2XQ3A

Pentameric ligand gated ion channel glic in complex with br-lidocaine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq3A01
2XQ7A 5L4HA 3EAMA 2XYTA 3P50A 2Y57A 2YMDA 3SIOA 4LMJA 4QH1A 5AFKA 3UQ4A 3SQ6A 2LM2A 2M6BA 3SH1A 4QACA 3GUAA 5HCMA 4ILCA 4XHEA 4ALXA 2BR7A 2WNLA 2X00D 2BYPA 3SQ9A 2BG9A 3WTJA 3P4WA 3JAEA 4QABA 5HCJA 4QH4A 2XQ5A 2KSRA 3JADA 4HFIA 2XYSA 3WTOA 2LKHA 4HFHA 4X5TA 4AFTA 2XZ5A 3WTNA 4TWHA 2W8GA 4UM3A 5J5HA 5CFBA 3UQ7A 2ZJUA 4ZRUA 2QC1B 4TNWA 4A97A 5J5FA 4ILAA 4IL4A 4IL9A 2UZ6A 4UM3P 2LKGA 2XNUA 3U8NA 4B5DA 5KZUA 5BP0A 5J5IA 4EZ1A 2BYSA 2WNCA 4NPPA 2YMEA 5AFJA 5HEOA 2WN9A 4AFGA 4HFDA 2BG9B 5CO5A 1UV6A 3UUBA 4UXUA 2XQ4A 1UX2A 5AINA 3U8MA 4A98A 3TLWA 5LXBA 3LSVA 4BFQA 1OEDE 5L47A 3TLSA 3JAFA 4ZZBA 4F8HA 4PIRA 4AFHA 3WTMA 3UU5A 4FRRA 2YKSA 3RHWA 3TLTA 4ZZCA 4XK9A 3WTKA 2BYNA 3PMZA 4UM3S 5TVCA 1OEDC 4NZBA 3ZDHA 4ZK4A 1UW6A 2PGZA 4HQPA 5HEJA 3U8LA 2VL0A 2LLYA 3RI5A 4UY2A 2C9TA 2BG9E 5BW2A 3T4MA 2WNJA 2BYRA 3WTLA 5AFNA 2ZJVA 2XQ6A 4LMLA 3RIAA 4TWDA 2BJ0A 3UU6A 3RQWA 4TWFA 2M6IA 3EI0A 3WIPA 3WTHA 4ZK1A 5SYOA 5KE4A 2Y7YA 2BG9C 2XZ6A 2MAWA 1I9BA 3TLVA 5L4EA 5JMEA 2Y54A 3EHZA 5HEHA 5BRXA 4BQTA 2XQ8A 4HFEA 2YOEA 2YN6A 2BYQA 3RQUA 4ZJTA 5J5GA 5J0ZA 5HEGA 4HFCA 3IGQA 3UU3A 3ZDGA 4UM1A 5HEUA 2XQ3A 2XNTA 5FJVA 4ZJSA 4D01A 5AFMB 4Z90A 2X00A 2BR8A 5AFMA 4COFA 5IUXA 2W8FA 3RIFA 5AFLA 3PEOA 4IREA 1OEDB 2XNVA 2Y58A 4LMKA 4ILBA 2XQAA 2XQ9A 4DBMA 3UU4A 4ZR6A 4Z91A 3WTIA 1OEDA 3U8JA 3TLUA 4QH5A 4HFBA 3ZKRA 5AFHA 3C79A 4WV9A 2PH9A 3U8KA 3UU8A 2WZYA 4TNVA 4QAAA 3C84A 2Y56A 5LG3A
chains in the Genus database with same CATH superfamily
5AQIB 4YY3T 2JMKA 3AE2A 4P09A 3FZLB 3PU3A 1X79A 1S35A 4U3CA 4LFBT 3C50A 2XQ5A 4HFIA 2XYSA 3MA9A 3CVRA 3IA3A 3R6NA 5FXWA 1WLXA 4ZRUA 4GK0E 2WBLA 4A97A 1FEWA 4B5DA 4UVAB 5JDHA 5LGTB 3Q9DA 1HF8A 2H7VC 4ADZA 1T98A 3EUHA 1NAFA 4HFDA 3J9X1 1KF6A 3K3NA 5LHIB 2WY2A 3ZCJA 3U3IA 4PIRA 2Q9QD 1SHZC 1LVFA 4WNKA 3CQXC 3ETUA 4U7YA 3I0OA 5AQJB 2EHOD 4BAYB 5AFNA 3AEBA 5L3DB 4X1KE 2QYWA 3PUWF 4WW0A 4DR2T 3ZMSB 2VASA 3RQUA 2XM2A 4B3MT 3P4QA 4JUYA 2X00A 3ZYKA 3GN5B 3IBPA 2W8FA 2YK0A 4L9IA 2C5IT 2D2SA 2WS3A 3TLUA 3C79A 5AQMB 1SUMB 4NIQA 3SS1A 3N9MA 3EAMA 3X1DA 4JEHB 2LM2A 5LOVE 2ACXA 3HKEE 3N9PA 3ETVA 3JAEA 3NBXX 1HR0T 4QH4A 2KSRA 1YW0A 1WFDA 3AE5A 4JBWF 2A72A 4UM3A 1MIVA 2V8SV 3AECA 3P4RA 5JR9B 3HL6A 4PFOA 5HEOA 2DWGA 3QB5K 4H9QC 5EZYE 1QSDA 2IUBA 2BG9B 5AINA 4O4JE 4O2BE 4BFQA 2NW9A 2FJEA 2W67A 4WBOA 3K1SA 3I0QA 2X9XA 3DJBA 3J7Yq 3OKQA 4GKJT 1N32T 3PMZA 5LB7B 4G63A 5F3JA 1UW6A 3N9QA 2Q9QC 4HQPA 3U8LA 4YSZA 3WTLA 3RH3A 4DUYT 4I43B 1ZP0A 3FZMB 5BRXA 4BQTA 3O4XE 5AQQB 5EK2A 2E9XD 5HWXA 5J0ZA 2XAQB 3NZPA 4ZJSA 1FJGT 3ZMZB 1D1CA 5ABFB 3AVSA 3N2GE 3PUSA 2DWKA 3LBXA 3ZLIA 4IIJE 1WR0A 4EZHA 3QK6A 1IJ5A 4DMWA 1N33T 2WMOA 4HGAA 3OTOT 5IWAT 1WYBA 3PE0A 4QABA 3OYZA 1M7KA 2B76A 4JI5T 2XZ5A 4JYAT 2WU5A 4CI3B 5C2TA 3RRWA 2CM0A 2XPKA 2LSIA 3RKGA 4EZ1A 3BQIA 3HI2A 5AFJA 2XASB 2WZHA 3GWHA 1L0VA 5FL0A 4DVDA 3UUBA 4UXUA 3GA8A 3KINB 2X0LB 4IE7A 4IT4A 3UULA 2L9QA 3WTMA 2RPAA 5JDMA 4NXMT 1KNPA 2D0TA 2M67A 4H9SE 5LNKA 2KXPB 5HEJA 2V7LA 1W09A 1KNZA 2WNJA 4O4IE 2IMLA 2ZMAA 1LKXA 1XWMA 1O3XA 4TV8E 2XY8B 1I94T 5SYOA 5C8YE 4EAHA 2LSJA 1NEKA 5HEGA 2A3DA 4HEAA 2CBJA 4KUMB 1BR0A 2N2NA 1M62A 4DR4T 4YTMA 1Y01A 3PEOA 5HYAA 2XQ9A 1OEDA 2NW7A 2ZM0A 3T1HT 3WAKA 5HAXA 2JJ9A 3QUJA 3HA4A 2PH9A 3B13A 3BK9A 4X66T 4DR3T 5AQVB 4AIUA 5IYZE 3UFGA 2J62A 2BR7A 3ZC0A 4YLHA 4IDPA 2E5LT 2CCQA 1T72A 2JQQA 2W0GA 3AA7B 4IE0A 4AQFA 1D0YA 3AA6B 2YDRA 3NKZA 4BJMA 3PV0F 4KP3C 5FVKA 4IL9A 3FXEB 5AQFB 2DCFA 4PAGA 4AKGA 4UVCB 4ASKA 3PUXF 4DR7T 3PJAA 4N78D 2KWIB 3IF8B 4TV9E 5TVCA 3I9YA 2UUCT 2CPTA 2K48A 3CPZA 5AQNB 5L2LA 2BDEA 4YSYA 2K5BB 3K3OA 2KT9A 2X0HA 2IC9A 2UU9T 2LSKA 4DBRA 4MALA 