 3UU8A 1G8XA 1OEDE 2Y56A 2JQHA 3CX7B 4YHHT 5HXRA 4X64T 4GKKT 1Y01A 3ZMUB 5AFLA 5EK4A 2MAWA 2P9BA 5IWAT 1KK7A 4Z90A 4IL4A 3N9QA 1JNZA 2NW8A 2W63A 4AIUA 2W66A 2Q9QC 2VQET 2VB6A 2L3LA 4QXBB 4ZS3A 1W0AA 4YSZA 2WAUA 2VKHA 1X79A 5CA0E 3MA9A 5IYZE 1D0ZA 3P4RA 4ANJA 2VKJA 1E7PA 5FVLA 2WCAA 3LK2B 5LOVE 2WNCA 3ZT7A 1KEYA 5FXWA 2CM0A 4IE7A 4UV8B 5KZUA 1UURA 1U4QA 4EXTA 5ABHA 2CMRA 3AE9A 1LRZA 3ETVA 3OTOT 1UW6A 1D1BA 1SUMB 4I0UA 1J5WA 4BQTA 4OFZA 3ZEFB 3PUAA 4DV4T 5AQSB 5AQPB 5HEJA 4IE5A 4DR3T 4WNKA 4O4IE 5A1LA 1J1JA 4XZCA 4EOZB 5HXHA 3P4WA 4E7ZA 2YU1A 3OYZA 5AQMB 3T1HT 1XMQT 4DV6T 4ASKA 4J2CA 4P0AA 2G0UA 3ZCJA 3C51A 1IBKT 1QLBA 4EZHA 2A2FX 2EHOB 5EK3A 4WV9A 4ZS2A 1N34T 4KBMB 4H9NC 5JMEA 3QUJA 2YMEA 3RIUA 3O4XE 4LMLA 4OYJA 4DR7T 3C4XA 4HQPA 4Q25A 5LP6E 4HTEA 2CWOA 4I43B 1WYBA 3PUQA 1QUUA 4EIWA 5BR8T 4WBOA 3UUBA 1ZP0A 2H7OA 3EDUA 2JMHA 2IIUA 2EHOA 2A9UA 4JUYA 2RP4A 2DWKA 4AFTA 3IBPA 4U2YA 5LHIB 3CQGB 1HG5A 2V26A 3PU8A 2XM2A 4HFVA 3OJAA 2WP9A 1T8BA 3C64A 2V7MA 2WMNA 2CLYB 1E2AA 1ZEEA 2LSGA 2XQAA 3E08A 1WLXA 4TX5A 2W67A 2N9DA 3AEGA 5LGUB 2RA1A 1M62A 3U8NA 3CX8B 1SHZC 4DR5T 2UUCT 5LBQB 3WAJA 2BBJA 3MJXA 3K3OA 2K5BB 5CA1E 2JJ9A 3IGQA 4TV8E 4IDNA 4AQYT 3N9OA 3UTKA 2AXDS 2LRLA 3AB3B 1KNRA 4UM1A 3G06A 4U33A 2VASA 4DV0T 2WZHA 3EHZA 4XBFB 3SRZA 2NW9A 2X00D 2IDOB 5AFJA 3NRXA 1DU2A 3U3IA 1YQ4A 4CN4A 4X65T 4UXUA 3UU3A 3AA0B 3VRBA 2CCQA 4EYUA 3L39A 2K48A 2FBWA 3AA6B 4IE0A 2VURA 3O1IA 3T4MA 3U8JA 3LDQB 3OKQA 2OLTA 2D0UA 2ZM6T 3SS1A 2WM9A 5F8PA 4AQFA 5ABEA 4B6XA 5L3GB 2YDQA 4MHCA 3LK3B 5IHYA 5E0OA 3RIFA 4BA9A 1UX2A 3QB5A 4LFCT 2X9HA 4EEBA 2X9XA 3P7IA 4WYVA 3VR9A 5ABGA 5FY1A 4A97A 4JV5T 3AXJB 2Y58A 2ZJVA 3BK9A 4IDPA 2PGZA 4A56A 2XQ5A 1VCTA 1ZV4X 2LKHA 3T8OA 1XZYA 2BYPA 2LOPA 4CXYA 2CBIA 2WZYA 3ZLIA 3H3MA 4H9PC 4NXNT 2OA5A 1MIVA 3Q5XA 4KP3C 3T1YT 1GQEA 5JDLA 1E1HB 2C5IT 4WZXA 2JMKA 4XHEA 4BFQA 2XQ4A 3AXJA 4GYSA 3KINB 3ZC1A 4HWDA 5LHHB 3P50A 4TWFA 2IW5B 3RIUC 3K8PC 3QC9A 3BQLA 2ACXA 5FXZA 1WR6A 2E9XD 2BG9E 3N9PA 3H37A 1Z8UA 1NEKA 1OWAA 2K3WA 3GWHA 4O4HE 3AVSA 1UX4A 3U78A 4JEHB 2VVSA 2Y48B 2FJBA 1Y64B 1S35A 2UXNB 2V7IA 2EHOC 1XDOA 4FI5A 2H3RA 2ES0A 5L3DB 5HXEA 5J5HA 3RHWA 4B3RT 3GN5A 5LGTB 2Y8DA 5JDMA 4H9QC 2XY8B 2XASB 3RC3A 2PG8A 1HG2A 1I6ZA 3HKEE 3FZHB 2LSIA 1M7KA 2EHOD 4XAXB 5L2LA 2HHHT 4QH4A 4FJOA 2V7LA 2WU5A 3ZSTA 3PTRB 3AA1B 4HWCA 2ZMAA 3B5MA 3JAEA 4AKIA 4KX6A 2YINA 3GMIA 2XNTA 4K0UA 5C8YE 3TLTA 2CEAA 4JI0T 5C2TA 2CXFA 5AFNA 4D01A 4B3MT 5AQGB 2HH7A 4L9IA 3AE3A 4A5XA 3QK6A 2V5DA 3K3NA 3AEAA 2W62A 1VRBA 3MKDA 3NWIA 2E5LT 2NP9A 2IUBA 3PUSA 4TV9E 4ZK1A 4ALXA 2GK9A 4QH1A 1V9DA 3FZLB 4JBWF 4ZI2C 3AAIA 4DUZT 4LF8T 3VHLA 3JADA 4B5DA 2XAQB 1XNQT 4NUVA 4DV2T 3KV5A 3SIOA 1UK5A 2K24A 4AI6A 2QRXA 2CXDA 1FMVA 3VU7H 4AKRB 2LJLA 2BKPA 2Y57A 1YKEB 4JEUB 3ZYLA 3M3ZB 1HNZT 2XQ8A 2X00A 4CN1A 5LBMA 1XWMA 5JDFA 2BS2A 1HX8A 3PUVF 4AQFC 4MLKA 4U72A 3C4ZA 4QX7B 3RRWA 1AJ3A 5AQVB 2OV9A 1NENA 3JC6D 5JVDE 3MXZA 3RGLA 2NTXA 3KV6A 5AQIB 3RYIE 1I94T 2BYNA 4DV3T 2YMDA 2LM2A 1JNRA 5HXCA 1W0BA 4HFDA 5AQJB 3C98B 5DQVA 2BYRA 2WS3A 4UY2A 3C50A 1ZHCA 3A8YC 3C79A 2C5KT 2E5VA 