2XQ3A

Pentameric ligand gated ion channel glic in complex with br-lidocaine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq3A01
2LLYA 4HFCA 2BYSA 4TNVA 4UY2A 4ZK1A 3ZDHA 2W8FA 2LKHA 4QAAA 2XYTA 2C9TA 2BG9E 2LKGA 4IL4A 2W8GA 4TWDA 2XNVA 4UM1A 4X5TA 3TLWA 2PGZA 2BG9C 3PMZA 1UV6A 4LMJA 4AFGA 4QABA 2BG9B 4UM3P 2XNUA 5TVCA 2XQ6A 2Y54A 5HCJA 3UQ4A 3EI0A 5HEHA 4XHEA 3ZKRA 5KE4A 5AFMA 3TLUA 4ZRUA 2YMDA 5AFNA 4ZZBA 3U8JA 4QH5A 2WNLA 5CO5A 3WTJA 4UM3S 3IGQA 5J5HA 5KZUA 2M6BA 4QH4A 3JAFA 2QC1B 4XK9A 4AFHA 2YOEA 3WTOA 2XYSA 2Y58A 3SQ6A 2Y56A 2ZJUA 2LM2A 2XQ9A 2XQ7A 2BJ0A 3TLTA 3EHZA 3RQUA 3UU3A 3TLSA 3UU8A 3U8KA 4LMKA 3WTMA 2XNTA 3TLVA 2XZ5A 5BP0A 4ILBA 4UM3A 3WTHA 5HEGA 3PEOA 2BYRA 2VL0A 2PH9A 4DBMA 4ILAA 2WZYA 2X00D 5LXBA 4FRRA 3EAMA 3U8LA 4ZJTA 4Z91A 2BYQA 5J5GA 3WTIA 4IL9A 3UQ7A 4HFDA 4TWHA 2Y57A 3JAEA 2XQ4A 5IUXA 1UX2A 5J5FA 2BG9A 4PIRA 5HEJA 4NZBA 3UU5A 4ZJSA 4ZR6A 1I9BA 3C79A 2BYPA 2X00A 5L4EA 4HFIA 2WNJA 2XZ6A 2YMEA 1OEDA 3GUAA 3RIFA 2Y7YA 4AFTA 4BQTA 4Z90A 5BRXA 4D01A 3P50A 3RHWA 5AFMB 4COFA 3JADA 5FJVA 4HFEA 4QH1A 3T4MA 5CFBA 4B5DA 5L47A 3U8NA 2XQ8A 5AFHA 3RIAA 4HFHA 2WN9A 4ZK4A 3SH1A 3SIOA 5AFLA 2YN6A 3C84A 2BR8A 2UZ6A 3ZDGA 1OEDE 3RI5A 4NPPA 3UU6A 5JMEA 5HCMA 2ZJVA 4A97A 3RQWA 4F8HA 3LSVA 3WTLA 4IREA 5J0ZA 3UU4A 5SYOA 3WIPA 3P4WA 4TWFA 2KSRA 2XQAA 5HEUA 2BYNA 4QACA 3SQ9A 2YKSA 4HFBA 3U8MA 2XQ5A 4EZ1A 4TNWA 2MAWA 5LG3A 4WV9A 1OEDC 2XQ3A 4LMLA 1OEDB 2WNCA 4ALXA 3WTKA 5J5IA 3UUBA 2BR7A 5BW2A 4ILCA 4BFQA 1UW6A 5HEOA 5AINA 4HQPA 4UXUA 4ZZCA 5AFKA 4A98A 5AFJA 2M6IA 3WTNA 5L4HA
chains in the Genus database with same CATH superfamily
3Q5DA 3PUVF 3VKHA 5LOVE 5JDMA 3BQKA 4C90A 3CQXC 3HKDE 2E5VA 4X1YE 2WCAA 5FYMA 5AQNB 3ZEFB 2YK0A 5J5HA 4XK9A 2VWAA 3P8CD 2YOEA 3HR0A 2VVSA 1MNEA 4GIWA 3EABA 2YDRA 4O2BE 4CN4A 5BMVE 2PFVA 3LG7A 4UM3A 1NAFA 2BVLA 5EZYE 5J1GA 4HE8A 4Z8XA 4B3TT 3FBZA 3I0QA 4H63V 2WB5A 4WZXA 1BR2A 1YKEB 5LMNT 2MTQA 2VKOA 2WZHA 5JDHA 1J5ET 4MFRA 4HWHA 2FUPA 3ZC1A 4B3ST 1QLBA 4MHCA 2DWKA 3L3PA 3D0TA 3EDUA 2M67A 1HCIA 4GYRA 2AE9A 3WAKA 1J1JA 3UU6A 1FIOA 4EYUA 2CXFA 3VRBA 3EUHA 2JQQA 3C98B 4Q25A 1IBLT 1KFYA 1UW6A 2J47A 1D1CA 2LM9A 2WBLA 2WDRA 4UY2A 3PJAJ 3RYCE 2A3DA 2K5BB 2W8GA 4U74A 4X5TA 3RRCA 1VOMA 5DJQC 3FZKB 2Y48B 2WP9A 2XAJB 4XHEA 3C51A 2NOXA 3PUWF 3AVRA 2WU5A 4QH5A 4KHPT 5LMUT 1JNRA 3GA8A 2MPKA 2LHNA 3EHZA 2WMOA 3KV4A 1KNRA 3ZSTA 5LP6E 2WMNA 2XZEA 5HEGA 2W62A 4DVDA 4M1PA 4GOUA 2X00D 4DR4T 1BR4A 4KMCA 1IAPA 1T8BA 2KNDA 2VKHA 2YDQA 1WYCA 4ZJSA 4PW8A 2BYPA 5KXJA 3N2OA 1HS7A 3C4ZA 2XQYA 4TUYE 1YKHB 4UIGA 2XUEA 5LCYA 3NBXX 2WN9A 2YN6A 2JMKA 1YQ4A 3AEDA 3K1SA 4I0UA 5JMEA 5JRCA 2UUCT 2D9DA 2OV9A 1R8IA 1OEDC 4PJMA 5HEOA 3IF8B 4I4TE 4XBFB 5L3FB 2LOSA 3PJAA 2V5DA 2XYTA 4L9IA 4HKAA 4LMJA 4UVAB 4PFOA 1UX5A 5H6QB 3TLUA 5CO5A 4YTMA 5LHHB 3E22E 5AQLB 3WTOA 2X9XA 3P4RA 4HWIB 3SQ6A 4O4LE 4DV4T 1ZKEA 2V7IA 4ZI7E 3UU8A 2YU1A 3N9QA 2E9XD 3MJXA 1W0AA 3PEOA 1I94T 4TV9E 5LXBA 4MALA 3P4PA 3KV5A 3MKDA 3DTOA 4B3MT 3ZPOA 4EYYR 3VRAA 4TV8E 3SOLA 5IUXA 4TN7B 4QX8B 3NRYA 2Q9QB 2LSJA 3SRZA 3VU7H 3C79A 4WW0A 4LF4T 2OA5A 2X9HA 4LFAT 2Y6XA 5JR9A 1HTJF 3AEFA 3SFDA 1MNDA 2ZM8A 2FJBA 3N9LA 1FJGT 2VVNA 4ZK4A 1OEDE 3ZMUB 4NPPA 4F6RC 2YINA 4U2ZA 3RQWA 4IREA 4PJNA 3CK6A 3K8PC 3PU3A 4TNWA 2UXDT 5LG3A 4YHJA 1SE7A 2NW9A 5AFKA 3BQIA 3AEGA 1T98A 4P09A 2XM1A 4X1KE 3UUMA 3BQLA 4IIJE 2W8FA 5H6RB 4GK5E 4UM1A 2CEAA 2Q9QA 1BR1A 4DBQA 2IC6A 4UV8B 1U4QA 3FZHB 4DV0T 3LBXB 5KE4A 4JI3T 3VKGA 4YSZA 4ASKA 5LHGB 5AQKB 3QC9A 4YSYA 4FI5A 4IT4A 5BP0A 2K48A 5FMNA 2RPAA 3N5LA 3ONXA 3ANWA 2UUAT 3U3IA 3K3QC 3M65A 2J62A 5ABHA 4ZJTA 5M4YA 2W00A 3LK2B 