3RQWA 4TWFA 1Y64B 3L3PA 4U7IA 2XZ6A 2LEHA 4TZ4C 2MBGA 3EHZA 5JDNA 2OA5A 5J5GA 5FXZA 4DV0T 4PJMA 2HN2A 4ZI2D 2DL1A 2BR8A 1KEYA 3C98B 4B3ST 5AQUB 5LMNT 2V26A 4DBMA 3AAIA 2UXNB 3QC9A 2WWUA 3S4UA 2FJBA 2D9DA 2CLYB 2NWBA 3KBTA 2WDQA 3VU7H 5FP3A 3RLFF 2E2AA 5HXEA 2BVLA 3ZJ1A 3N2KE 3OBVE 3WTOA 4HFHA 3FZHB 3KV6A 3ANWB 4Q25A 3KV5A 2IIUA 5J5FA 4AI6A 4CXXA 4NPPA 4KI0F 2WN9A 1UCUA 3AA0B 2CBIA 2VVNA 1UX4A 5JH7E 3AE4A 3VKGA 4AFHA 3WTKA 4DR5T 5JDLA 1OEDC 3PURA 2NTXA 1WR6A 3EABA 4ZOLE 2LSGA 2XAFB 3UUNA 4EXTA 1HX8A 2N9DA 3LK2B 3ZT5A 5KE4A 4JI2T 5EK3A 5JMEA 3SFEA 5LHGB 4AQFC 4PK6A 2MOZA 1YKHB 2CXLA 2WZIA 2L8KA 2W63A 5H6RB 1JNZA 1HNWT 2V7JA 4ZI2C 3I9WA 3C4XA 3UTKA 5ETWA 4I55E 1WCRA 4DV6T 1G73A 2PJQA 3P50A 3GUAA 4PK4A 2BZBA 3PUQA 5L3FB 3RPUA 2JRKA 4CQIA 1Z8UA 1UGOA 4KX6A 4EYUA 5CFBA 4NUUA 4A5XA 3RF1A 2QC1B 1U4QA 4TNWA 4U33A 2UZ6A 4X65T 2H7OA 2HPJA 2XAHB 2MTQA 3CMLA 2YMEA 4AXPA 4EEBA 3ZSSA 2EHOA 2MYSA 2X66A 5ABEA 4JI4T 4H63H 2W00A 5DABA 3NRXA 4A56A 1YQ4A 3RYFE 2W4XA 1DU2A 3ZCIA 5LG4A 2IDOB 4QHOA 2ZM2A 2ES0A 3AE6A 2NR4A 3ZYLA 3VRAA 4QWNB 2H89A 1IBMT 4YHJA 4KHZF 2XQ6A 3AE3A 2LSYA 2WWVA 3Q5EA 3VRBA 5LGUB 3T1YT 1YQ3A 1IAPA 1D0ZA 2J4GA 2V7IA 4IE4A 3IGQA 3ZDGA 2LJLA 2XNTA 4PFPA 2W66A 1OEDB 4DIDB 2Y58A 4MHCA 4GK5E 4ZR6A 2KLQA 1N36T 3WTIA 4HWFA 4AQGA 1HFAA 3AE8A 1D1AA 4QAAA 2X68A 5CA1E 4Z8XA 2LRLA 3HKBE 3RKOA 3SIOA 1CHUA 3SQ6A 3A7MA 4ILCA 4DR6T 3SQ9A 2BVMA 4QX7B 3V5SA 3CQCB 2PBIA 5HCJA 4XZCA 4H63V 4PJNA 4ZI3C 2Y6XA 3N9OA 2VB6A 3SWHA 4HE8A 3Q5DA 4AQYT 1HX1B 2CEAA 2FUPA 3EVYA 3JC6D 3MACA 5IHYA 3OPCA 1YXRA 2D5UA 2UXCT 5FXVA 5ABGA 2SPCA 4QXHB 2HN1A 3UU5A 4FRRA 5KXJA 2VQET 5LMUT 3VHLA 2E9XA 2LOSA 2DHRA 3LFMA 4CN4A 1BR4A 4YJ2E 2WCAA 4DMVA 2RP4A 2WM9A 4PJLA 2R6GF 4CN6A 3PUAA 1MIYA 1KFYA 3TLVA 2P9BA 3A5XA 3H3MA 3LDQB 4HFEA 3N2OA 5LXTE 1NENA 3F57A 4AISA 3PTRB 5IUXA 2V1DB 3HR0A 2XNVA 3B57A 2XQAA 4G2AA 2EHOC 2QRXA 5CA0E 4LF8T 5AFHA 2AXDS 4U31A 4TNVA 1SE7A 1US7B 5JDQA 4YFSA 2XYTA 3RX6A 3AVRA 4YJ3E 4XHEA 2LOPA 4YSXA 1FIOA 2BS2A 1HS7A 5AFLA 3JADA 2LKHA 3WTNA 2IAKA 2K3WA 3AA1B 1J1JA 3UQ7A 4MLKA 2XTLA 3FXDB 4ILAA 2XNUA 2W2UA 1ZV4X 1MMNA 1AJ3A 2OLTA 2V5CA 5CO5A 4IHJE 1T7SA 5LXBA 3W15B 4ZI7E 3L09A 1OEDE 5BR8T 3AXJB 3LK42 4F8HA 2VKHA 1J5ET 1ZOYA 3FZFB 4UM3S 3PUYF 5AQTB 4DO0A 4ZK4A 3BQKA 3AEFA 3KV4A 3AE7A 2X0YA 5CGMA 4GYRA 2XHEB 3T8OA 2BKPA 2V6YA 3KFWX 2CA5A 1UX5A 4X64T 1KNRA 4E7SA 2CWYA 3O1JA 5JVDE 2PFVA 1IBKT 2WP9A 2Y8DA 2ODVA 3RC8A 2CE7A 5KMGP 4ILUA 4WV9A 3UU8A 4AKLA 4JV5T 3RGLA 3RYIE 2J1DG 3UQ4A 2B1EA 5LJMA 3QNUA 3MZKB 4EEDA 2E9XC 3ESLA 3C64A 3KDSE 2JQHA 2WDRA 2Q9QB 1WYCA 2FBWA 4QKNA 4U74A 4X20E 4IL4A 4XBFB 5DQWA 2BYSA 2EHOB 5FXXA 4FJOA 2BKNA 5JREA 4HWIB 4A98A 3LG7A 3IEEA 2ZM8A 5FVLA 5LBMA 1HNXT 2PG8A 2XAGB 2YKSA 3RHWA 3SRZA 4ZZCA 5JRCA 2D0UA 4NZBA 2VKDA 3OYXA 1GQEA 4J2CA 4BA9A 4UIGA 3R84B 5LCYA 2RA1A 3I1AA 2X9HA 4LMLA 4TWDA 4IE6A 3G06A 2Y7YA 2NTYA 4F6RC 2KMFA 2OV9A 3AAEB 4ZJTA 3UUXB 3UU3A 5HEUA 1U5PA 3CQGB 3SFDA 4ILBA 4YTNA 4EIWA 1ZKEA 5AQKB 5AQSB 5HXSA 5J2UE 2UXBT 4IDNA 1HNZT 2XQ7A 3H37A 1UURA 2UUBT 4O4LE 5AFKA 5H6QB 4I0UA 5L3BB 4O4HE 2CRBA 4OHFA 2CXFA 4DV2T 2BYPA 2BG9A 5C3JA 2ZLYA 4X5TA 1SA0E 2QVAA 4P0AA 4TWHA 5AQOB 5J5HA 3D0TA 3KV9A 4CI2B 2LKGA 5KZUA 4X1IE 3AE9A 2CHNA 2VWAA 5CJ5A 2XQ4A 3ZN1B 4CXWA 3AEDA 3PJAJ 3LSVA 5F8PA 2VURA 4C91A 1MMAA 1MMGA 3TLSA 1X9BA 4HN9A 3BQLA 4LFCT 4DUZT 5LHHB 2YU1A 2E9XB 3TLTA 3DP7A 4QXBB 2BYNA 3V5UA 4JI7T 3ZDHA 1HG2A 3VR9A 2LLYA 3RI5A 2C9TA 1E1HB 1W9RA 5JQGE 3VKHA 5FY0A 4NXNT 4EV6A 4JEUB 1I9BA 3ZN0B 5HXRA 2YOEA 2C5JA 2MPKA 4HFCA 4KMCA 3KVAA 5JDFA 4LF5T 3E08A 3WAJA 3CIRA 4COFA 3M65A 3UU4A 4IDOA 2KWHA 3N9LA 4AKRB 3ZKRA 4ZHQE 1XNRT 1KK7A 2ZM6T 2XAJB 2XZEA 2Y56A 3RYHE 1QUUA 2Y57A 4QH1A 2YDQA 5HCMA 2V7KA 5LA6E 4ISTA 4YT0A 4AFTA 3JCFA 3LBXB 4I50E 