5BW2A 1I9BA 3UFGA 4NXMT 2WY2A 3ONLC 4HE8A 4I50E 2RPAA 1HCIA 1WRDA 5AQRB 4TN7B 1YXRA 4CXXA 3ZMSB 5LCYA 2UUAT 3RKOA 2C9TA 2LOSA 5AFMB 4TZ4C 3TLSA 4UVBB 2KSRA 2ZM0A 2KINB 4GK0E 5AQFB 2BR8A 3EI0A 3K1SA 1G73A 2E9XB 3AEEA 5AFUL 2CXLA 3ZYKA 2XTLA 3ABVA 3MZKB 5HAXA 3U8LA 4G2AA 3CIRA 2PFVA 2QGSA 1W9RA 2Y7YA 2FJAA 3WTOA 1D1CA 4I4TE 5AFMA 2IC9A 3V5UA 1VOMA 4WW0A 3MK7C 4PIRA 3FB2A 3BQKA 5ADXL 3P4SA 2BYSA 2DLRA 3RPUA 3H3AA 4CXWA 2XZEA 3JCFA 2W61A 1HR0T 4ZJTA 2E9XA 4MBQA 2YKSA 4GK5E 2XQ6A 1T72A 2LHRA 3CK6A 2VQFT 2NR4A 3QNUA 4QHOA 4QKNA 4COFA 5FJVA 1SE7A 2LM9A 2WNLA 3PUXF 1XMOT 4IDOA 3HR0A 4H63H 5JDQA 1BR0A 2QYWA 3NZPA 4QXHB 4AKGA 2J62A 3LK42 4BJNA 4PK6A 2BVMA 2BR7A 5LXTE 2XQ3A 5HEOA 2HPLA 3RYCE 3ZT5A 2DWGA 1MNEA 5F5WA 1MNDA 4IREA 4QXCB 1IJ5A 4G63A 2KLQA 4ZZBA 4U7YA 1FJGT 4PNIA 3AE5A 5KXJA 2X66A 2XAGB 4MALA 5FYMA 4OYKA 4JI8T 4DMWA 3ZT6A 3IHRA 5JDGA 3ZN1B 4O4LE 5TAOA 4YSXA 3PUZF 2KNDA 2XHEB 3S4UA 3KV4A 4DV7T 2XNUA 3PMZA 5EZYE 2NW7A 3N9NA 2LSKA 4X66T 2LSJA 3PU3A 2L9QA 3AVRA 2WB5A 2M67A 2IMLA 3CQXC 3PV0F 3KV9A 4XK9A 5J2UE 4UIGA 5J0ZA 4WBNE 4KUMB 3SFDA 3J7Yq 4PFPA 4LFBT 4IL9A 5J5GA 5J5IA 2XZ6A 4ZRUA 3FBLA 2Z6EA 3RIAA 1D1AA 4FRRA 3FZMB 4DIDB 2BBHA 2XUEA 3VKHA 4X1YE 3ZC0A 2ODUA 3AE4A 1IBLT 2D9DA 2CA5A 2AE9A 2UXDT 2I6HA 5CFBA 3UUMA 2LRKA 2WWVA 4O8SA 1YD8G 5LG3A 3UQ4A 1N33T 2M6IA 4JI1T 3PDYA 1CUNA 4UV9B 3DJBA 2XQ7A 2JPFA 2XPKA 3ZJ2A 3WIPA 4JYAT 3QB5K 2PBIA 4ADZA 2NWBA 2NOXA 2V6XA 5HCJA 3Q5DA 5J2TE 3TKLB 2XAFB 5LMNT 2D2SA 3L8RA 4HFHA 3ZMZB 2KWIB 2L8KA 5AQHB 1L0VA 1ZKEA 4QH5A 3WTMA 4X62T 4QWNB 4DVDA 1YW0A 4IT4A 3LJCA 5LHGB 3FZFB 5GONE 3Q5WA 3R84B 5HEHA 5JTGA 3CQCB 3AECA 2WQYA 3AE2A 2LT3A 4HWFA 1KNZA 4QABA 3F57A 1IZNB 3P4PA 4EYYR 5LJNA 3BQIA 5AQUB 4YTNA 1HX1B 5KDMC 1KF6A 4LF9T 1T98A 4EZ4A 5JR9B 3ZCIA 3NBXX 3I9YA 1O3XA 3PUYF 1BR4A 4A98A 2PH9A 2BS4A 1N32T 4GOUA 4AQGA 3ZPOA 1IJ6A 3PJAJ 5FKYA 4JI7T 5BP0A 1XDPA 5L4HA 2CPTA 2BJ0A 4UM3A 2E9XC 1CHUA 3CX6B 4HFEA 5JRCB 1MIYA 5BRXA 4CZZB 3ZSSA 1MMAA 1OEDB 2XJ7A 5FY0A 5JR9A 5CB4E 5M4YA 4CI1B 1NAFA 3CMLA 3IA3A 4IHJE 1WYCA 4CI3B 5SYOA 2V6YB 4ILCA 5L3EB 3Q5EA 3OVUA 4LF7T 1QSDA 4ISSA 5CGMA 2A3DA 5F3JA 1B7TA 2N2NA 3UT5E 4OX9T 4JI6T 2DHRA 5JRCA 3VKGA 4AKLA 5HCMA 4KI0F 3SQ6A 5HXSA 1D0YA 5JREA 1OEDA 4IGUA
chains in the Genus database with same CATH topology
3C84A 4D01A 4TWDA 5L47A 2YKSA 2BYRA 2XQ6A 3RQWA 2WN9A 4UY2A 2WNCA 4UM3P 4IL9A 5J5GA 5AFJA 5J5IA 2YOEA 2XZ6A 4ZRUA 3U8MA 4LMJA 3RIAA 3C79A 5KZUA 4FRRA 3UUBA 5BW2A 4Z91A 4COFA 4UXUA 3ZKRA 4XHEA 2ZJUA 5FJVA 3WTNA 2XQ4A 3UU3A 1I9BA 4AFGA 2BG9C 4A98A 3WTHA 2WNLA 2PH9A 3SQ9A 3P50A 4TWFA 4HFIA 4HFBA 3SH1A 3T4MA 5BP0A 3U8JA 4QAAA 5J5FA 4TWHA 5CFBA 4AFTA 1UW6A 2XYTA 4ZK1A 5L4HA 3UU5A 3WTKA 4ALXA 2XQ9A 5AFNA 4HFCA 2BG9E 2BJ0A 4UM3A 4AFHA 4QH1A 2XNVA 2C9TA 5HEUA 2LKGA 4BQTA 1OEDC 4X5TA 4F8HA 3U8KA 2BR7A 2XQ3A 2BG9B 5HEOA 4ZK4A 5AFMB 3TLSA 3UU4A 5LG3A 4HFEA 2LLYA 3UQ4A 3WTIA 2KSRA 4TNVA 3TLWA 5AINA 4LMKA 2M6IA 5HEJA 2W8FA 2BR8A 3EI0A 3JADA 4B5DA 2XQ7A 2YN6A 4IREA 5BRXA 4ILBA 2XYSA 5IUXA 3UU8A 4EZ1A 1OEDE 2Y56A 3RIFA 3ZDGA 3UQ7A 4ZZBA 2M6BA 2XQAA 4NPPA 4TNWA 5L4EA 2W8GA 