4HWCA 3LDQB 2EHOD 2ACXA 2KWIB 4LF8T 1ZEEA 4AKRB 3X1DA 2W61A 5JQGE 4BQTA 5AQTB 3ZJ2A 2D0TA 2CXLA 3ZYKA 4QH1A 5FVKA 1CHUA 2HPLA 2D0UA 3RH3A 1ZHCA 2J4GA 2ODVA 2YKSA 1I6ZA 2DL1A 2MAWA 4WV9A 3AE8A 4DIDB 4H9SE 2BBJA 2IMLA 4NIQA 5JR9C 4AQYT 3ETUA 3RRWA 2CLYB 2WDVA 4K0KT 3JC6C 1UV6A 2IHR1 1VRBA 4ZEYA 4QABA 1LRZA 3V5UA 3ZMVB 4C91A 3QB5K 2XPKA 1LVFA 3ZKRA 4DUZT 2V7LA 2E9XB 3LK42 3NKZA 4ZZBA 2WNLA 2BDEA 4UM3S 3JC6D 1ZOYA 2QC1B 4AKIA 3AE7A 4UEMA 4ZS3A 2PJQA 3UUNA 3IHRA 3ZSSA 5JTGA 2ZMAA 2JQHA 2R6GF 1KNZA 2LSYA 4PK6A 2A9UA 1FMVA 4IDZA 3RYFE 3JAEA 2XQ4A 1IBMT 5J2UE 3I9WA 1UCUA 4PK4A 3PV0F 1FMWA 4JI2T 1WLXA 2X9WA 2YDSA 4PK5A 4D01A 4U31A 5FXWA 5FJVA 4HFEA 2AXDS 2XY8B 2W66A 4IE7A 4HFHA 3ZMSB 2MOZA 1D0ZA 3KBUA 3R6NA 3QNUA 1UK5A 4OHFA 1IBKT 3RLFF 4ISSA 5FVLA 4LF6T 4DV2T 3WTKA 5BW2A 4ISTA 2NWBA 4HQPA 5EK3A 3AE3A 1YW0A 2BS4A 4YJ3E 3AEBA 2E9XC 5IYZE 2HHHT 2LLYA 3ZMZB 2LSKA 2BYSA 1OXZA 5JDLA 3HA4A 4IL4A 3WAJA 3SWHA 1NENA 2BKOA 3PUQA 3NZPA 2E5LT 2VK9A 2VKJA 4AKHA 4BJNA 4LF9T 2V6YA 2DLRA 1Z0PA 3WTJA 3VR8A 3IGQA 4CI3B 1UGOA 3QOFA 2Y56A 2LM2A 3NVOA 2DCFA 2ZM2A 4IDOA 5FY0A 4NUUA 3RIUA 3O1HA 1W0BA 4EIWA 2CLYC 4IDNA 2UXXB 2W67A 2IW5B 4PIRA 3AXJB 2SPCA 4DR5T 3NWIA 1MMDA 2CE7A 2K9AA 2V7MA 3T4MA 5FXZA 3LFMA 3CWZB 1XZYA 4QHOA 4V1Av 2UZ6A 3AE5A 2ZM6T 4U2YA 2LE8A 3UU4A 3U8MA 4EB6E 1HG2A 4ALXA 4KBMB 3PE0A 5GONE 1S94A 3FBLA 4EZ4A 5AFJA 2K24A 5LJMA 2NTXA 2B76A 3TLWA 2BG9C 4DV6T 3AAEB 4P0BA 2D5UA 3JCFA 1IJ6A 5L3BB 3KV9A 4IE0A 1SA0E 3U8JA 1QSDA 4CXYA 3CQCB 3ZYMA 5KZUA 2BVMA 2FBWA 3AE2A 5F5WA 4H63H 3W15B 4LMKA 2CHNA 2BKNA 4ILAA 2V6YB 4DMVA 3FZMB 4O2AE 2KXPB 4YHHT 4TWHA 2P9BA 5J5FA 3KV6A 2IUBA 3UU5A 2X00A 2XZ6A 2WS3A 3QK6A 4AFTA 3KINB 4EOZB 4AIUA 5C2TA 1XWMA 3ESLA 2EHOB 5CFBA 4GYSA 1MIVA 4DR6T 2IIUA 5CGMA 3RI5A 4OFZA 3HL6A 4UV9B 3ZN1B 1OWAA 2XQ5A 2WNCA 3VR9A 2ODUA 2BZBA 2IC9A 2A72A 3P4SA 4LFBT 4X65T 2XTLA 4YLHA 2E9XA 3AAIA 2XNVA 4YFSA 3IBPA 4E7SA 3J9X1 2UXBT 2XNUA 3OVUA 4JI8T 4PJLA 3E0ZA 4I55E 3UUXB 2DNXA 2WWUA 3UFEA 4BAYB 1XNQT 1B7TA 2QRXA 4CQIA 3H3MA 3AA6B 3AVSA 5LYJE 4ZI3D 4G63A 2KINB 4ZOLE 2N2NA 3UQ7A 1Y01A 3UT5E 2KZ7B 3IEEA 2YMEA 3RIFA 5EK4A 3P50A 3K3OA 3L8RA 5AQSB 2V7KA 3WI3A 3RGLA 1GQEA 4IHJE 2PTFA 1T72A 2ZJVA 3P4WA 2XQAA 4XAXB 4CZZB 4L5GA 4P1NA 3CX7B 4LMLA 4HWDA 4WBNE 4UXUA 4A98A 5ABFB 4GK0E 5C3JA 3CIRA 3CX8B 2NW8A 2LKHA 2IDOB 1KNPA 2EHOC 2V8SV 4TWDA 1N34T 3ZC0A 4X62T 1WFDA 3OYXA 3PUAA 5CB4E 1LVKA 3B5MA 5E0OA 2D2SA 4LFCT 5ABGA 2EHOA 5AQPB 4ERRA 2YMDA 4IDPA 1W09A 3ANWB 2I6HA 3FZFB 3A7MA 2YU2A 2XYSA 1AJ3A 1N33T 5FXXA 3TLTA 3ZT7A 2X0YA 3PUGA 3TLSA 3C64A 5JDNA 2VL0A 3ZCJA 2X51A 2JIWA 5L3GB 4CXXA 2XSAA 1DU2A 4HTEA 3CPZA 1I9BA 3CQGB 4U72A 2CPTA 3H37A 5HWXA 4B3RT 4QKNA 3UTKA 1US7B 3O1IA 2VQFT 2XQ8A 4IE4A 5ETWA 1SUMB 4U7IA 3QB5A 1O3XA 2WAUA 1HR0T 5LGUB 5SYOA 5HEUA 2BBHA 4AI6A 4JV5T 5LG4A 3G06A 2LHRA 4IE6A 1V9DA 3UUBA 3J7Yq 4BFQA 4LF7T 3Q5EA 2E8IA 2C5IT 4OYJA 3I1AA 3RC8A 3PURA 4ZK1A 4UELA 2KLQA 3AECA 3RF1A 4ZI2C 2C9TA 1ZV4X 2LKGA 2PG8A 4NXNT 4QXBB 2PGZA 1S35A 2J1DG 3GMIA 2XAGB 1YQ3A 5TVCA 2DI4A 2L3LA 2Y54A 1IZNB 3KDSE 2LSIA 5KMGP 4FJOA 4O4IE 1HNWT 2DWGA 2V5CA 2M6BA 5HXSA 5LJNA 4B6XA 2CM0A 4BA9A 3RQUA 3ZT5A 4JI1T 5LNKA 4HGAA 2ZM0A 2X67A 5JRCB 4G2AA 2BYQA 2H3RA 5J5GA 2I0MA 4WBOA 3OYZA 4BJMA 4L0RA 1HX1B 1UX2A 4KI0F 4OYKA 3B13A 2CXDA 3AE6A 4CXWA 5LHIB 5L4EA 2K3WA 4LF5T 1W9RA 1KK7A 5L47A 2CBIA 2WM9A 5AFHA 5AFLA 3U78A 4YJ2E 5HAXA 3Q9DA 5LGNB 5LXTE 4YSXA 5HCMA 1E1HB 5L2LA 2V6XA 2V26A 2BYNA 3AA1B 4JBWF 4DR3T 4QACA 2A2FX 2VASA 4DUYT 3ZCIA 3N9OA 4JLEA 2BKPA 2L8KA 2QA7A 5JH7E 3IA3A 4PJJA 2F4VT 4N78D 3N9PA 4HFCA 3ZT6A 4TNVA 4JI7T 1MMAA 4EZHA 4DV7T 2H88A 