3K8PC 3O9XA 5M4YA 4DBQA 2Z6EA 1W0BA 4UVBB 1HTJF 2X9YA 2E5VA 2XSBA 3MK7C 4CXYA 1UX2A 4LF6T 3Q2MA 4IDZA 1XMOT 4B3TT 1J5WA 3NVOA 2NP9A 5HXHA 3E0ZA 2DI4A 5HXCA 4XAXB 4YHHT 2QA7A 3RIUA 1UK5A 3UFEA 2I6HA 2F4VT 3ZPOA 4JI0T 4U72A 4UY2A 5FY1A 3RIAA 3OJAA 5L3GB 5ABHA 3EI0A 2BG9C 1MNDA 5AFUL 4CI1B 4PNIA 2BYQA 3AE1A 2XQ3A 3MXZA 2IHR1 4D01A 3AEGA 3PU8A 5AQGB 4Z90A 4EZ4A 3ABVA 1LRZA 1YKEB 3CWZB 4UXNB 4ZS2A 4HKAA 1IJ6A 5J1GA 3CKDA 3RRCA 4LMJA 5HWYA 4U2ZA 3NWIA 4C90A 3UT5E 4K0UA 2IC6A 4AKIA 3C4ZA 2YU2A 4L0RA 3RYCE 3EDUA 2C0SA 2I59A 4MFRA 4OYJA 3SOLA 2HH7A 4CN1A 5GONE 1UV6A 1VCSA 1XNQT 3TKLB 3NRYA 3TLWA 2WU2A 4CZZB 4U2YA 4LF4T 1MNEA 1B7TA 4ZZBA 3FBZA 3L8RA 4DR1T 5JRCB 3A8YC 5AQLB 2DLRA 1R8IA 3FHNA 4E7ZA 4KHPT 5F5WA 4HWHA 2X51A 1NWMX 2BYRA 4GYSA 1VRBA 4GIWA 1YD8G 4WYVA 2MAWA 2LRKA 4FI5A 5TAOA 1HG5A 4HFVA 3DTOA 3VR8A 1H7CA 1MMDA 2VL8A 4DNDA 4LF7T 1G8XA 4Z91A 4ISSA 3ONJA 2UXXB 4IDQA 2VKJA 3ANWA 2E8IA 3U8KA 3PDYA 3C84A 5L4HA 1OXZA 2X9WA 4WBNE 2X00D 2VKOA 3P4WA 4X1YE 3RIUC 3MJXA 3WI3A 5LBQB 3PUZF 4UF0A 2W8GA 3ZEFB 4NUVA 2A9UA 4UM3P 2I0MA 1S94A 2XUEA 3OVUA 2VK9A 1VCTA 4DV3T 4B6XA 4YXDA 3CX7B 3EDVA 3ONLC 5LP6E 2YINA 4LF9T 3KBUA 4JI6T 4TUYE 4H9RC 2WMNA 4TN7B 2BJ0A 3MKDA 4ERRA 3N5LA 2XSAA 2A2FX 3JC6C 3WTHA 4EB6E 1BR2A 1ZHCA 2N1GA 2Y54A 5HEHA 2XQ8A 3CX8B 3FB2A 3CX6B 4PK5A 4H9PC 2LHRA 5AFMA 3B5MA 3L39A 4PJJA 3U78A 4ANJA 4EGWA 4UV9B 3QOFA 2WZYA 5LGNB 2ODUA 2IW5B 5LG3A 3LJCA 3AB3B 5BMVE 4QACA 4HTEA 2DNXA 4JLEA 4M1PA 2V7MA 5FKYA 2GK9A 2L3LA 4B3RT 1D1BA 4V1Av 2WQYA 4GKKT 4WZXA 2HPLA 3ZT7A 3ZMUB 3AAAB 2LHNA 2CLYC 1FMVA 1Z0PA 2W62A 5CB4E 2C5KT 2V5DA 2KZ7B 3RC3A 5J2TE 5FY7A 4DV4T 3ZMTB 3QB5A 3PUVF 2VL0A 2BG9E 5BW2A 3T4MA 1T8BA 2J47A 4HWDA 2ZJVA 5ADXL 1HCIA 2BKOA 1XMQT 3WIPA 3AEAA 4PW8A 1E2AA 3ZC1A 3CK6A 5L4EA 2JQKA 4KBMB 2XM1A 5JDGA 1VOMA 4EOZB 4O2AE 3NZQA 4ZEYA 1E7PA 2KNDA 2X67A 4DV5T 3IHRA 2VQFT 3RIFA 4IREA 2PTFA 3GN5A 1QLBA 1W0AA 3C51A 4O8SA 2VVSA 3PUGA 2CWOA 2WSSV 2LE8A 1CUNA 2M6BA 3Q5XA 3P4PA 4ALXA 4H9NC 2WNLA 1LVKA 3ONXA 2ZJUA 4P0BA 4HWCA 2BS4A 3N9NA 5BP0A 5J5IA 2WNCA 5JR9A 2BS3A 2CXDA 5FL1A 1BR1A 5A1LA 2JQ9A 4K0KT 3F31A 5L47A 3HKDE 3O1HA 4JI3T 5FYMA 2UUAT 3C4WA 2BBHA 3FBLA 5FMNA 2H3RA 3AEEA 2LT3A 2YDSA 2LM9A 4H9OC 3O1IA 4ZK1A 1EZ3A 4TX5A 1XZYA 2YN6A 4DV7T 3H3AA 1ZEEA 2FJAA 4UM1A 5FJVA 3LK3B 1UUSA 4UV8B 1V9DA 2YEVC 4LMKA 2HHHT 4DV1T 3U8JA 5ABFA 3ZMVB 4OFZA 4QH5A 4HFBA 4OK0A 4UEMA 5E0OA 3ZT6A 1XDOA 2YMDA 1D0XA 3SH1A 2JMHA 3E22E 5FNVE 2WB5A 3WTJA 4JI1T 3HKCE 1N34T 5LYJE 4UF0B 2NOXA 4IE5A 1XDPA 2NW8A 3AXJA 5L3CB 4GOUA 2UXDT 4L5GA 2Y48B 4I4TE 5AQPB 2XJ7A 3U8NA 4QXCB 5KDMC 2JIWA 2WDVA 4AFGA 5AQHB 2K24A 3U8MA 4JI8T 3JAFA 1FMWA 5JTGA 4P1NA 2WAUA 4OX9T 3F2EA 4BJNA 4XK9A 4YTPA 4MBQA 1I6ZA 2G0UA 3GMIA 2PGZA 2QGSA 2K9AA 3KVBA 4UR9A 3FZKB 2V6XA 3UU6A 4UELA 2M6IA 4IGUA 2BBJA 5DQVA 5LJNA 4EYYR 5KX5E 5AQRB 2H88A 3P7IA 2XQYA 4ZXLA 2W61A 1IZNB 3P4SA 1IBLT 2JPFA 4AKHA 4ZS3A 1OWAA 1JNRA 4X62T 5L3EB 5AFMB 4ZI3D 2ACZA 1WRDA 3ZJ2A 3Q5WA 2CMRA 2AE9A 3UUMA 3ZYMA 5JR9C 4OYKA 1MIWA 2V6YB 4LFAT 3ZSTA 5DJQC 4QX8B 2CHOA 2KINB 2Q9QA 3P8CD 3M3ZB 5EK4A 3K3QC 2FJDA
chains in the Genus database with same CATH topology
2XQ7A 5L4HA 3EAMA 2XYTA 3P50A 2Y57A 2YMDA 3SIOA 4LMJA 4QH1A 5AFKA 3UQ4A 3SQ6A 2LM2A 2M6BA 3SH1A 4QACA 3GUAA 5HCMA 4ILCA 4XHEA 4ALXA 2BR7A 2WNLA 2X00D 2BYPA 3SQ9A 2BG9A 3WTJA 3P4WA 3JAEA 4QABA 5HCJA 4QH4A 2XQ5A 2KSRA 3JADA 4HFIA 2XYSA 3WTOA 2LKHA 4HFHA 4X5TA 4AFTA 2XZ5A 3WTNA 4TWHA 2W8GA 4UM3A 5J5HA 5CFBA 3UQ7A 2ZJUA 4ZRUA 2QC1B 4TNWA 4A97A 5J5FA 4ILAA 4IL4A 4IL9A 2UZ6A 4UM3P 2LKGA 2XNUA 3U8NA 4B5DA 5KZUA 5BP0A 5J5IA 4EZ1A 2BYSA 2WNCA 4NPPA 2YMEA 5AFJA 5HEOA 2WN9A 4AFGA 4HFDA 2BG9B 5CO5A 1UV6A 3UUBA 4UXUA 2XQ4A 1UX2A 5AINA 3U8MA 4A98A 3TLWA 5LXBA 3LSVA 4BFQA 1OEDE 5L47A 3TLSA 3JAFA 