2XZ5A 5TVCA 3SIOA 3WIPA 3P4WA 1OEDB 1UX2A 3TLUA 5HEGA 5J5HA 5AFLA 2MAWA 5HCJA 3U8NA 3RHWA 3RI5A 2Y54A 2Y57A 2UZ6A 3U8LA 2XQ8A 4A97A 5SYOA 2X00A 4HFHA 4Z90A 3WTLA 4ILCA 5LXBA 2Y58A 3TLVA 4ILAA 2Y7YA 4UM3S 4NZBA 4IL4A 2ZJVA 3WTOA 4QH5A 3WTMA 5AFKA 4WV9A 3LSVA 2XNUA 3IGQA 3PMZA 5KE4A 4QH4A 5AFMA 2BG9A 3PEOA 2PGZA 3GUAA 2QC1B 5CO5A 2XQ5A 2YMEA 3ZDHA 5JMEA 2LKHA 4PIRA 3WTJA 3JAEA 5HEHA 2BYPA 2WNJA 4LMLA 2BYSA 4UM1A 2WZYA 2BYNA 3EAMA 5HCMA 2XNTA 4ZZCA 2BYQA 4DBMA 4QACA 3SQ6A 4QABA 2YMDA 3JAFA 3TLTA 4XK9A 2LM2A 5AFHA 3EHZA 5J0ZA 1UV6A 4ZJTA 4BFQA 4ZR6A 4ZJSA 4HQPA 1OEDA 3UU6A 4HFDA 2VL0A 2X00D 3RQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C84 A;  4D01 A;  4TWD A;  5L47 A;  2YKS A;  2BYR A;  2XQ6 A;  3RQW A;  2WN9 A;  4UY2 A;  2WNC A;  4UM3 P;  4IL9 A;  5J5G A;  5AFJ A;  5J5I A;  2YOE A;  2XZ6 A;  4ZRU A;  3U8M A;  4LMJ A;  3RIA A;  3C79 A;  5KZU A;  4FRR A;  3UUB A;  5BW2 A;  4Z91 A;  4COF A;  4UXU A;  3ZKR A;  4XHE A;  2ZJU A;  5FJV A;  3WTN A;  2XQ4 A;  3UU3 A;  1I9B A;  4AFG A;  2BG9 C;  4A98 A;  3WTH A;  2WNL A;  2PH9 A;  3SQ9 A;  3P50 A;  4TWF A;  4HFI A;  4HFB A;  3SH1 A;  3T4M A;  5BP0 A;  3U8J A;  4QAA A;  5J5F A;  4TWH A;  5CFB A;  4AFT A;  1UW6 A;  2XYT A;  4ZK1 A;  5L4H A;  3UU5 A;  3WTK A;  4ALX A;  2XQ9 A;  5AFN A;  4HFC A;  2BG9 E;  2BJ0 A;  4UM3 A;  4AFH A;  4QH1 A;  2XNV A;  2C9T A;  5HEU A;  2LKG A;  4BQT A;  1OED C;  4X5T A;  4F8H A;  3U8K A;  2BR7 A;  2XQ3 A;  2BG9 B;  5HEO A;  4ZK4 A;  5AFM B;  3TLS A;  3UU4 A;  5LG3 A;  4HFE A;  2LLY A;  3UQ4 A;  3WTI A;  2KSR A;  4TNV A;  3TLW A;  5AIN A;  4LMK A;  2M6I A;  5HEJ A;  2W8F A;  2BR8 A;  3EI0 A;  3JAD A;  4B5D A;  2XQ7 A;  2YN6 A;  4IRE A;  5BRX A;  4ILB A;  2XYS A;  5IUX A;  3UU8 A;  4EZ1 A;  1OED E;  2Y56 A;  3RIF A;  3ZDG A;  3UQ7 A;  4ZZB A;  2M6B A;  2XQA A;  4NPP A;  4TNW A;  5L4E A;  2W8G A;  2XZ5 A;  5TVC A;  3SIO A;  3WIP A;  3P4W A;  1OED B;  1UX2 A;  3TLU A;  5HEG A;  5J5H A;  5AFL A;  2MAW A;  5HCJ A;  3U8N A;  3RHW A;  3RI5 A;  2Y54 A;  2Y57 A;  2UZ6 A;  3U8L A;  2XQ8 A;  4A97 A;  5SYO A;  2X00 A;  4HFH A;  4Z90 A;  3WTL A;  4ILC A;  5LXB A;  2Y58 A;  3TLV A;  4ILA A;  2Y7Y A;  4UM3 S;  4NZB A;  4IL4 A;  2ZJV A;  3WTO A;  4QH5 A;  3WTM A;  5AFK A;  4WV9 A;  3LSV A;  2XNU A;  3IGQ A;  3PMZ A;  5KE4 A;  4QH4 A;  5AFM A;  2BG9 A;  3PEO A;  2PGZ A;  3GUA A;  2QC1 B;  5CO5 A;  2XQ5 A;  2YME A;  3ZDH A;  5JME A;  2LKH A;  4PIR A;  3WTJ A;  3JAE A;  5HEH A;  2BYP A;  2WNJ A;  4LML A;  2BYS A;  4UM1 A;  2WZY A;  2BYN A;  3EAM A;  5HCM A;  2XNT A;  4ZZC A;  2BYQ A;  4DBM A;  4QAC A;  3SQ6 A;  4QAB A;  2YMD A;  3JAF A;  3TLT A;  4XK9 A;  2LM2 A;  5AFH A;  3EHZ A;  5J0Z A;  1UV6 A;  4ZJT A;  4BFQ A;  4ZR6 A;  4ZJS A;  4HQP A;  1OED A;  3UU6 A;  4HFD A;  2VL0 A;  2X00 D;  3RQU A; 
#chains in the Genus database with same CATH topology