2L9QA 4U33A 1N36T 5AQRB 3NZQA 4PFPA 3RKOA 3UQ4A 3OPCA 5AFMA 5LBMA 4AKLA 4DR7T 5ABEA 3PUZF 4I43B 5FL1A 2ZJUA 3UU3A 2XZ5A 3MXZA 2BYRA 2X0HA 5L3CB 3O1JA 4HFDA 3AEAA 3Q2MA 2CWYA 2BG9A 3N9MA 4ZR6A 4I50E 4EXTA 4PNIA 5DQVA 2OLTA 5L3EB 2Y7YA 5A1LA 1M62A 5LB7B 3RHWA 5AFMB 5CJ5A 5IWAT 2V7JA 3OKQA 3SIOA 3OBVE 2X66A 1HNZT 5JDFA 3B57A 3OTOT 5KDMC 4JI0T 1D1BA 3PDYA 2W0GA 3ZN0B 2KT9A 4HFBA 3KFWX 4YY3T 3FZLB 1G8XA 1NWMX 3F2EA 5J5IA 1OEDB 2FJAA 2IAKA 1VCSA 2W63A 2Z6EA 3S4UA 3AA7B 2X0LB 2BS2A 3Q5XA 2M6IA 2VB6A 2LOPA 1NEKA 2NR4A 3VHLA 3Q5WA 3PMZA 4AFGA 2BG9B 4DBRA 3ETVA 2XHEB 4ZI3C 3EI0A 3ZJ1A 2WY2A 4QXCB 2RA1A 4O4JE 5DQWA 4NUVA 3JAFA 4MBQA 4U3CA 2Y58A 4CN1A 2W2UA 4DV3T 4JUYA 1BR0A 1HNXT 1XDPA 4DR1T 2JMHA 5ABFA 2LT3A 2PH9A 2KMFA 4DBMA 1EZ3A 2XSBA 2GK9A 3AE1A 3GN5A 1QUUA 5AFUL 1WR0A 4KHZF 4X1IE 2HN2A 4TZ4C 2X9YA 1OEDA 3CX6B 4CI2B 3RC3A 2JQ9A 3JADA 1FEWA 2XAFB 4B5DA 3AXJA 5HWYA 4AISA 3RYIE 4DNDA 4ZXLA 2UXCT 4WYVA 4GKKT 1MIWA 2QYWA 3O4XE 4MLKA 3WTLA 3WIPA 4DMWA 5F3JA 4EZ1A 4H9NC 2XQ3A 2HH7A 4YT0A 4ILCA 3KVBA 3QUJA 5ADXL 1HG5A 2UUBT 2VL8A 3EDVA 5L4HA 4AXPA 1CUNA 1G73A 3HKEE 1D0XA 3RKGA 4PAGA 3K3NA 4UM3P 3FHNA 5HCJA 3F31A 5AQJB 3I0OA 4K0UA 4HN9A 5AFNA 2E2AA 2Q9QD 3AE9A 1JNZA 2XQ7A 2BJ0A 2HPJA 2DHRA 2LRLA 2C5KT 5HYAA 1VCTA 1HF8A 4UR9A 1MMNA 5JDQA 4ANJA 2G0UA 4FRRA 3OJAA 1MMGA 4CI1B 4Z91A 4IL9A 2XAHB 2Y57A 5KX5E 5EK2A 3FB2A 3A5XA 3AB3B 3LBXA 1M7KA 1WR6A 5DABA 4HFIA 3R84B 1LKXA 2WSSV 1D0YA 2B1EA 1XNRT 2MBGA 3ABVA 5AQIB 3U8NA 4JI6T 2BS3A 3ONJA 5L3DB 2BR8A 3DP7A 3FXEB 3HKBE 4ILUA 4NXMT 4AKGA 4X66T 4QX7B 2CBJA 1KF6A 5AQVB 4F8HA 5J0ZA 5F8PA 4TWFA 2KSRA 3SQ9A 3P4QA 5AINA 2H7OA 3WTNA 5LA6E 5AQOB 5AQFB 4IGUA 4QAAA 2BG9E 4KP3C 3CMLA 1UURA 3NRXA 2CCQA 2Q9QC 2QGSA 2QVAA 5HEHA 1XMQT 5FKYA 1SHZC 3HKCE 4CN6A 4ZRUA 5JVDE 3MACA 3AAAB 4IDQA 4QH4A 1KEYA 3CVRA 4J2CA 3U8KA 3WTMA 5CA0E 4ILBA 1U5PA 4KUMB 3MK7C 3PU8A 3SS1A 4HWFA 1E2AA 2LSGA 5HEJA 4NZBA 3L09A 4ZS2A 5FY1A 2CRBA 2JQKA 4E7ZA 2WNJA 3T1YT 1HX8A 3AEEA 5FP3A 5BRXA 1Z8UA 1IJ5A 4COFA 2MYSA 2XM2A 5IHYA 3FXDB 3PUYF 1YD8G 2C0SA 2WDQA 5C8YE 2JRKA 4A5XA 3SFEA 2N1GA 2NTYA 5LBQB 2WWVA 5HXEA 4A97A 1UUSA 3RPUA 4DR2T 2YEVC 3RIUC 3TKLB 4UXNB 3EVYA 5FL0A 3V5SA 3HI2A 2C5JA 4EEBA 2N9DA 4KX6A 2FJEA 3A8YC 2LRKA 3L39A 1L0VA 2WZIA 5AQHB 2LJLA 1HFAA 4EEDA 3ZLIA 2XQ6A 3ONLC 2UXNB 2X68A 3AE4A 2VQET 4UF0A 4OK0A 4H9PC 4GKJT 3F57A 2LEHA 3C50A 4JEHB 1XDOA 3E08A 5FNVE 3BK9A 1X79A 2XAQB 3GN5B 5CA1E 2I59A 5JDGA 1UX4A 3O9XA 3MZKB 3P7IA 1WRDA 1X9BA 2XNTA 3TLVA 2XJ7A 5AQUB 3WTHA 2ACZA 4QWNB 3N9NA 2WZYA 3RYHE 4UVCB 2XASB 5HXHA 2PBIA 4JI5T 2H7VC 4XZCA 2HN1A 2VURA 3AA0B 2CWOA 3KVAA 5JREA 5JR9B 5LGTB 1XMOT 4EV6A 4H9OC 2UU9T 3PUSA 2ES0A 4JI4T 4OX9T 1T7SA 3H3AA 2VKDA 3LSVA 2V1DB 4HEAA 2H89A 4WNKA 4AQGA 2W4XA 2Y8DA 3CKDA 4UVBB 5J2TE 3M3ZB 2WU2A 4HFVA 2FJDA 3ZDHA 3T1HT 4TX5A 4A56A 4YTNA 4IE5A 1WCRA 3KBTA 4EGWA 4UF0B 4QXHB 3UULA 4YXDA 2CHOA 4DV5T 3ZMTB 4EAHA 4ZHQE 1D1AA 3T8OA 4AFHA 4ZI2D 2XQ9A 1Y64B 4U7YA 3C4WA 5FY7A 4JEUB 2NW7A 1H7CA 2JJ9A 3EAMA 3U8LA 4X20E 1WYBA 1YXRA 3WTIA 4O8SA 3LJCA 4AQFC 5HXRA 3PTRB 3UFGA 5AQMB 4JYAT 3LK3B 2CA5A 3GUAA 3GWHA 4P0AA 4Z90A 4DO0A 4AQFA 2KWHA 4O4HE 4DV1T 4YTPA 1MIYA 3N2GE 2RP4A 3RIAA 3SH1A 3C84A 3ZDGA 1ZP0A 1J5WA 5HXCA 5FXVA 2JPFA 4ADZA 4X64T 1N32T 5AQGB 5AQQB 3I9YA 4H9QC 5TAOA 5BR8T 3MA9A 2NP9A 2BR7A 2ZLYA 3N2KE 3C4XA 1E7PA 2CMRA 3PUXF 4ZZCA 3DJBA 2WQYA 4H9RC 3ZYLA 3RX6A
chains in the Genus database with same CATH topology