4ZZBA 4F8HA 4PIRA 4AFHA 3WTMA 3UU5A 4FRRA 2YKSA 3RHWA 3TLTA 4ZZCA 4XK9A 3WTKA 2BYNA 3PMZA 4UM3S 5TVCA 1OEDC 4NZBA 3ZDHA 4ZK4A 1UW6A 2PGZA 4HQPA 5HEJA 3U8LA 2VL0A 2LLYA 3RI5A 4UY2A 2C9TA 2BG9E 5BW2A 3T4MA 2WNJA 2BYRA 3WTLA 5AFNA 2ZJVA 2XQ6A 4LMLA 3RIAA 4TWDA 2BJ0A 3UU6A 3RQWA 4TWFA 2M6IA 3EI0A 3WIPA 3WTHA 4ZK1A 5SYOA 5KE4A 2Y7YA 2BG9C 2XZ6A 2MAWA 1I9BA 3TLVA 5L4EA 5JMEA 2Y54A 3EHZA 5HEHA 5BRXA 4BQTA 2XQ8A 4HFEA 2YOEA 2YN6A 2BYQA 3RQUA 4ZJTA 5J5GA 5J0ZA 5HEGA 4HFCA 3IGQA 3UU3A 3ZDGA 4UM1A 5HEUA 2XQ3A 2XNTA 5FJVA 4ZJSA 4D01A 5AFMB 4Z90A 2X00A 2BR8A 5AFMA 4COFA 5IUXA 2W8FA 3RIFA 5AFLA 3PEOA 4IREA 1OEDB 2XNVA 2Y58A 4LMKA 4ILBA 2XQAA 2XQ9A 4DBMA 3UU4A 4ZR6A 4Z91A 3WTIA 1OEDA 3U8JA 3TLUA 4QH5A 4HFBA 3ZKRA 5AFHA 3C79A 4WV9A 2PH9A 3U8KA 3UU8A 2WZYA 4TNVA 4QAAA 3C84A 2Y56A 5LG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ7 A;  5L4H A;  3EAM A;  2XYT A;  3P50 A;  2Y57 A;  2YMD A;  3SIO A;  4LMJ A;  4QH1 A;  5AFK A;  3UQ4 A;  3SQ6 A;  2LM2 A;  2M6B A;  3SH1 A;  4QAC A;  3GUA A;  5HCM A;  4ILC A;  4XHE A;  4ALX A;  2BR7 A;  2WNL A;  2X00 D;  2BYP A;  3SQ9 A;  2BG9 A;  3WTJ A;  3P4W A;  3JAE A;  4QAB A;  5HCJ A;  4QH4 A;  2XQ5 A;  2KSR A;  3JAD A;  4HFI A;  2XYS A;  3WTO A;  2LKH A;  4HFH A;  4X5T A;  4AFT A;  2XZ5 A;  3WTN A;  4TWH A;  2W8G A;  4UM3 A;  5J5H A;  5CFB A;  3UQ7 A;  2ZJU A;  4ZRU A;  2QC1 B;  4TNW A;  4A97 A;  5J5F A;  4ILA A;  4IL4 A;  4IL9 A;  2UZ6 A;  4UM3 P;  2LKG A;  2XNU A;  3U8N A;  4B5D A;  5KZU A;  5BP0 A;  5J5I A;  4EZ1 A;  2BYS A;  2WNC A;  4NPP A;  2YME A;  5AFJ A;  5HEO A;  2WN9 A;  4AFG A;  4HFD A;  2BG9 B;  5CO5 A;  1UV6 A;  3UUB A;  4UXU A;  2XQ4 A;  1UX2 A;  5AIN A;  3U8M A;  4A98 A;  3TLW A;  5LXB A;  3LSV A;  4BFQ A;  1OED E;  5L47 A;  3TLS A;  3JAF A;  4ZZB A;  4F8H A;  4PIR A;  4AFH A;  3WTM A;  3UU5 A;  4FRR A;  2YKS A;  3RHW A;  3TLT A;  4ZZC A;  4XK9 A;  3WTK A;  2BYN A;  3PMZ A;  4UM3 S;  5TVC A;  1OED C;  4NZB A;  3ZDH A;  4ZK4 A;  1UW6 A;  2PGZ A;  4HQP A;  5HEJ A;  3U8L A;  2VL0 A;  2LLY A;  3RI5 A;  4UY2 A;  2C9T A;  2BG9 E;  5BW2 A;  3T4M A;  2WNJ A;  2BYR A;  3WTL A;  5AFN A;  2ZJV A;  2XQ6 A;  4LML A;  3RIA A;  4TWD A;  2BJ0 A;  3UU6 A;  3RQW A;  4TWF A;  2M6I A;  3EI0 A;  3WIP A;  3WTH A;  4ZK1 A;  5SYO A;  5KE4 A;  2Y7Y A;  2BG9 C;  2XZ6 A;  2MAW A;  1I9B A;  3TLV A;  5L4E A;  5JME A;  2Y54 A;  3EHZ A;  5HEH A;  5BRX A;  4BQT A;  2XQ8 A;  4HFE A;  2YOE A;  2YN6 A;  2BYQ A;  3RQU A;  4ZJT A;  5J5G A;  5J0Z A;  5HEG A;  4HFC A;  3IGQ A;  3UU3 A;  3ZDG A;  4UM1 A;  5HEU A;  2XQ3 A;  2XNT A;  5FJV A;  4ZJS A;  4D01 A;  5AFM B;  4Z90 A;  2X00 A;  2BR8 A;  5AFM A;  4COF A;  5IUX A;  2W8F A;  3RIF A;  5AFL A;  3PEO A;  4IRE A;  1OED B;  2XNV A;  2Y58 A;  4LMK A;  4ILB A;  2XQA A;  2XQ9 A;  4DBM A;  3UU4 A;  4ZR6 A;  4Z91 A;  3WTI A;  1OED A;  3U8J A;  3TLU A;  4QH5 A;  4HFB A;  3ZKR A;  5AFH A;  3C79 A;  4WV9 A;  2PH9 A;  3U8K A;  3UU8 A;  2WZY A;  4TNV A;  4QAA A;  3C84 A;  2Y56 A;  5LG3 A; 
#chains in the Genus database with same CATH topology
 5AQI B;  4YY3 T;  2JMK A;  3AE2 A;  4P09 A;  3FZL B;  3PU3 A;  1X79 A;  1S35 A;  4U3C A;  4LFB T;  3C50 A;  2XQ5 A;  4HFI A;  2XYS A;  3MA9 A;  3CVR A;  3IA3 A;  3R6N A;  5FXW A;  1WLX A;  4ZRU A;  4GK0 E;  2WBL A;  4A97 A;  1FEW A;  4B5D A;  4UVA B;  5JDH A;  5LGT B;  3Q9D A;  1HF8 A;  2H7V C;  4ADZ A;  1T98 A;  3EUH A;  1NAF A;  4HFD A;  3J9X 1;  1KF6 A;  3K3N A;  5LHI B;  2WY2 A;  3ZCJ A;  3U3I A;  4PIR A;  2Q9Q D;  1SHZ C;  1LVF A;  4WNK A;  3CQX C;  3ETU A;  4U7Y A;  3I0O A;  5AQJ B;  2EHO D;  4BAY B;  5AFN A;  3AEB A;  5L3D B;  4X1K E;  2QYW A;  3PUW F;  4WW0 A;  4DR2 T;  3ZMS B;  2VAS A;  3RQU A;  2XM2 A;  4B3M T;  3P4Q A;  4JUY A;  2X00 A;  