 3C84 A;  2QA7 A;  2A72 A;  4V1A v;  4JI5 T;  4H9R C;  2QVA A;  3U8M A;  4LMJ A;  1MMD A;  2XAJ B;  5FXX A;  2ZLY A;  2WSS V;  2LE8 A;  4Z91 A;  2HN2 A;  3ZKR A;  2ZJU A;  2V6Y A;  2UU9 T;  5FP3 A;  4PAG A;  5ABF B;  2X0H A;  2FUP A;  4PJL A;  2V7J A;  5HYA A;  2UXX B;  2PTF A;  1MMG A;  5LB7 B;  5HEU A;  4H9O C;  2LLY A;  5AIN A;  4PJJ A;  3AA7 B;  4L0R A;  2D5U A;  3B13 A;  5IUX A;  5H6R B;  5C3J A;  3ZDG A;  3V5S A;  2JRK A;  2CWY A;  5LMU T;  4LFA T;  3OBV E;  3TLU A;  3LG7 A;  1IBM T;  5ABF A;  2UZ6 A;  2PJQ A;  5J1G A;  3LBX B;  2IAK A;  5FVK A;  2ZM8 A;  5LXB A;  4PFO A;  4IDQ A;  1YKH B;  4GIW A;  1IAP A;  4HEA A;  2C0S A;  3AE6 A;  1H7C A;  3GUA A;  2QC1 B;  2WU2 A;  3N5L A;  4UF0 B;  4EAH A;  2HPJ A;  2BYQ A;  3JC6 C;  1HS7 A;  2ACZ A;  4ZJS A;  2JQQ A;  1OXZ A;  1ZOY A;  4ERR A;  3PE0 A;  4H9S E;  3WAK A;  1YQ3 A;  3LBX A;  3RF1 A;  4MFR A;  3WTN A;  3N9M A;  2IHR 1;  4JLE A;  2W0G A;  2J1D G;  3SQ9 A;  4KHZ F;  4HFI A;  3RYH E;  4UF0 A;  1XNR T;  4EB6 E;  2XQ9 A;  4ZXL A;  3HKB E;  4X5T A;  4N78 D;  4ZK4 A;  3PUG A;  5LNK A;  2ZM2 A;  4ILB A;  4EZ1 A;  2YU2 A;  1HFA A;  1KNP A;  4UVA B;  4JI2 T;  2WDR A;  5LYJ E;  2WMO A;  5L3B B;  4GKJ T;  4CN6 A;  3N2O A;  4YTP A;  2Y54 A;  4CI2 B;  4UEM A;  2J4G A;  4O4J E;  4CQI A;  3AEF A;  5KMG P;  4ZOL E;  3TLV A;  4ILA A;  2Q9Q D;  5LGN B;  2W2U A;  5KX5 E;  3AEB A;  3AAE B;  2E8I A;  5FNV E;  2YDR A;  1R8I A;  5CO5 A;  2CBJ A;  2JQ9 A;  1D0X A;  3ONX A;  3P8C D;  2X68 A;  2DNX A;  1BR2 A;  4QAC A;  4M1P A;  3AED A;  5JR9 C;  2W4X A;  1UV6 A;  3FXD B;  2J47 A;  2KT9 A;  3RQU A;  4PK4 A;  4NIQ A;  2C5J A;  3MAC A;  3AE8 A;  2WDV A;  4NUU A;  2ODV A;  3WTH A;  3QOF A;  4PJN A;  4UEL A;  5LA6 E;  4UVC B;  3HKC E;  4YTM A;  3RRC A;  3ESL A;  3E22 E;  3I0O A;  2VKD A;  3N2K E;  1FMW A;  2B1E A;  4IST A;  2LEH A;  3GA8 A;  3UU5 A;  2XYT A;  3WTK A;  4EV6 A;  5FL1 A;  3ETU A;  1OED C;  3U8K A;  5CJ5 A;  4YXD A;  1UCU A;  5FY7 A;  4E7S A;  2X0L B;  3A5X A;  2M6B A;  2BS3 A;  2XZ5 A;  5L4E A;  5TVC A;  2NTY A;  3CKD A;  3AE7 A;  1LVK A;  3IEE A;  4AXP A;  5AQT B;  2MBG A;  1WFD A;  3O1J A;  4AKH A;  3E0Z A;  2F4V T;  2FJD A;  2CRB A;  1WR0 A;  5EK2 A;  3RLF F;  4DV5 T;  5KE4 A;  2H7V C;  1HTJ F;  3VRA A;  3CVR A;  4DMV A;  4LF4 T;  3HA4 A;  2V7K A;  2N1G A;  4ZZC A;  2X51 A;  4P09 A;  4DBM A;  1BR1 A;  4P0B A;  3PUW F;  1WCR A;  2VL0 A;  4JI4 T;  1KFY A;  4TWD A;  3SWH A;  5L47 A;  3KDS E;  4HWH A;  5JH7 E;  4UM3 P;  3LFM A;  4L5G A;  3I1A A;  4U7I A;  4AFG A;  1FEW A;  3UUN A;  4DUY T;  1LVF A;  4DR6 T;  4O2A E;  3HL6 A;  1MMN A;  5AQL B;  3SH1 A;  2VL8 A;  2BVL A;  4KHP T;  4DR4 T;  2YDS A;  4K0K T;  2XNV A;  2R6G F;  2LKG A;  4Z8X A;  4F8H A;  4C90 A;  2BG9 B;  3Q2M A;  2K9A A;  2VK9 A;  4U31 A;  3TLW A;  3HKD E;  2XYS A;  3ZJ1 A;  3OYX A;  2X9Y A;  3B57 A;  4PJM A;  4TNW A;  1NWM X;  3J9X 1;  3HI2 A;  2UXC T;  4ZEY A;  4ZI7 E;  4YFS A;  1N36 T;  5FL0 A;  3KBT A;  2DL1 A;  3EVY A;  3ONJ A;  3SFE A;  3UUX B;  4KMC A;  2I0M A;  4JI3 T;  4NZB A;  5LG4 A;  3L09 A;  1US7 B;  3FHN A;  3FXE B;  4UXN B;  4DND A;  2BG9 A;  3M65 A;  3I0Q A;  5L3C B;  2WDQ A;  2JIW A;  2MOZ A;  4ZI3 C;  5JDN A;  5AFH A;  3F2E A;  1FIO A;  1SA0 E;  5FXV A;  2Q9Q B;  2CHO A;  2E2A A;  1U5P A;  2V1D B;  