2LLYA 4HFCA 2BYSA 4TNVA 4UY2A 4ZK1A 3ZDHA 2W8FA 2LKHA 4QAAA 2XYTA 2C9TA 2BG9E 2LKGA 4IL4A 2W8GA 4TWDA 2XNVA 4UM1A 4X5TA 3TLWA 2PGZA 2BG9C 3PMZA 1UV6A 4LMJA 4AFGA 4QABA 2BG9B 4UM3P 2XNUA 5TVCA 2XQ6A 2Y54A 5HCJA 3UQ4A 3EI0A 5HEHA 4XHEA 3ZKRA 5KE4A 5AFMA 3TLUA 4ZRUA 2YMDA 5AFNA 4ZZBA 3U8JA 4QH5A 2WNLA 5CO5A 3WTJA 4UM3S 3IGQA 5J5HA 5KZUA 2M6BA 4QH4A 3JAFA 2QC1B 4XK9A 4AFHA 2YOEA 3WTOA 2XYSA 2Y58A 3SQ6A 2Y56A 2ZJUA 2LM2A 2XQ9A 2XQ7A 2BJ0A 3TLTA 3EHZA 3RQUA 3UU3A 3TLSA 3UU8A 3U8KA 4LMKA 3WTMA 2XNTA 3TLVA 2XZ5A 5BP0A 4ILBA 4UM3A 3WTHA 5HEGA 3PEOA 2BYRA 2VL0A 2PH9A 4DBMA 4ILAA 2WZYA 2X00D 5LXBA 4FRRA 3EAMA 3U8LA 4ZJTA 4Z91A 2BYQA 5J5GA 3WTIA 4IL9A 3UQ7A 4HFDA 4TWHA 2Y57A 3JAEA 2XQ4A 5IUXA 1UX2A 5J5FA 2BG9A 4PIRA 5HEJA 4NZBA 3UU5A 4ZJSA 4ZR6A 1I9BA 3C79A 2BYPA 2X00A 5L4EA 4HFIA 2WNJA 2XZ6A 2YMEA 1OEDA 3GUAA 3RIFA 2Y7YA 4AFTA 4BQTA 4Z90A 5BRXA 4D01A 3P50A 3RHWA 5AFMB 4COFA 3JADA 5FJVA 4HFEA 4QH1A 3T4MA 5CFBA 4B5DA 5L47A 3U8NA 2XQ8A 5AFHA 3RIAA 4HFHA 2WN9A 4ZK4A 3SH1A 3SIOA 5AFLA 2YN6A 3C84A 2BR8A 2UZ6A 3ZDGA 1OEDE 3RI5A 4NPPA 3UU6A 5JMEA 5HCMA 2ZJVA 4A97A 3RQWA 4F8HA 3LSVA 3WTLA 4IREA 5J0ZA 3UU4A 5SYOA 3WIPA 3P4WA 4TWFA 2KSRA 2XQAA 5HEUA 2BYNA 4QACA 3SQ9A 2YKSA 4HFBA 3U8MA 2XQ5A 4EZ1A 4TNWA 2MAWA 5LG3A 4WV9A 1OEDC 2XQ3A 4LMLA 1OEDB 2WNCA 4ALXA 3WTKA 5J5IA 3UUBA 2BR7A 5BW2A 4ILCA 4BFQA 1UW6A 5HEOA 5AINA 4HQPA 4UXUA 4ZZCA 5AFKA 4A98A 5AFJA 2M6IA 3WTNA 5L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLY A;  4HFC A;  2BYS A;  4TNV A;  4UY2 A;  4ZK1 A;  3ZDH A;  2W8F A;  2LKH A;  4QAA A;  2XYT A;  2C9T A;  2BG9 E;  2LKG A;  4IL4 A;  2W8G A;  4TWD A;  2XNV A;  4UM1 A;  4X5T A;  3TLW A;  2PGZ A;  2BG9 C;  3PMZ A;  1UV6 A;  4LMJ A;  4AFG A;  4QAB A;  2BG9 B;  4UM3 P;  2XNU A;  5TVC A;  2XQ6 A;  2Y54 A;  5HCJ A;  3UQ4 A;  3EI0 A;  5HEH A;  4XHE A;  3ZKR A;  5KE4 A;  5AFM A;  3TLU A;  4ZRU A;  2YMD A;  5AFN A;  4ZZB A;  3U8J A;  4QH5 A;  2WNL A;  5CO5 A;  3WTJ A;  4UM3 S;  3IGQ A;  5J5H A;  5KZU A;  2M6B A;  4QH4 A;  3JAF A;  2QC1 B;  4XK9 A;  4AFH A;  2YOE A;  3WTO A;  2XYS A;  2Y58 A;  3SQ6 A;  2Y56 A;  2ZJU A;  2LM2 A;  2XQ9 A;  2XQ7 A;  2BJ0 A;  3TLT A;  3EHZ A;  3RQU A;  3UU3 A;  3TLS A;  3UU8 A;  3U8K A;  4LMK A;  3WTM A;  2XNT A;  3TLV A;  2XZ5 A;  5BP0 A;  4ILB A;  4UM3 A;  3WTH A;  5HEG A;  3PEO A;  2BYR A;  2VL0 A;  2PH9 A;  4DBM A;  4ILA A;  2WZY A;  2X00 D;  5LXB A;  4FRR A;  3EAM A;  3U8L A;  4ZJT A;  4Z91 A;  2BYQ A;  5J5G A;  3WTI A;  4IL9 A;  3UQ7 A;  4HFD A;  4TWH A;  2Y57 A;  3JAE A;  2XQ4 A;  5IUX A;  1UX2 A;  5J5F A;  2BG9 A;  4PIR A;  5HEJ A;  4NZB A;  3UU5 A;  4ZJS A;  4ZR6 A;  1I9B A;  3C79 A;  2BYP A;  2X00 A;  5L4E A;  4HFI A;  2WNJ A;  2XZ6 A;  2YME A;  1OED A;  3GUA A;  3RIF A;  2Y7Y A;  4AFT A;  4BQT A;  4Z90 A;  5BRX A;  4D01 A;  3P50 A;  3RHW A;  5AFM B;  4COF A;  3JAD A;  5FJV A;  4HFE A;  4QH1 A;  3T4M A;  5CFB A;  4B5D A;  5L47 A;  3U8N A;  2XQ8 A;  5AFH A;  3RIA A;  4HFH A;  2WN9 A;  4ZK4 A;  3SH1 A;  3SIO A;  5AFL A;  2YN6 A;  3C84 A;  2BR8 A;  2UZ6 A;  3ZDG A;  1OED E;  3RI5 A;  4NPP A;  3UU6 A;  5JME A;  5HCM A;  2ZJV A;  4A97 A;  3RQW A;  4F8H A;  3LSV A;  3WTL A;  4IRE A;  5J0Z A;  3UU4 A;  5SYO A;  3WIP A;  3P4W A;  4TWF A;  2KSR A;  2XQA A;  5HEU A;  2BYN A;  4QAC A;  3SQ9 A;  2YKS A;  4HFB A;  3U8M A;  2XQ5 A;  4EZ1 A;  4TNW A;  2MAW A;  5LG3 A;  4WV9 A;  1OED C;  2XQ3 A;  4LML A;  1OED B;  2WNC A;  4ALX A;  3WTK A;  5J5I A;  3UUB A;  2BR7 A;  5BW2 A;  4ILC A;  4BFQ A;  1UW6 A;  5HEO A;  5AIN A;  4HQP A;  4UXU A;  4ZZC A;  5AFK A;  4A98 A;  5AFJ A;  2M6I A;  3WTN A;  5L4H A; 
#chains in the Genus database with same CATH topology