3ZYK A;  3GN5 B;  3IBP A;  2W8F A;  2YK0 A;  4L9I A;  2C5I T;  2D2S A;  2WS3 A;  3TLU A;  3C79 A;  5AQM B;  1SUM B;  4NIQ A;  3SS1 A;  3N9M A;  3EAM A;  3X1D A;  4JEH B;  2LM2 A;  5LOV E;  2ACX A;  3HKE E;  3N9P A;  3ETV A;  3JAE A;  3NBX X;  1HR0 T;  4QH4 A;  2KSR A;  1YW0 A;  1WFD A;  3AE5 A;  4JBW F;  2A72 A;  4UM3 A;  1MIV A;  2V8S V;  3AEC A;  3P4R A;  5JR9 B;  3HL6 A;  4PFO A;  5HEO A;  2DWG A;  3QB5 K;  4H9Q C;  5EZY E;  1QSD A;  2IUB A;  2BG9 B;  5AIN A;  4O4J E;  4O2B E;  4BFQ A;  2NW9 A;  2FJE A;  2W67 A;  4WBO A;  3K1S A;  3I0Q A;  2X9X A;  3DJB A;  3J7Y q;  3OKQ A;  4GKJ T;  1N32 T;  3PMZ A;  5LB7 B;  4G63 A;  5F3J A;  1UW6 A;  3N9Q A;  2Q9Q C;  4HQP A;  3U8L A;  4YSZ A;  3WTL A;  3RH3 A;  4DUY T;  4I43 B;  1ZP0 A;  3FZM B;  5BRX A;  4BQT A;  3O4X E;  5AQQ B;  5EK2 A;  2E9X D;  5HWX A;  5J0Z A;  2XAQ B;  3NZP A;  4ZJS A;  1FJG T;  3ZMZ B;  1D1C A;  5ABF B;  3AVS A;  3N2G E;  3PUS A;  2DWK A;  3LBX A;  3ZLI A;  4IIJ E;  1WR0 A;  4EZH A;  3QK6 A;  1IJ5 A;  4DMW A;  1N33 T;  2WMO A;  4HGA A;  3OTO T;  5IWA T;  1WYB A;  3PE0 A;  4QAB A;  3OYZ A;  1M7K A;  2B76 A;  4JI5 T;  2XZ5 A;  4JYA T;  2WU5 A;  4CI3 B;  5C2T A;  3RRW A;  2CM0 A;  2XPK A;  2LSI A;  3RKG A;  4EZ1 A;  3BQI A;  3HI2 A;  5AFJ A;  2XAS B;  2WZH A;  3GWH A;  1L0V A;  5FL0 A;  4DVD A;  3UUB A;  4UXU A;  3GA8 A;  3KIN B;  2X0L B;  4IE7 A;  4IT4 A;  3UUL A;  2L9Q A;  3WTM A;  2RPA A;  5JDM A;  4NXM T;  1KNP A;  2D0T A;  2M67 A;  4H9S E;  5LNK A;  2KXP B;  5HEJ A;  2V7L A;  1W09 A;  1KNZ A;  2WNJ A;  4O4I E;  2IML A;  2ZMA A;  1LKX A;  1XWM A;  1O3X A;  4TV8 E;  2XY8 B;  1I94 T;  5SYO A;  5C8Y E;  4EAH A;  2LSJ A;  1NEK A;  5HEG A;  2A3D A;  4HEA A;  2CBJ A;  4KUM B;  1BR0 A;  2N2N A;  1M62 A;  4DR4 T;  4YTM A;  1Y01 A;  3PEO A;  5HYA A;  2XQ9 A;  1OED A;  2NW7 A;  2ZM0 A;  3T1H T;  3WAK A;  5HAX A;  2JJ9 A;  3QUJ A;  3HA4 A;  2PH9 A;  3B13 A;  3BK9 A;  4X66 T;  4DR3 T;  5AQV B;  4AIU A;  5IYZ E;  3UFG A;  2J62 A;  2BR7 A;  3ZC0 A;  4YLH A;  4IDP A;  2E5L T;  2CCQ A;  1T72 A;  2JQQ A;  2W0G A;  3AA7 B;  4IE0 A;  4AQF A;  1D0Y A;  3AA6 B;  2YDR A;  3NKZ A;  4BJM A;  3PV0 F;  4KP3 C;  5FVK A;  4IL9 A;  3FXE B;  5AQF B;  2DCF A;  4PAG A;  4AKG A;  4UVC B;  4ASK A;  3PUX F;  4DR7 T;  3PJA A;  4N78 D;  2KWI B;  3IF8 B;  4TV9 E;  5TVC A;  3I9Y A;  2UUC T;  2CPT A;  2K48 A;  3CPZ A;  5AQN B;  5L2L A;  2BDE A;  4YSY A;  2K5B B;  3K3O A;  2KT9 A;  2X0H A;  2IC9 A;  2UU9 T;  2LSK A;  4DBR A;  4MAL A;  3RQW A;  4TWF A;  1Y64 B;  3L3P A;  4U7I A;  2XZ6 A;  2LEH A;  4TZ4 C;  2MBG A;  3EHZ A;  5JDN A;  2OA5 A;  5J5G A;  5FXZ A;  4DV0 T;  4PJM A;  2HN2 A;  4ZI2 D;  2DL1 A;  2BR8 A;  1KEY A;  3C98 B;  4B3S T;  5AQU B;  5LMN T;  2V26 A;  4DBM A;  3AAI A;  2UXN B;  3QC9 A;  2WWU A;  3S4U A;  2FJB A;  2D9D A;  2CLY B;  2NWB A;  3KBT A;  2WDQ A;  3VU7 H;  5FP3 A;  3RLF F;  2E2A A;  5HXE A;  2BVL A;  3ZJ1 A;  3N2K E;  3OBV E;  3WTO A;  4HFH A;  3FZH B;  3KV6 A;  3ANW B;  4Q25 A;  3KV5 A;  2IIU A;  5J5F A;  4AI6 A;  4CXX A;  4NPP A;  4KI0 F;  2WN9 A;  1UCU A;  3AA0 B;  2CBI A;  2VVN A;  1UX4 A;  5JH7 E;  3AE4 A;  3VKG A;  4AFH A;  3WTK A;  4DR5 T;  5JDL A;  1OED C;  3PUR A;  2NTX A;  1WR6 A;  3EAB A;  4ZOL E;  2LSG A;  2XAF B;  3UUN A;  4EXT A;  1HX8 A;  2N9D A;  3LK2 B;  3ZT5 A;  5KE4 A;  4JI2 T;  5EK3 A;  5JME A;  3SFE A;  5LHG B;  4AQF C;  4PK6 A;  2MOZ A;  1YKH B;  2CXL A;  2WZI A;  2L8K A;  2W63 A;  5H6R B;  1JNZ A;  1HNW T;  2V7J A;  4ZI2 C;  3I9W A;  3C4X A;  3UTK A;  5ETW A;  4I55 E;  1WCR A;  4DV6 T;  1G73 A;  2PJQ A;  3P50 A;  3GUA A;  4PK4 A;  2BZB A;  3PUQ A;  5L3F B;  3RPU A;  2JRK A;  4CQI A;  1Z8U A;  1UGO A;  4KX6 A;  4EYU A;  5CFB A;  4NUU A;  4A5X A;  3RF1 A;  2QC1 B;  