2KMF A;  2YOE A;  3KVB A;  4X1K E;  4ZI3 D;  4IIJ E;  4YT0 A;  3ZYM A;  5JDH A;  3RKG A;  2W00 A;  3RC8 A;  5DJQ C;  3UFE A;  3RYF E;  4HFB A;  3K3Q C;  5J5F A;  2VVN A;  3KFW X;  5AQO B;  3NRY A;  4HFC A;  3FZK B;  2YK0 A;  3FBZ A;  3D0T A;  4OHF A;  4YHJ A;  4I55 E;  5H6Q B;  4TNV A;  4YJ2 E;  2Q9Q A;  2DCF A;  3VR8 A;  2W8F A;  4X1I E;  2YN6 A;  4HGA A;  4DBQ A;  2XSB A;  1EZ3 A;  4UR9 A;  4NPP A;  5DAB A;  4GYR A;  2SPC A;  3W15 B;  3Q9D A;  3RI5 A;  3WI3 A;  3N2G E;  3OPC A;  5L3F B;  4IDZ A;  3RX6 A;  1MIW A;  3KVA A;  4F6R C;  4BAY B;  3LSV A;  4U74 A;  2B76 A;  3AE1 A;  3CWZ B;  3PEO A;  3C4W A;  3ZMV B;  2X9W A;  1VCS A;  4BJM A;  2BKN A;  4IE6 A;  2V8S V;  2CE7 A;  5ETW A;  2MPK A;  3A7M A;  2JQK A;  4B3T T;  1HF8 A;  1S94 A;  4QX8 B;  4ZR6 A;  3GN5 B;  4HWI B;  3KBU A;  3PUR A;  1J5E T;  3EAB A;  4YLH A;  2WBL A;  3CPZ A;  3L3P A;  4P1N A;  3N9L A;  2WN9 A;  4OK0 A;  2MTQ A;  3DTO A;  2HN1 A;  5AQN B;  2H88 A;  4U3C A;  2KZ7 B;  5JQG E;  2BZB A;  2Y6X A;  4PW8 A;  4X20 E;  4HKA A;  2I59 A;  4LF6 T;  2CHN A;  4AIS A;  2VWA A;  4TUY E;  1LKX A;  4O2B E;  4QAA A;  4TWH A;  2V5C A;  3NKZ A;  1W09 A;  2XM1 A;  2BKO A;  2KWH A;  2KXP B;  3UUL A;  4DBR A;  2MYS A;  4ZHQ E;  2LSY A;  2VKO A;  1X9B A;  5FMN A;  3SOL A;  1UGO A;  1UUS A;  2YEV C;  3UQ7 A;  4EED A;  2W8G A;  5HWY A;  2FJE A;  4LF5 T;  4YSY A;  2D0T A;  5DQW A;  4DR2 T;  5LJM A;  3ANW B;  2WZI A;  5HEG A;  2WWU A;  3ZMT B;  3P4Q A;  2XAH B;  2UUB T;  5BMV E;  3PJA A;  3DP7 A;  4EGW A;  3WTL A;  5AQK B;  4UM3 S;  5AFK A;  3EUH A;  3I9W A;  3AAA B;  3ZDH A;  3WTJ A;  2X0Y A;  2WNJ A;  3IF8 B;  3EAM A;  4H63 V;  1UX5 A;  3RH3 A;  3JAF A;  2H89 A;  3UU6 A;  3ANW A;  3X1D A;  2CLY C;  1T7S A;  3O9X A;  3RQW A;  1HNX T;  2LHN A;  3NZQ A;  4YY3 T;  5AQQ B;  4AFH A;  1Z0P A;  4IE4 A;  2DI4 A;  4ILU A;  2XQY A;  2BG9 C;  2IC6 A;  3NVO A;  3ZN0 B;  1HNW T;  3EDV A;  2BDE A;  4HN9 A;  2X67 A;  4DR1 T;  3O1H A;  4B3S T;  4PK5 A;  2XSA A;  3R6N A;  4ZI2 D;  4DV1 T;  2UXB T;  4U2Z A;  3F31 A;  3UU4 A;  4DO0 A;  3WTI A;  4C91 A;  4LMK A;  5HWX A;  4YJ3 E;  3UU8 A;  1G8X A;  1OED E;  2Y56 A;  2JQH A;  3CX7 B;  4YHH T;  5HXR A;  4X64 T;  4GKK T;  1Y01 A;  3ZMU B;  5AFL A;  5EK4 A;  2MAW A;  2P9B A;  5IWA T;  1KK7 A;  4Z90 A;  4IL4 A;  3N9Q A;  1JNZ A;  2NW8 A;  2W63 A;  4AIU A;  2W66 A;  2Q9Q C;  2VQE T;  2VB6 A;  2L3L A;  4QXB B;  4ZS3 A;  1W0A A;  4YSZ A;  2WAU A;  2VKH A;  1X79 A;  5CA0 E;  3MA9 A;  5IYZ E;  1D0Z A;  3P4R A;  4ANJ A;  2VKJ A;  1E7P A;  5FVL A;  2WCA A;  3LK2 B;  5LOV E;  2WNC A;  3ZT7 A;  1KEY A;  5FXW A;  2CM0 A;  4IE7 A;  4UV8 B;  5KZU A;  1UUR A;  1U4Q A;  4EXT A;  5ABH A;  2CMR A;  3AE9 A;  1LRZ A;  3ETV A;  3OTO T;  1UW6 A;  1D1B A;  1SUM B;  4I0U A;  1J5W A;  4BQT A;  4OFZ A;  3ZEF B;  3PUA A;  4DV4 T;  5AQS B;  5AQP B;  5HEJ A;  4IE5 A;  4DR3 T;  4WNK A;  4O4I E;  5A1L A;  1J1J A;  4XZC A;  4EOZ B;  5HXH A;  3P4W A;  4E7Z A;  2YU1 A;  3OYZ A;  5AQM B;  3T1H T;  1XMQ T;  4DV6 T;  4ASK A;  4J2C A;  4P0A A;  2G0U A;  3ZCJ A;  3C51 A;  1IBK T;  1QLB A;  4EZH A;  2A2F X;  2EHO B;  5EK3 A;  4WV9 A;  4ZS2 A;  1N34 T;  4KBM B;  4H9N C;  5JME A;  3QUJ A;  2YME A;  3RIU A;  3O4X E;  4LML A;  4OYJ A;  4DR7 T;  3C4X A;  4HQP A;  4Q25 A;  5LP6 E;  4HTE A;  2CWO A;  4I43 B;  1WYB A;  3PUQ A;  1QUU A;  4EIW A;  5BR8 T;  4WBO A;  3UUB A;  1ZP0 A;  2H7O A;  3EDU A;  2JMH A;  2IIU A;  2EHO A;  2A9U A;  4JUY A;  2RP4 A;  2DWK A;  4AFT A;  3IBP A;  4U2Y A;  5LHI B;  3CQG B;  1HG5 A;  2V26 A;  3PU8 A;  2XM2 A;  4HFV A;  3OJA A;  2WP9 A;  1T8B A;  3C64 A;  2V7M A;  2WMN A;  2CLY B;  1E2A A;  1ZEE A;  2LSG A;  2XQA A;  3E08 A;  1WLX A;  4TX5 A;  2W67 A;  2N9D A;  3AEG A;  5LGU B;  2RA1 A;  1M62 A;  3U8N A;  3CX8 B;  1SHZ C;  4DR5 T;  2UUC T;  5LBQ B;  3WAJ A;  2BBJ A;  3MJX A;  3K3O A;  2K5B B;  5CA1 E;  2JJ9 A;  3IGQ A;  4TV8 E;  4IDN A;  4AQY T;  3N9O A;  3UTK A;  2AXD S;  2LRL A;  3AB3 B;  1KNR A;  4UM1 A;  3G06 A;  4U33 A;  2VAS A;  4DV0 T;  2WZH A;  3EHZ A;  4XBF B;  3SRZ A;  2NW9 A;  2X00 D;  2IDO B;  5AFJ A;  3NRX A;  1DU2 A;  3U3I A;  1YQ4 A;  4CN4 A;  4X65 T;  4UXU A;  3UU3 A;  3AA0 B;  3VRB A;  2CCQ A;  4EYU A;  3L39 A;  2K48 A;  2FBW A;  3AA6 B;  4IE0 A;  2VUR A;  3O1I A;  3T4M A;  3U8J A;  3LDQ B;  3OKQ A;  2OLT A;  2D0U A;  2ZM6 T;  3SS1 A;  2WM9 A;  5F8P A;  4AQF A;  5ABE A;  4B6X A;  5L3G B;  2YDQ A;  4MHC A;  3LK3 B;  5IHY A;  5E0O A;  3RIF A;  4BA9 A;  1UX2 A;  3QB5 A;  4LFC T;  2X9H A;  4EEB A;  2X9X A;  3P7I A;  4WYV A;  3VR9 A;  5ABG A;  5FY1 A;  4A97 A;  4JV5 T;  3AXJ B;  2Y58 A;  2ZJV A;  3BK9 A;  4IDP A;  2PGZ A;  4A56 A;  2XQ5 A;  1VCT A;  1ZV4 X;  2LKH A;  3T8O A;  1XZY A;  2BYP A;  2LOP A;  4CXY A;  2CBI A;  2WZY A;  3ZLI A;  3H3M A;  4H9P C;  4NXN T;  2OA5 A;  1MIV A;  3Q5X A;  4KP3 C;  3T1Y T;  1GQE A;  5JDL A;  1E1H B;  2C5I T;  4WZX A;  2JMK A;  4XHE A;  4BFQ A;  2XQ4 A;  3AXJ A;  4GYS A;  3KIN B;  3ZC1 A;  4HWD A;  5LHH B;  3P50 A;  4TWF A;  2IW5 B;  3RIU C;  3K8P C;  3QC9 A;  3BQL A;  2ACX A;  5FXZ A;  1WR6 A;  2E9X D;  2BG9 E;  3N9P A;  3H37 A;  1Z8U A;  1NEK A;  1OWA A;  2K3W A;  3GWH A;  4O4H E;  3AVS A;  1UX4 A;  3U78 A;  4JEH B;  2VVS A;  2Y48 B;  2FJB A;  1Y64 B;  1S35 A;  2UXN B;  2V7I A;  2EHO C;  1XDO A;  4FI5 A;  2H3R A;  2ES0 A;  5L3D B;  5HXE A;  5J5H A;  3RHW A;  4B3R T;  3GN5 A;  5LGT B;  2Y8D A;  5JDM A;  4H9Q C;  2XY8 B;  2XAS B;  3RC3 A;  2PG8 A;  1HG2 A;  1I6Z A;  3HKE E;  3FZH B;  2LSI A;  1M7K A;  2EHO D;  4XAX B;  5L2L A;  2HHH T;  4QH4 A;  4FJO A;  2V7L A;  2WU5 A;  3ZST A;  3PTR B;  3AA1 B;  4HWC A;  2ZMA A;  3B5M A;  3JAE A;  4AKI A;  4KX6 A;  2YIN A;  3GMI A;  2XNT A;  4K0U A;  5C8Y E;  3TLT A;  2CEA A;  4JI0 T;  5C2T A;  2CXF A;  5AFN A;  4D01 A;  4B3M T;  5AQG B;  2HH7 A;  4L9I A;  3AE3 A;  4A5X A;  3QK6 A;  2V5D A;  3K3N A;  3AEA A;  2W62 A;  1VRB A;  3MKD A;  3NWI A;  2E5L T;  2NP9 A;  2IUB A;  3PUS A;  4TV9 E;  4ZK1 A;  4ALX A;  2GK9 A;  4QH1 A;  1V9D A;  3FZL B;  4JBW F;  4ZI2 C;  3AAI A;  4DUZ T;  4LF8 T;  3VHL A;  3JAD A;  4B5D A;  2XAQ B;  1XNQ T;  4NUV A;  4DV2 T;  3KV5 A;  3SIO A;  1UK5 A;  2K24 A;  4AI6 