 3Q5D A;  3PUV F;  3VKH A;  5LOV E;  5JDM A;  3BQK A;  4C90 A;  3CQX C;  3HKD E;  2E5V A;  4X1Y E;  2WCA A;  5FYM A;  5AQN B;  3ZEF B;  2YK0 A;  5J5H A;  4XK9 A;  2VWA A;  3P8C D;  2YOE A;  3HR0 A;  2VVS A;  1MNE A;  4GIW A;  3EAB A;  2YDR A;  4O2B E;  4CN4 A;  5BMV E;  2PFV A;  3LG7 A;  4UM3 A;  1NAF A;  2BVL A;  5EZY E;  5J1G A;  4HE8 A;  4Z8X A;  4B3T T;  3FBZ A;  3I0Q A;  4H63 V;  2WB5 A;  4WZX A;  1BR2 A;  1YKE B;  5LMN T;  2MTQ A;  2VKO A;  2WZH A;  5JDH A;  1J5E T;  4MFR A;  4HWH A;  2FUP A;  3ZC1 A;  4B3S T;  1QLB A;  4MHC A;  2DWK A;  3L3P A;  3D0T A;  3EDU A;  2M67 A;  1HCI A;  4GYR A;  2AE9 A;  3WAK A;  1J1J A;  3UU6 A;  1FIO A;  4EYU A;  2CXF A;  3VRB A;  3EUH A;  2JQQ A;  3C98 B;  4Q25 A;  1IBL T;  1KFY A;  1UW6 A;  2J47 A;  1D1C A;  2LM9 A;  2WBL A;  2WDR A;  4UY2 A;  3PJA J;  3RYC E;  2A3D A;  2K5B B;  2W8G A;  4U74 A;  4X5T A;  3RRC A;  1VOM A;  5DJQ C;  3FZK B;  2Y48 B;  2WP9 A;  2XAJ B;  4XHE A;  3C51 A;  2NOX A;  3PUW F;  3AVR A;  2WU5 A;  4QH5 A;  4KHP T;  5LMU T;  1JNR A;  3GA8 A;  2MPK A;  2LHN A;  3EHZ A;  2WMO A;  3KV4 A;  1KNR A;  3ZST A;  5LP6 E;  2WMN A;  2XZE A;  5HEG A;  2W62 A;  4DVD A;  4M1P A;  4GOU A;  2X00 D;  4DR4 T;  1BR4 A;  4KMC A;  1IAP A;  1T8B A;  2KND A;  2VKH A;  2YDQ A;  1WYC A;  4ZJS A;  4PW8 A;  2BYP A;  5KXJ A;  3N2O A;  1HS7 A;  3C4Z A;  2XQY A;  4TUY E;  1YKH B;  4UIG A;  2XUE A;  5LCY A;  3NBX X;  2WN9 A;  2YN6 A;  2JMK A;  1YQ4 A;  3AED A;  3K1S A;  4I0U A;  5JME A;  5JRC A;  2UUC T;  2D9D A;  2OV9 A;  1R8I A;  1OED C;  4PJM A;  5HEO A;  3IF8 B;  4I4T E;  4XBF B;  5L3F B;  2LOS A;  3PJA A;  2V5D A;  2XYT A;  4L9I A;  4HKA A;  4LMJ A;  4UVA B;  4PFO A;  1UX5 A;  5H6Q B;  3TLU A;  5CO5 A;  4YTM A;  5LHH B;  3E22 E;  5AQL B;  3WTO A;  2X9X A;  3P4R A;  4HWI B;  3SQ6 A;  4O4L E;  4DV4 T;  1ZKE A;  2V7I A;  4ZI7 E;  3UU8 A;  2YU1 A;  3N9Q A;  2E9X D;  3MJX A;  1W0A A;  3PEO A;  1I94 T;  4TV9 E;  5LXB A;  4MAL A;  3P4P A;  3KV5 A;  3MKD A;  3DTO A;  4B3M T;  3ZPO A;  4EYY R;  3VRA A;  4TV8 E;  3SOL A;  5IUX A;  4TN7 B;  4QX8 B;  3NRY A;  2Q9Q B;  2LSJ A;  3SRZ A;  3VU7 H;  3C79 A;  4WW0 A;  4LF4 T;  2OA5 A;  2X9H A;  4LFA T;  2Y6X A;  5JR9 A;  1HTJ F;  3AEF A;  3SFD A;  1MND A;  2ZM8 A;  2FJB A;  3N9L A;  1FJG T;  2VVN A;  4ZK4 A;  1OED E;  3ZMU B;  4NPP A;  4F6R C;  2YIN A;  4U2Z A;  3RQW A;  4IRE A;  4PJN A;  3CK6 A;  3K8P C;  3PU3 A;  4TNW A;  2UXD T;  5LG3 A;  4YHJ A;  1SE7 A;  2NW9 A;  5AFK A;  3BQI A;  3AEG A;  1T98 A;  4P09 A;  2XM1 A;  4X1K E;  3UUM A;  3BQL A;  4IIJ E;  2W8F A;  5H6R B;  4GK5 E;  4UM1 A;  2CEA A;  2Q9Q A;  1BR1 A;  4DBQ A;  2IC6 A;  4UV8 B;  1U4Q A;  3FZH B;  4DV0 T;  3LBX B;  5KE4 A;  4JI3 T;  3VKG A;  4YSZ A;  4ASK A;  5LHG B;  5AQK B;  3QC9 A;  4YSY A;  4FI5 A;  4IT4 A;  5BP0 A;  2K48 A;  5FMN A;  2RPA A;  3N5L A;  3ONX A;  3ANW A;  2UUA T;  3U3I A;  3K3Q C;  3M65 A;  2J62 A;  5ABH A;  4ZJT A;  5M4Y A;  2W00 A;  3LK2 B;  4HWC A;  3LDQ B;  2EHO D;  2ACX A;  2KWI B;  4LF8 T;  1ZEE A;  4AKR B;  3X1D A;  2W61 A;  5JQG E;  4BQT A;  5AQT B;  3ZJ2 A;  2D0T A;  2CXL A;  3ZYK A;  4QH1 A;  5FVK A;  1CHU A;  2HPL A;  2D0U A;  3RH3 A;  1ZHC A;  2J4G A;  2ODV A;  2YKS A;  1I6Z A;  2DL1 A;  2MAW A;  4WV9 A;  3AE8 A;  4DID B;  4H9S E;  2BBJ A;  2IML A;  4NIQ A;  5JR9 C;  4AQY T;  3ETU A;  3RRW A;  2CLY B;  2WDV A;  4K0K T;  3JC6 C;  1UV6 A;  2IHR 1;  1VRB A;  4ZEY A;  4QAB A;  1LRZ A;  3V5U A;  3ZMV B;  4C91 A;  3QB5 K;  2XPK A;  1LVF A;  3ZKR A;  4DUZ T;  2V7L A;  2E9X B;  3LK4 2;  3NKZ A;  4ZZB A;  2WNL A;  2BDE A;  4UM3 S;  3JC6 D;  1ZOY A;  2QC1 B;  4AKI A;  3AE7 A;  4UEM A;  4ZS3 A;  2PJQ A;  3UUN A;  3IHR A;  3ZSS A;  5JTG A;  2ZMA