1U4Q A;  4TNW A;  4U33 A;  2UZ6 A;  4X65 T;  2H7O A;  2HPJ A;  2XAH B;  2MTQ A;  3CML A;  2YME A;  4AXP A;  4EEB A;  3ZSS A;  2EHO A;  2MYS A;  2X66 A;  5ABE A;  4JI4 T;  4H63 H;  2W00 A;  5DAB A;  3NRX A;  4A56 A;  1YQ4 A;  3RYF E;  2W4X A;  1DU2 A;  3ZCI A;  5LG4 A;  2IDO B;  4QHO A;  2ZM2 A;  2ES0 A;  3AE6 A;  2NR4 A;  3ZYL A;  3VRA A;  4QWN B;  2H89 A;  1IBM T;  4YHJ A;  4KHZ F;  2XQ6 A;  3AE3 A;  2LSY A;  2WWV A;  3Q5E A;  3VRB A;  5LGU B;  3T1Y T;  1YQ3 A;  1IAP A;  1D0Z A;  2J4G A;  2V7I A;  4IE4 A;  3IGQ A;  3ZDG A;  2LJL A;  2XNT A;  4PFP A;  2W66 A;  1OED B;  4DID B;  2Y58 A;  4MHC A;  4GK5 E;  4ZR6 A;  2KLQ A;  1N36 T;  3WTI A;  4HWF A;  4AQG A;  1HFA A;  3AE8 A;  1D1A A;  4QAA A;  2X68 A;  5CA1 E;  4Z8X A;  2LRL A;  3HKB E;  3RKO A;  3SIO A;  1CHU A;  3SQ6 A;  3A7M A;  4ILC A;  4DR6 T;  3SQ9 A;  2BVM A;  4QX7 B;  3V5S A;  3CQC B;  2PBI A;  5HCJ A;  4XZC A;  4H63 V;  4PJN A;  4ZI3 C;  2Y6X A;  3N9O A;  2VB6 A;  3SWH A;  4HE8 A;  3Q5D A;  4AQY T;  1HX1 B;  2CEA A;  2FUP A;  3EVY A;  3JC6 D;  3MAC A;  5IHY A;  3OPC A;  1YXR A;  2D5U A;  2UXC T;  5FXV A;  5ABG A;  2SPC A;  4QXH B;  2HN1 A;  3UU5 A;  4FRR A;  5KXJ A;  2VQE T;  5LMU T;  3VHL A;  2E9X A;  2LOS A;  2DHR A;  3LFM A;  4CN4 A;  1BR4 A;  4YJ2 E;  2WCA A;  4DMV A;  2RP4 A;  2WM9 A;  4PJL A;  2R6G F;  4CN6 A;  3PUA A;  1MIY A;  1KFY A;  3TLV A;  2P9B A;  3A5X A;  3H3M A;  3LDQ B;  4HFE A;  3N2O A;  5LXT E;  1NEN A;  3F57 A;  4AIS A;  3PTR B;  5IUX A;  2V1D B;  3HR0 A;  2XNV A;  3B57 A;  2XQA A;  4G2A A;  2EHO C;  2QRX A;  5CA0 E;  4LF8 T;  5AFH A;  2AXD S;  4U31 A;  4TNV A;  1SE7 A;  1US7 B;  5JDQ A;  4YFS A;  2XYT A;  3RX6 A;  3AVR A;  4YJ3 E;  4XHE A;  2LOP A;  4YSX A;  1FIO A;  2BS2 A;  1HS7 A;  5AFL A;  3JAD A;  2LKH A;  3WTN A;  2IAK A;  2K3W A;  3AA1 B;  1J1J A;  3UQ7 A;  4MLK A;  2XTL A;  3FXD B;  4ILA A;  2XNU A;  2W2U A;  1ZV4 X;  1MMN A;  1AJ3 A;  2OLT A;  2V5C A;  5CO5 A;  4IHJ E;  1T7S A;  5LXB A;  3W15 B;  4ZI7 E;  3L09 A;  1OED E;  5BR8 T;  3AXJ B;  3LK4 2;  4F8H A;  2VKH A;  1J5E T;  1ZOY A;  3FZF B;  4UM3 S;  3PUY F;  5AQT B;  4DO0 A;  4ZK4 A;  3BQK A;  3AEF A;  3KV4 A;  3AE7 A;  2X0Y A;  5CGM A;  4GYR A;  2XHE B;  3T8O A;  2BKP A;  2V6Y A;  3KFW X;  2CA5 A;  1UX5 A;  4X64 T;  1KNR A;  4E7S A;  2CWY A;  3O1J A;  5JVD E;  2PFV A;  1IBK T;  2WP9 A;  2Y8D A;  2ODV A;  3RC8 A;  2CE7 A;  5KMG P;  4ILU A;  4WV9 A;  3UU8 A;  4AKL A;  4JV5 T;  3RGL A;  3RYI E;  2J1D G;  3UQ4 A;  2B1E A;  5LJM A;  3QNU A;  3MZK B;  4EED A;  2E9X C;  3ESL A;  3C64 A;  3KDS E;  2JQH A;  2WDR A;  2Q9Q B;  1WYC A;  2FBW A;  4QKN A;  4U74 A;  4X20 E;  4IL4 A;  4XBF B;  5DQW A;  2BYS A;  2EHO B;  5FXX A;  4FJO A;  2BKN A;  5JRE A;  4HWI B;  4A98 A;  3LG7 A;  3IEE A;  2ZM8 A;  5FVL A;  5LBM A;  1HNX T;  2PG8 A;  2XAG B;  2YKS A;  3RHW A;  3SRZ A;  4ZZC A;  5JRC A;  2D0U A;  4NZB A;  2VKD A;  3OYX A;  1GQE A;  4J2C A;  4BA9 A;  4UIG A;  3R84 B;  5LCY A;  2RA1 A;  3I1A A;  2X9H A;  4LML A;  4TWD A;  4IE6 A;  3G06 A;  2Y7Y A;  2NTY A;  4F6R C;  2KMF A;  2OV9 A;  3AAE B;  4ZJT A;  3UUX B;  3UU3 A;  5HEU A;  1U5P A;  3CQG B;  3SFD A;  4ILB A;  4YTN A;  4EIW A;  1ZKE A;  5AQK B;  5AQS B;  5HXS A;  5J2U E;  2UXB T;  4IDN A;  1HNZ T;  2XQ7 A;  3H37 A;  1UUR A;  2UUB T;  4O4L E;  5AFK A;  5H6Q B;  4I0U A;  5L3B B;  4O4H E;  2CRB A;  4OHF A;  2CXF A;  4DV2 T;  2BYP A;  2BG9 A;  5C3J A;  2ZLY A;  4X5T A;  1SA0 E;  2QVA A;  4P0A A;  4TWH A;  5AQO B;  5J5H A;  3D0T A;  3KV9 A;  4CI2 B;  2LKG A;  5KZU A;  4X1I E;  3AE9 A;  2CHN A;  2VWA A;  5CJ5 A;  2XQ4 A;  3ZN1 B;  4CXW A;  3AED A;  3PJA J;  3LSV A;  5F8P A;  2VUR A;  4C91 A;  1MMA A;  1MMG A;  3TLS A;  1X9B A;  4HN9 A;  3BQL A;  4LFC T;  4DUZ T;  5LHH B;  2YU1 A;  2E9X B;  3TLT A;  3DP7 A;  4QXB B;  2BYN A;  3V5U A;  4JI7 T;  3ZDH A;  1HG2 A;  3VR9 A;  2LLY A;  3RI5 A;  2C9T A;  1E1H B;  1W9R A;  5JQG E;  3VKH A;  5FY0 A;  4NXN T;  4EV6 A;  4JEU B;  1I9B A;  3ZN0 B;  5HXR A;  2YOE A;  2C5J A;  2MPK A;  4HFC A;  4KMC A;  3KVA A;  5JDF A;  4LF5 T;  3E08 A;  3WAJ A;  3CIR A;  4COF A;  3M65 A;  3UU4 A;  4IDO A;  2KWH A;  3N9L A;  4AKR B;  3ZKR A;  4ZHQ E;  1XNR T;  1KK7 A;  2ZM6 T;  2XAJ B;  2XZE A;  2Y56 A;  3RYH E;  1QUU A;  2Y57 A;  4QH1 A;  2YDQ A;  5HCM A;  2V7K A;  5LA6 E;  4IST A;  4YT0 A;  4AFT A;  3JCF A;  3LBX B;  4I50 E;  3K8P C;  3O9X A;  5M4Y A;  4DBQ A;  2Z6E A;  1W0B A;  4UVB B;  1HTJ F;  2X9Y A;  2E5V A;  2XSB A;  3MK7 C;  4CXY A;  1UX2 A;  4LF6 T;  3Q2M A;  4IDZ A;  1XMO T;  4B3T T;  1J5W A;  3NVO A;  2NP9 A;  5HXH A;  3E0Z A;  2DI4 A;  5HXC A;  4XAX B;  4YHH T;  2QA7 A;  3RIU A;  1UK5 A;  3UFE A;  2I6H A;  2F4V T;  3ZPO A;  4JI0 T;  4U72 A;  4UY2 A;  5FY1 A;  3RIA A;  3OJA A;  5L3G B;  5ABH A;  3EI0 A;  2BG9 C;  1MND A;  5AFU L;  4CI1 B;  4PNI A;  2BYQ A;  3AE1 A;  2XQ3 A;  3MXZ A;  2IHR 1;  4D01 A;  3AEG A;  3PU8 A;  5AQG B;  4Z90 A;  4EZ4 A;  3ABV A;  1LRZ A;  1YKE B;  3CWZ B;  4UXN B;  4ZS2 A;  4HKA A;  1IJ6 A;  5J1G A;  3CKD A;  3RRC A;  4LMJ A;  5HWY A;  4U2Z A;  3NWI A;  4C90 A;  3UT5 E;  4K0U A;  2IC6 A;  4AKI A;  3C4Z A;  2YU2 A;  4L0R A;  3RYC E;  3EDU A;  2C0S A;  2I59 A;  4MFR A;  4OYJ A;  3SOL A;  2HH7 A;  4CN1 A;  5GON E;  1UV6 A;  1VCS A;  1XNQ T;  3TKL B;  3NRY A;  3TLW A;  2WU2 A;  4CZZ B;  4U2Y A;  4LF4 T;  1MNE A;  1B7T A;  4ZZB A;  3FBZ A;  3L8R A;  4DR1 T;  5JRC B;  3A8Y C;  5AQL B;  2DLR A;  1R8I A;  3FHN A;  4E7Z A;  4KHP T;  5F5W A;  4HWH A;  2X51 A;  1NWM X;  2BYR A;  4GYS A;  1VRB A;  4GIW A;  1YD8 G;  4WYV A;  2MAW A;  2LRK A;  4FI5 A;  5TAO A;  1HG5 A;  4HFV A;  3DTO A;  3VR8 A;  1H7C A;  1MMD A;  2VL8 A;  4DND A;  4LF7 T;  1G8X A;  4Z91 A;  4ISS A;  3ONJ A;  2UXX B;  4IDQ A;  2VKJ A;  3ANW A;  2E8I A;  3U8K A;  3PDY A;  3C84 A;  5L4H A;  1OXZ A;  2X9W A;  4WBN E;  2X00 D;  2VKO A;  3P4W A;  4X1Y E;  3RIU C;  3MJX A;  3WI3 A;  5LBQ B;  3PUZ F;  4UF0 A;  2W8G A;  3ZEF B;  4NUV A;  2A9U A;  4UM3 P;  2I0M A;  1S94 A;  2XUE A;  3OVU A;  2VK9 A;  1VCT A;  4DV3 T;  4B6X A;  4YXD A;  3CX7 B;  3EDV A;  3ONL C;  5LP6 E;  2YIN A;  4LF9 T;  3KBU A;  4JI6 T;  4TUY E;  4H9R C;  2WMN A;  4TN7 B;  2BJ0 A;  3MKD A;  4ERR A;  3N5L A;  2XSA A;  2A2F X;  3JC6 C;  3WTH A;  4EB6 E;  1BR2 A;  1ZHC A;  2N1G A;  2Y54 A;  5HEH A;  2XQ8 A;  3CX8 B;  3FB2 A;  3CX6 B;  4PK5 A;  4H9P C;  2LHR A;  5AFM A;  3B5M A;  3L39 A;  4PJJ A;  3U78 A;  4ANJ A;  4EGW A;  4UV9 B;  3QOF A;  2WZY A;  5LGN B;  2ODU A;  2IW5 B;  5LG3 A;  3LJC A;  3AB3 B;  5BMV E;  4QAC A;  4HTE A;  2DNX A;  4JLE A;  4M1P A;  2V7M A;  5FKY A;  2GK9 A;  2L3L A;  4B3R T;  1D1B A;  4V1A v;  2WQY A;  4GKK T;  4WZX A;  2HPL A;  3ZT7 A;  3ZMU B;  3AAA B;  2LHN A;  2CLY C;  1FMV A;  1Z0P A;  2W62 A;  5CB4 E;  2C5K T;  2V5D A;  2KZ7 B;  3RC3 A;  5J2T E;  5FY7 A;  4DV4 T;  3ZMT B;  3QB5 A;  3PUV F;  2VL0 A;  2BG9 E;  5BW2 A;  3T4M A;  1T8B A;  2J47 A;  4HWD A;  2ZJV A;  5ADX L;  1HCI A;  2BKO A;  1XMQ T;  3WIP A;  3AEA A;  4PW8 A;  1E2A A;  3ZC1 A;  3CK6 A;  5L4E A;  2JQK A;  4KBM B;  2XM1 A;  5JDG A;  1VOM A;  4EOZ B;  4O2A E;  3NZQ A;  4ZEY A;  1E7P A;  2KND A;  2X67 A;  4DV5 T;  3IHR A;  2VQF T;  3RIF A;  4IRE A;  2PTF A;  3GN5 A;  1QLB A;  1W0A A;  3C51 A;  4O8S A;  2VVS A;  3PUG A;  2CWO A;  2WSS V;  2LE8 A;  1CUN A;  2M6B A;  3Q5X A;  3P4P A;  4ALX A;  4H9N C;  2WNL A;  1LVK A;  3ONX A;  2ZJU A;  4P0B A;  4HWC A;  2BS4 A;  3N9N A;  5BP0 A;  5J5I A;  2WNC A;  5JR9 A;  2BS3 A;  2CXD A;  5FL1 A;  