A;  2QRX A;  2CXD A;  1FMV A;  3VU7 H;  4AKR B;  2LJL A;  2BKP A;  2Y57 A;  1YKE B;  4JEU B;  3ZYL A;  3M3Z B;  1HNZ T;  2XQ8 A;  2X00 A;  4CN1 A;  5LBM A;  1XWM A;  5JDF A;  2BS2 A;  1HX8 A;  3PUV F;  4AQF C;  4MLK A;  4U72 A;  3C4Z A;  4QX7 B;  3RRW A;  1AJ3 A;  5AQV B;  2OV9 A;  1NEN A;  3JC6 D;  5JVD E;  3MXZ A;  3RGL A;  2NTX A;  3KV6 A;  5AQI B;  3RYI E;  1I94 T;  2BYN A;  4DV3 T;  2YMD A;  2LM2 A;  1JNR A;  5HXC A;  1W0B A;  4HFD A;  5AQJ B;  3C98 B;  5DQV A;  2BYR A;  2WS3 A;  4UY2 A;  3C50 A;  1ZHC A;  3A8Y C;  3C79 A;  2C5K T;  2E5V A;  5BW2 A;  1I9B A;  3UFG A;  4NXM T;  2WY2 A;  3ONL C;  4HE8 A;  4I50 E;  2RPA A;  1HCI A;  1WRD A;  5AQR B;  4TN7 B;  1YXR A;  4CXX A;  3ZMS B;  5LCY A;  2UUA T;  3RKO A;  2C9T A;  2LOS A;  5AFM B;  4TZ4 C;  3TLS A;  4UVB B;  2KSR A;  2ZM0 A;  2KIN B;  4GK0 E;  5AQF B;  2BR8 A;  3EI0 A;  3K1S A;  1G73 A;  2E9X B;  3AEE A;  5AFU L;  2CXL A;  3ZYK A;  2XTL A;  3ABV A;  3MZK B;  5HAX A;  3U8L A;  4G2A A;  3CIR A;  2PFV A;  2QGS A;  1W9R A;  2Y7Y A;  2FJA A;  3WTO A;  1D1C A;  4I4T E;  5AFM A;  2IC9 A;  3V5U A;  1VOM A;  4WW0 A;  3MK7 C;  4PIR A;  3FB2 A;  3BQK A;  5ADX L;  3P4S A;  2BYS A;  2DLR A;  3RPU A;  3H3A A;  4CXW A;  2XZE A;  3JCF A;  2W61 A;  1HR0 T;  4ZJT A;  2E9X A;  4MBQ A;  2YKS A;  4GK5 E;  2XQ6 A;  1T72 A;  2LHR A;  3CK6 A;  2VQF T;  2NR4 A;  3QNU A;  4QHO A;  4QKN A;  4COF A;  5FJV A;  1SE7 A;  2LM9 A;  2WNL A;  3PUX F;  1XMO T;  4IDO A;  3HR0 A;  4H63 H;  5JDQ A;  1BR0 A;  2QYW A;  3NZP A;  4QXH B;  4AKG A;  2J62 A;  3LK4 2;  4BJN A;  4PK6 A;  2BVM A;  2BR7 A;  5LXT E;  2XQ3 A;  5HEO A;  2HPL A;  3RYC E;  3ZT5 A;  2DWG A;  1MNE A;  5F5W A;  1MND A;  4IRE A;  4QXC B;  1IJ5 A;  4G63 A;  2KLQ A;  4ZZB A;  4U7Y A;  1FJG T;  4PNI A;  3AE5 A;  5KXJ A;  2X66 A;  2XAG B;  4MAL A;  5FYM A;  4OYK A;  4JI8 T;  4DMW A;  3ZT6 A;  3IHR A;  5JDG A;  3ZN1 B;  4O4L E;  5TAO A;  4YSX A;  3PUZ F;  2KND A;  2XHE B;  3S4U A;  3KV4 A;  4DV7 T;  2XNU A;  3PMZ A;  5EZY E;  2NW7 A;  3N9N A;  2LSK A;  4X66 T;  2LSJ A;  3PU3 A;  2L9Q A;  3AVR A;  2WB5 A;  2M67 A;  2IML A;  3CQX C;  3PV0 F;  3KV9 A;  4XK9 A;  5J2U E;  4UIG A;  5J0Z A;  4WBN E;  4KUM B;  3SFD A;  3J7Y q;  4PFP A;  4LFB T;  4IL9 A;  5J5G A;  5J5I A;  2XZ6 A;  4ZRU A;  3FBL A;  2Z6E A;  3RIA A;  1D1A A;  4FRR A;  3FZM B;  4DID B;  2BBH A;  2XUE A;  3VKH A;  4X1Y E;  3ZC0 A;  2ODU A;  3AE4 A;  1IBL T;  2D9D A;  2CA5 A;  2AE9 A;  2UXD T;  2I6H A;  5CFB A;  3UUM A;  2LRK A;  2WWV A;  4O8S A;  1YD8 G;  5LG3 A;  3UQ4 A;  1N33 T;  2M6I A;  4JI1 T;  3PDY A;  1CUN A;  4UV9 B;  3DJB A;  2XQ7 A;  2JPF A;  2XPK A;  3ZJ2 A;  3WIP A;  4JYA T;  3QB5 K;  2PBI A;  4ADZ A;  2NWB A;  2NOX A;  2V6X A;  5HCJ A;  3Q5D A;  5J2T E;  3TKL B;  2XAF B;  5LMN T;  2D2S A;  3L8R A;  4HFH A;  3ZMZ B;  2KWI B;  2L8K A;  5AQH B;  1L0V A;  1ZKE A;  4QH5 A;  3WTM A;  4X62 T;  4QWN B;  4DVD A;  1YW0 A;  4IT4 A;  3LJC A;  5LHG B;  3FZF B;  5GON E;  3Q5W A;  3R84 B;  5HEH A;  5JTG A;  3CQC B;  3AEC A;  2WQY A;  3AE2 A;  2LT3 A;  4HWF A;  1KNZ A;  4QAB A;  