A;  2JQH A;  2R6G F;  1KNZ A;  2LSY A;  4PK6 A;  2A9U A;  1FMV A;  4IDZ A;  3RYF E;  3JAE A;  2XQ4 A;  1IBM T;  5J2U E;  3I9W A;  1UCU A;  4PK4 A;  3PV0 F;  1FMW A;  4JI2 T;  1WLX A;  2X9W A;  2YDS A;  4PK5 A;  4D01 A;  4U31 A;  5FXW A;  5FJV A;  4HFE A;  2AXD S;  2XY8 B;  2W66 A;  4IE7 A;  4HFH A;  3ZMS B;  2MOZ A;  1D0Z A;  3KBU A;  3R6N A;  3QNU A;  1UK5 A;  4OHF A;  1IBK T;  3RLF F;  4ISS A;  5FVL A;  4LF6 T;  4DV2 T;  3WTK A;  5BW2 A;  4IST A;  2NWB A;  4HQP A;  5EK3 A;  3AE3 A;  1YW0 A;  2BS4 A;  4YJ3 E;  3AEB A;  2E9X C;  5IYZ E;  2HHH T;  2LLY A;  3ZMZ B;  2LSK A;  2BYS A;  1OXZ A;  5JDL A;  3HA4 A;  4IL4 A;  3WAJ A;  3SWH A;  1NEN A;  2BKO A;  3PUQ A;  3NZP A;  2E5L T;  2VK9 A;  2VKJ A;  4AKH A;  4BJN A;  4LF9 T;  2V6Y A;  2DLR A;  1Z0P A;  3WTJ A;  3VR8 A;  3IGQ A;  4CI3 B;  1UGO A;  3QOF A;  2Y56 A;  2LM2 A;  3NVO A;  2DCF A;  2ZM2 A;  4IDO A;  5FY0 A;  4NUU A;  3RIU A;  3O1H A;  1W0B A;  4EIW A;  2CLY C;  4IDN A;  2UXX B;  2W67 A;  2IW5 B;  4PIR A;  3AXJ B;  2SPC A;  4DR5 T;  3NWI A;  1MMD A;  2CE7 A;  2K9A A;  2V7M A;  3T4M A;  5FXZ A;  3LFM A;  3CWZ B;  1XZY A;  4QHO A;  4V1A v;  2UZ6 A;  3AE5 A;  2ZM6 T;  4U2Y A;  2LE8 A;  3UU4 A;  3U8M A;  4EB6 E;  1HG2 A;  4ALX A;  4KBM B;  3PE0 A;  5GON E;  1S94 A;  3FBL A;  4EZ4 A;  5AFJ A;  2K24 A;  5LJM A;  2NTX A;  2B76 A;  3TLW A;  2BG9 C;  4DV6 T;  3AAE B;  4P0B A;  2D5U A;  3JCF A;  1IJ6 A;  5L3B B;  3KV9 A;  4IE0 A;  1SA0 E;  3U8J A;  1QSD A;  4CXY A;  3CQC B;  3ZYM A;  5KZU A;  2BVM A;  2FBW A;  3AE2 A;  5F5W A;  4H63 H;  3W15 B;  4LMK A;  2CHN A;  2BKN A;  4ILA A;  2V6Y B;  4DMV A;  3FZM B;  4O2A E;  2KXP B;  4YHH T;  4TWH A;  2P9B A;  5J5F A;  3KV6 A;  2IUB A;  3UU5 A;  2X00 A;  2XZ6 A;  2WS3 A;  3QK6 A;  4AFT A;  3KIN B;  4EOZ B;  4AIU A;  5C2T A;  1XWM A;  3ESL A;  2EHO B;  5CFB A;  4GYS A;  1MIV A;  4DR6 T;  2IIU A;  5CGM A;  3RI5 A;  4OFZ A;  3HL6 A;  4UV9 B;  3ZN1 B;  1OWA A;  2XQ5 A;  2WNC A;  3VR9 A;  2ODU A;  2BZB A;  2IC9 A;  2A72 A;  3P4S A;  4LFB T;  4X65 T;  2XTL A;  4YLH A;  2E9X A;  3AAI A;  2XNV A;  4YFS A;  3IBP A;  4E7S A;  3J9X 1;  2UXB T;  2XNU A;  3OVU A;  4JI8 T;  4PJL A;  3E0Z A;  4I55 E;  3UUX B;  2DNX A;  2WWU A;  3UFE A;  4BAY B;  1XNQ T;  1B7T A;  2QRX A;  4CQI A;  3H3M A;  3AA6 B;  3AVS A;  5LYJ E;  4ZI3 D;  4G63 A;  2KIN B;  4ZOL E;  2N2N A;  3UQ7 A;  1Y01 A;  3UT5 E;  2KZ7 B;  3IEE A;  2YME A;  3RIF A;  5EK4 A;  3P50 A;  3K3O A;  3L8R A;  5AQS B;  2V7K A;  3WI3 A;  3RGL A;  1GQE A;  4IHJ E;  2PTF A;  1T72 A;  2ZJV A;  3P4W A;  2XQA A;  4XAX B;  4CZZ B;  4L5G A;  4P1N A;  3CX7 B;  4LML A;  4HWD A;  4WBN E;  4UXU A;  4A98 A;  5ABF B;  4GK0 E;  5C3J A;  3CIR A;  3CX8 B;  2NW8 A;  2LKH A;  2IDO B;  1KNP A;  2EHO C;  2V8S V;  4TWD A;  1N34 T;  3ZC0 A;  4X62 T;  1WFD A;  3OYX A;  3PUA A;  5CB4 E;  1LVK A;  3B5M A;  5E0O A;  2D2S A;  4LFC T;  5ABG A;  2EHO A;  5AQP B;  4ERR A;  2YMD A;  4IDP A;  1W09 A;  3ANW B;  2I6H A;  3FZF B;  3A7M A;  2YU2 A;  2XYS A;  1AJ3 A;  1N33 T;  5FXX A;  3TLT A;  3ZT7 A;  2X0Y A;  3PUG A;  3TLS A;  3C64 A;  5JDN A;  2VL0 A;  3ZCJ A;  2X51 A;  2JIW A;  5L3G B;  4CXX A;  2XSA A;  1DU2 A;  4HTE A;  3CPZ A;  1I9B A;  3CQG B;  4U72 A;  2CPT A;  3H37 A;  5HWX A;  4B3R T;  4QKN A;  3UTK A;  1US7 B;  3O1I A;  2VQF T;  2XQ8 A;  4IE4 A;  5ETW A;  1SUM B;  4U7I A;  3QB5 A;  1O3X A;  2WAU A;  1HR0 T;  5LGU B;  5SYO A;  5HEU A;  2BBH A;  4AI6 A;  4JV5 T;  5LG4 A;  3G06 A;  2LHR A;  4IE6 A;  1V9D A;  3UUB A;  3J7Y q;  4BFQ A;  4LF7 T;  3Q5E A;  2E8I A;  2C5I T;  4OYJ A;  3I1A A;  3RC8 A;  3PUR A;  