1BR1 A;  5A1L A;  2JQ9 A;  4K0K T;  3F31 A;  5L47 A;  3HKD E;  3O1H A;  4JI3 T;  5FYM A;  2UUA T;  3C4W A;  2BBH A;  3FBL A;  5FMN A;  2H3R A;  3AEE A;  2LT3 A;  2YDS A;  2LM9 A;  4H9O C;  3O1I A;  4ZK1 A;  1EZ3 A;  4TX5 A;  1XZY A;  2YN6 A;  4DV7 T;  3H3A A;  1ZEE A;  2FJA A;  4UM1 A;  5FJV A;  3LK3 B;  1UUS A;  4UV8 B;  1V9D A;  2YEV C;  4LMK A;  2HHH T;  4DV1 T;  3U8J A;  5ABF A;  3ZMV B;  4OFZ A;  4QH5 A;  4HFB A;  4OK0 A;  4UEM A;  5E0O A;  3ZT6 A;  1XDO A;  2YMD A;  1D0X A;  3SH1 A;  2JMH A;  3E22 E;  5FNV E;  2WB5 A;  3WTJ A;  4JI1 T;  3HKC E;  1N34 T;  5LYJ E;  4UF0 B;  2NOX A;  4IE5 A;  1XDP A;  2NW8 A;  3AXJ A;  5L3C B;  4GOU A;  2UXD T;  4L5G A;  2Y48 B;  4I4T E;  5AQP B;  2XJ7 A;  3U8N A;  4QXC B;  5KDM C;  2JIW A;  2WDV A;  4AFG A;  5AQH B;  2K24 A;  3U8M A;  4JI8 T;  3JAF A;  1FMW A;  5JTG A;  4P1N A;  2WAU A;  4OX9 T;  3F2E A;  4BJN A;  4XK9 A;  4YTP A;  4MBQ A;  1I6Z A;  2G0U A;  3GMI A;  2PGZ A;  2QGS A;  2K9A A;  3KVB A;  4UR9 A;  3FZK B;  2V6X A;  3UU6 A;  4UEL A;  2M6I A;  4IGU A;  2BBJ A;  5DQV A;  5LJN A;  4EYY R;  5KX5 E;  5AQR B;  2H88 A;  3P7I A;  2XQY A;  4ZXL A;  2W61 A;  1IZN B;  3P4S A;  1IBL T;  2JPF A;  4AKH A;  4ZS3 A;  1OWA A;  1JNR A;  4X62 T;  5L3E B;  5AFM B;  4ZI3 D;  2ACZ A;  1WRD A;  3ZJ2 A;  3Q5W A;  2CMR A;  2AE9 A;  3UUM A;  3ZYM A;  5JR9 C;  4OYK A;  1MIW A;  2V6Y B;  4LFA T;  3ZST A;  5DJQ C;  4QX8 B;  2CHO A;  2KIN B;  2Q9Q A;  3P8C D;  3M3Z B;  5EK4 A;  3K3Q C;  2FJD A; 
#chains in the Genus database with same CATH homology
 2XQ7 A;  5L4H A;  3EAM A;  2XYT A;  3P50 A;  2Y57 A;  2YMD A;  3SIO A;  4LMJ A;  4QH1 A;  5AFK A;  3UQ4 A;  3SQ6 A;  2LM2 A;  2M6B A;  3SH1 A;  4QAC A;  3GUA A;  5HCM A;  4ILC A;  4XHE A;  4ALX A;  2BR7 A;  2WNL A;  2X00 D;  2BYP A;  3SQ9 A;  2BG9 A;  3WTJ A;  3P4W A;  3JAE A;  4QAB A;  5HCJ A;  4QH4 A;  2XQ5 A;  2KSR A;  3JAD A;  4HFI A;  2XYS A;  3WTO A;  2LKH A;  4HFH A;  4X5T A;  4AFT A;  2XZ5 A;  3WTN A;  4TWH A;  2W8G A;  4UM3 A;  5J5H A;  5CFB A;  3UQ7 A;  2ZJU A;  4ZRU A;  2QC1 B;  4TNW A;  4A97 A;  5J5F A;  4ILA A;  4IL4 A;  4IL9 A;  2UZ6 A;  4UM3 P;  2LKG A;  2XNU A;  3U8N A;  4B5D A;  5KZU A;  5BP0 A;  5J5I A;  4EZ1 A;  2BYS A;  2WNC A;  4NPP A;  2YME A;  5AFJ A;  5HEO A;  2WN9 A;  4AFG A;  4HFD A;  2BG9 B;  5CO5 A;  1UV6 A;  3UUB A;  4UXU A;  2XQ4 A;  1UX2 A;  5AIN A;  3U8M A;  4A98 A;  3TLW A;  5LXB A;  3LSV A;  4BFQ A;  1OED E;  5L47 A;  3TLS A;  3JAF A;  4ZZB A;  4F8H A;  4PIR A;  4AFH A;  3WTM A;  3UU5 A;  4FRR A;  2YKS A;  3RHW A;  3TLT A;  4ZZC A;  4XK9 A;  3WTK A;  2BYN A;  3PMZ A;  4UM3 S;  5TVC A;  1OED C;  4NZB A;  3ZDH A;  4ZK4 A;  1UW6 A;  2PGZ A;  4HQP A;  5HEJ A;  3U8L A;  2VL0 A;  2LLY A;  3RI5 A;  4UY2 A;  2C9T A;  2BG9 E;  5BW2 A;  3T4M A;  2WNJ A;  2BYR A;  3WTL A;  5AFN A;  2ZJV A;  2XQ6 A;  4LML A;  3RIA A;  4TWD A;  2BJ0 A;  3UU6 A;  3RQW A;  4TWF A;  2M6I A;  3EI0 A;  3WIP A;  3WTH A;  4ZK1 A;  5SYO A;  5KE4 A;  2Y7Y A;  2BG9 C;  2XZ6 A;  2MAW A;  1I9B A;  3TLV A;  5L4E A;  5JME A;  2Y54 A;  3EHZ A;  5HEH A;  5BRX A;  4BQT A;  2XQ8 A;  4HFE A;  2YOE A;  2YN6 A;  2BYQ A;  3RQU A;  4ZJT A;  5J5G A;  5J0Z A;  5HEG A;  4HFC A;  3IGQ A;  3UU3 A;  3ZDG A;  4UM1 A;  5HEU A;  2XQ3 A;  2XNT A;  5FJV A;  4ZJS A;  4D01 A;  5AFM B;  4Z90 A;  2X00 A;  2BR8 A;  5AFM A;  4COF A;  5IUX A;  2W8F A;  3RIF A;  5AFL A;  3PEO A;  4IRE A;  1OED B;  2XNV A;  2Y58 A;  4LMK A;  4ILB A;  2XQA A;  2XQ9 A;  4DBM A;  3UU4 A;  4ZR6 A;  4Z91 A;  3WTI A;  1OED A;  3U8J A;  3TLU A;  4QH5 A;  4HFB A;  3ZKR A;  5AFH A;  3C79 A;  4WV9 A;  2PH9 A;  3U8K A;  3UU8 A;  2WZY A;  4TNV A;  4QAA A;  3C84 A;  2Y56 A;  5LG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...