3F57 A;  1IZN B;  3P4P A;  4EYY R;  5LJN A;  3BQI A;  5AQU B;  4YTN A;  1HX1 B;  5KDM C;  1KF6 A;  4LF9 T;  1T98 A;  4EZ4 A;  5JR9 B;  3ZCI A;  3NBX X;  3I9Y A;  1O3X A;  3PUY F;  1BR4 A;  4A98 A;  2PH9 A;  2BS4 A;  1N32 T;  4GOU A;  4AQG A;  3ZPO A;  1IJ6 A;  3PJA J;  5FKY A;  4JI7 T;  5BP0 A;  1XDP A;  5L4H A;  2CPT A;  2BJ0 A;  4UM3 A;  2E9X C;  1CHU A;  3CX6 B;  4HFE A;  5JRC B;  1MIY A;  5BRX A;  4CZZ B;  3ZSS A;  1MMA A;  1OED B;  2XJ7 A;  5FY0 A;  5JR9 A;  5CB4 E;  5M4Y A;  4CI1 B;  1NAF A;  3CML A;  3IA3 A;  4IHJ E;  1WYC A;  4CI3 B;  5SYO A;  2V6Y B;  4ILC A;  5L3E B;  3Q5E A;  3OVU A;  4LF7 T;  1QSD A;  4ISS A;  5CGM A;  2A3D A;  5F3J A;  1B7T A;  2N2N A;  3UT5 E;  4OX9 T;  4JI6 T;  2DHR A;  5JRC A;  3VKG A;  4AKL A;  5HCM A;  4KI0 F;  3SQ6 A;  5HXS A;  1D0Y A;  5JRE A;  1OED A;  4IGU A; 
#chains in the Genus database with same CATH homology
 3C84 A;  4D01 A;  4TWD A;  5L47 A;  2YKS A;  2BYR A;  2XQ6 A;  3RQW A;  2WN9 A;  4UY2 A;  2WNC A;  4UM3 P;  4IL9 A;  5J5G A;  5AFJ A;  5J5I A;  2YOE A;  2XZ6 A;  4ZRU A;  3U8M A;  4LMJ A;  3RIA A;  3C79 A;  5KZU A;  4FRR A;  3UUB A;  5BW2 A;  4Z91 A;  4COF A;  4UXU A;  3ZKR A;  4XHE A;  2ZJU A;  5FJV A;  3WTN A;  2XQ4 A;  3UU3 A;  1I9B A;  4AFG A;  2BG9 C;  4A98 A;  3WTH A;  2WNL A;  2PH9 A;  3SQ9 A;  3P50 A;  4TWF A;  4HFI A;  4HFB A;  3SH1 A;  3T4M A;  5BP0 A;  3U8J A;  4QAA A;  5J5F A;  4TWH A;  5CFB A;  4AFT A;  1UW6 A;  2XYT A;  4ZK1 A;  5L4H A;  3UU5 A;  3WTK A;  4ALX A;  2XQ9 A;  5AFN A;  4HFC A;  2BG9 E;  2BJ0 A;  4UM3 A;  4AFH A;  4QH1 A;  2XNV A;  2C9T A;  5HEU A;  2LKG A;  4BQT A;  1OED C;  4X5T A;  4F8H A;  3U8K A;  2BR7 A;  2XQ3 A;  2BG9 B;  5HEO A;  4ZK4 A;  5AFM B;  3TLS A;  3UU4 A;  5LG3 A;  4HFE A;  2LLY A;  3UQ4 A;  3WTI A;  2KSR A;  4TNV A;  3TLW A;  5AIN A;  4LMK A;  2M6I A;  5HEJ A;  2W8F A;  2BR8 A;  3EI0 A;  3JAD A;  4B5D A;  2XQ7 A;  2YN6 A;  4IRE A;  5BRX A;  4ILB A;  2XYS A;  5IUX A;  3UU8 A;  4EZ1 A;  1OED E;  2Y56 A;  3RIF A;  3ZDG A;  3UQ7 A;  4ZZB A;  2M6B A;  2XQA A;  4NPP A;  4TNW A;  5L4E A;  2W8G A;  2XZ5 A;  5TVC A;  3SIO A;  3WIP A;  3P4W A;  1OED B;  1UX2 A;  3TLU A;  5HEG A;  5J5H A;  5AFL A;  2MAW A;  5HCJ A;  3U8N A;  3RHW A;  3RI5 A;  2Y54 A;  2Y57 A;  2UZ6 A;  3U8L A;  2XQ8 A;  4A97 A;  5SYO A;  2X00 A;  4HFH A;  4Z90 A;  3WTL A;  4ILC A;  5LXB A;  2Y58 A;  3TLV A;  4ILA A;  2Y7Y A;  4UM3 S;  4NZB A;  4IL4 A;  2ZJV A;  3WTO A;  4QH5 A;  3WTM A;  5AFK A;  4WV9 A;  3LSV A;  2XNU A;  3IGQ A;  3PMZ A;  5KE4 A;  4QH4 A;  5AFM A;  2BG9 A;  3PEO A;  2PGZ A;  3GUA A;  2QC1 B;  5CO5 A;  2XQ5 A;  2YME A;  3ZDH A;  5JME A;  2LKH A;  4PIR A;  3WTJ A;  3JAE A;  5HEH A;  2BYP A;  2WNJ A;  4LML A;  2BYS A;  4UM1 A;  2WZY A;  2BYN A;  3EAM A;  5HCM A;  2XNT A;  4ZZC A;  2BYQ A;  4DBM A;  4QAC A;  3SQ6 A;  4QAB A;  2YMD A;  3JAF A;  3TLT A;  4XK9 A;  2LM2 A;  5AFH A;  3EHZ A;  5J0Z A;  1UV6 A;  4ZJT A;  4BFQ A;  4ZR6 A;  4ZJS A;  4HQP A;  1OED A;  3UU6 A;  4HFD A;  2VL0 A;  2X00 D;  3RQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...