4ZK1 A;  4UEL A;  2KLQ A;  3AEC A;  3RF1 A;  4ZI2 C;  2C9T A;  1ZV4 X;  2LKG A;  2PG8 A;  4NXN T;  4QXB B;  2PGZ A;  1S35 A;  2J1D G;  3GMI A;  2XAG B;  1YQ3 A;  5TVC A;  2DI4 A;  2L3L A;  2Y54 A;  1IZN B;  3KDS E;  2LSI A;  5KMG P;  4FJO A;  4O4I E;  1HNW T;  2DWG A;  2V5C A;  2M6B A;  5HXS A;  5LJN A;  4B6X A;  2CM0 A;  4BA9 A;  3RQU A;  3ZT5 A;  4JI1 T;  5LNK A;  4HGA A;  2ZM0 A;  2X67 A;  5JRC B;  4G2A A;  2BYQ A;  2H3R A;  5J5G A;  2I0M A;  4WBO A;  3OYZ A;  4BJM A;  4L0R A;  1HX1 B;  1UX2 A;  4KI0 F;  4OYK A;  3B13 A;  2CXD A;  3AE6 A;  4CXW A;  5LHI B;  5L4E A;  2K3W A;  4LF5 T;  1W9R A;  1KK7 A;  5L47 A;  2CBI A;  2WM9 A;  5AFH A;  5AFL A;  3U78 A;  4YJ2 E;  5HAX A;  3Q9D A;  5LGN B;  5LXT E;  4YSX A;  5HCM A;  1E1H B;  5L2L A;  2V6X A;  2V26 A;  2BYN A;  3AA1 B;  4JBW F;  4DR3 T;  4QAC A;  2A2F X;  2VAS A;  4DUY T;  3ZCI A;  3N9O A;  4JLE A;  2BKP A;  2L8K A;  2QA7 A;  5JH7 E;  3IA3 A;  4PJJ A;  2F4V T;  4N78 D;  3N9P A;  4HFC A;  3ZT6 A;  4TNV A;  4JI7 T;  1MMA A;  4EZH A;  4DV7 T;  2H88 A;  2L9Q A;  4U33 A;  1N36 T;  5AQR B;  3NZQ A;  4PFP A;  3RKO A;  3UQ4 A;  3OPC A;  5AFM A;  5LBM A;  4AKL A;  4DR7 T;  5ABE A;  3PUZ F;  4I43 B;  5FL1 A;  2ZJU A;  3UU3 A;  2XZ5 A;  3MXZ A;  2BYR A;  2X0H A;  5L3C B;  3O1J A;  4HFD A;  3AEA A;  3Q2M A;  2CWY A;  2BG9 A;  3N9M A;  4ZR6 A;  4I50 E;  4EXT A;  4PNI A;  5DQV A;  2OLT A;  5L3E B;  2Y7Y A;  5A1L A;  1M62 A;  5LB7 B;  3RHW A;  5AFM B;  5CJ5 A;  5IWA T;  2V7J A;  3OKQ A;  3SIO A;  3OBV E;  2X66 A;  1HNZ T;  5JDF A;  3B57 A;  3OTO T;  5KDM C;  4JI0 T;  1D1B A;  3PDY A;  2W0G A;  3ZN0 B;  2KT9 A;  4HFB A;  3KFW X;  4YY3 T;  3FZL B;  1G8X A;  1NWM X;  3F2E A;  5J5I A;  1OED B;  2FJA A;  2IAK A;  1VCS A;  2W63 A;  2Z6E A;  3S4U A;  3AA7 B;  2X0L B;  2BS2 A;  3Q5X A;  2M6I A;  2VB6 A;  2LOP A;  1NEK A;  2NR4 A;  3VHL A;  3Q5W A;  3PMZ A;  4AFG A;  2BG9 B;  4DBR A;  3ETV A;  2XHE B;  4ZI3 C;  3EI0 A;  3ZJ1 A;  2WY2 A;  4QXC B;  2RA1 A;  4O4J E;  5DQW A;  4NUV A;  3JAF A;  4MBQ A;  4U3C A;  2Y58 A;  4CN1 A;  2W2U A;  4DV3 T;  4JUY A;  1BR0 A;  1HNX T;  1XDP A;  4DR1 T;  2JMH A;  5ABF A;  2LT3 A;  2PH9 A;  2KMF A;  4DBM A;  1EZ3 A;  2XSB A;  2GK9 A;  3AE1 A;  3GN5 A;  1QUU A;  5AFU L;  1WR0 A;  4KHZ F;  4X1I E;  2HN2 A;  4TZ4 C;  2X9Y A;  1OED A;  3CX6 B;  4CI2 B;  3RC3 A;  2JQ9 A;  3JAD A;  1FEW A;  2XAF B;  4B5D A;  3AXJ A;  5HWY A;  4AIS A;  3RYI E;  4DND A;  4ZXL A;  2UXC T;  4WYV A;  4GKK T;  1MIW A;  2QYW A;  3O4X E;  4MLK A;  3WTL A;  3WIP A;  4DMW A;  5F3J A;  4EZ1 A;  4H9N C;  2XQ3 A;  2HH7 A;  4YT0 A;  4ILC A;  3KVB A;  3QUJ A;  5ADX L;  1HG5 A;  2UUB T;  2VL8 A;  3EDV A;  5L4H A;  4AXP A;  1CUN A;  1G73 A;  3HKE E;  1D0X A;  3RKG A;  4PAG A;  3K3N A;  4UM3 P;  3FHN A;  5HCJ A;  3F31 A;  5AQJ B;  3I0O A;  4K0U A;  4HN9 A;  5AFN A;  2E2A A;  2Q9Q D;  3AE9 A;  1JNZ A;  2XQ7 A;  2BJ0 A;  2HPJ A;  2DHR A;  2LRL A;  2C5K T;  5HYA A;  1VCT A;  1HF8 A;  4UR9 A;  1MMN A;  5JDQ A;  4ANJ A;  2G0U A;  4FRR A;  3OJA A;  1MMG A;  4CI1 B;  4Z91 A;  4IL9 A;  2XAH B;  2Y57 A;  5KX5 E;  5EK2 A;  3FB2 A;  3A5X A;  3AB3 B;  3LBX A;  1M7K A;  1WR6 A;  5DAB A;  4HFI A;  3R84 B;  1LKX A;  2WSS V;  1D0Y A;  2B1E A;  1XNR T;  2MBG A;  3ABV A;  5AQI B;  3U8N A;  4JI6 T;  2BS3 A;  3ONJ A;  5L3D B;  2BR8 A;  3DP7 A;  3FXE B;  3HKB E;  4ILU A;  4NXM T;  4AKG A;  4X66 T;  4QX7 B;  2CBJ A;  1KF6 A;  5AQV B;  4F8H A;  5J0Z A;  5F8P A;  4TWF A;  2KSR A;  3SQ9 A;  3P4Q A;  5AIN A;  2H7O A;  3WTN A;  5LA6 E;  5AQO B;  5AQF B;  4IGU A;  4QAA A;  2BG9 E;  4KP3 C;  3CML A;  1UUR A;  3NRX A;  2CCQ A;  2Q9Q C;  2QGS A;  2QVA A;  5HEH A;  1XMQ T;  5FKY A;  1SHZ C;  3HKC E;  4CN6 A;  4ZRU A;  5JVD E;  3MAC A;  3AAA B;  4IDQ A;  4QH4 A;  1KEY A;  3CVR A;  4J2C A;  3U8K A;  3WTM A;  5CA0 E;  4ILB A;  1U5P A;  4KUM B;  3MK7 C;  3PU8 A;  3SS1 A;  4HWF A;  1E2A A;  2LSG A;  5HEJ A;  4NZB A;  3L09 A;  4ZS2 A;  5FY1 A;  2CRB A;  2JQK A;  4E7Z A;  2WNJ A;  3T1Y T;  1HX8 A;  3AEE A;  5FP3 A;  5BRX A;  1Z8U A;  1IJ5 A;  4COF A;  2MYS A;  2XM2 A;  5IHY A;  3FXD B;  3PUY F;  1YD8 G;  2C0S A;  2WDQ A;  5C8Y E;  2JRK A;  4A5X A;  3SFE A;  2N1G A;  2NTY A;  5LBQ B;  2WWV A;  5HXE A;  4A97 A;  1UUS A;  3RPU A;  4DR2 T;  2YEV C;  3RIU C;  3TKL B;  4UXN B;  3EVY A;  5FL0 A;  3V5S A;  3HI2 A;  2C5J A;  4EEB A;  2N9D A;  4KX6 A;  2FJE A;  3A8Y C;  2LRK A;  3L39 A;  1L0V A;  2WZI A;  5AQH B;  2LJL A;  1HFA A;  4EED A;  3ZLI A;  2XQ6 A;  3ONL C;  2UXN B;  2X68 A;  3AE4 A;  2VQE T;  4UF0 A;  4OK0 A;  4H9P C;  4GKJ T;  3F57 A;  2LEH A;  3C50 A;  4JEH B;  1XDO A;  3E08 A;  5FNV E;  3BK9 A;  1X79 A;  2XAQ B;  3GN5 B;  5CA1 E;  2I59 A;  5JDG A;  1UX4 A;  3O9X A;  3MZK B;  3P7I A;  1WRD A;  1X9B A;  2XNT A;  3TLV A;  2XJ7 A;  5AQU B;  3WTH A;  2ACZ A;  4QWN B;  3N9N A;  2WZY A;  3RYH E;  4UVC B;  2XAS B;  5HXH A;  2PBI A;  4JI5 T;  2H7V C;  4XZC A;  2HN1 A;  2VUR A;  3AA0 B;  2CWO A;  3KVA A;  5JRE A;  5JR9 B;  5LGT B;  1XMO T;  4EV6 A;  4H9O C;  2UU9 T;  3PUS A;  2ES0 A;  4JI4 T;  4OX9 T;  1T7S A;  3H3A A;  2VKD A;  3LSV A;  2V1D B;  4HEA A;  2H89 A;  4WNK A;  4AQG A;  2W4X A;  2Y8D A;  3CKD A;  4UVB B;  5J2T E;  3M3Z B;  2WU2 A;  4HFV A;  2FJD A;  3ZDH A;  3T1H T;  4TX5 A;  4A56 A;  4YTN A;  4IE5 A;  1WCR A;  3KBT A;  4EGW A;  4UF0 B;  4QXH B;  3UUL A;  4YXD A;  2CHO A;  4DV5 T;  3ZMT B;  4EAH A;  4ZHQ E;  1D1A A;  3T8O A;  4AFH A;  4ZI2 D;  2XQ9 A;  1Y64 B;  4U7Y A;  3C4W A;  5FY7 A;  4JEU B;  2NW7 A;  1H7C A;  2JJ9 A;  3EAM A;  3U8L A;  4X20 E;  1WYB A;  1YXR A;  3WTI A;  4O8S A;  3LJC A;  4AQF C;  5HXR A;  3PTR B;  3UFG A;  5AQM B;  4JYA T;  3LK3 B;  2CA5 A;  3GUA A;  3GWH A;  4P0A A;  4Z90 A;  4DO0 A;  4AQF A;  2KWH A;  4O4H E;  4DV1 T;  4YTP A;  1MIY A;  3N2G E;  2RP4 A;  3RIA A;  3SH1 A;  3C84 A;  3ZDG A;  1ZP0 A;  1J5W A;  5HXC A;  5FXV A;  2JPF A;  4ADZ A;  4X64 T;  1N32 T;  5AQG B;  5AQQ B;  3I9Y A;  4H9Q C;  5TAO A;  5BR8 T;  3MA9 A;  2NP9 A;  2BR7 A;  2ZLY A;  3N2K E;  3C4X A;  1E7P A;  2CMR A;  3PUX F;  4ZZC A;  3DJB A;  2WQY A;  4H9R C;  3ZYL A;  3RX6 A; 
#chains in the Genus database with same CATH homology
 2LLY A;  4HFC A;  2BYS A;  4TNV A;  4UY2 A;  4ZK1 A;  3ZDH A;  2W8F A;  2LKH A;  4QAA A;  2XYT A;  2C9T A;  2BG9 E;  2LKG A;  4IL4 A;  2W8G A;  4TWD A;  2XNV A;  4UM1 A;  4X5T A;  3TLW A;  2PGZ A;  2BG9 C;  3PMZ A;  1UV6 A;  4LMJ A;  4AFG A;  4QAB A;  2BG9 B;  4UM3 P;  2XNU A;  5TVC A;  2XQ6 A;  2Y54 A;  5HCJ A;  3UQ4 A;  3EI0 A;  5HEH A;  4XHE A;  3ZKR A;  5KE4 A;  5AFM A;  3TLU A;  4ZRU A;  2YMD A;  5AFN A;  4ZZB A;  3U8J A;  4QH5 A;  2WNL A;  5CO5 A;  3WTJ A;  4UM3 S;  3IGQ A;  5J5H A;  5KZU A;  2M6B A;  4QH4 A;  3JAF A;  2QC1 B;  4XK9 A;  4AFH A;  2YOE A;  3WTO A;  2XYS A;  2Y58 A;  3SQ6 A;  2Y56 A;  2ZJU A;  2LM2 A;  2XQ9 A;  2XQ7 A;  2BJ0 A;  3TLT A;  3EHZ A;  3RQU A;  3UU3 A;  3TLS A;  3UU8 A;  3U8K A;  4LMK A;  3WTM A;  2XNT A;  3TLV A;  2XZ5 A;  5BP0 A;  4ILB A;  4UM3 A;  3WTH A;  5HEG A;  3PEO A;  2BYR A;  2VL0 A;  2PH9 A;  4DBM A;  4ILA A;  2WZY A;  2X00 D;  5LXB A;  4FRR A;  3EAM A;  3U8L A;  4ZJT A;  4Z91 A;  2BYQ A;  5J5G A;  3WTI A;  4IL9 A;  3UQ7 A;  4HFD A;  4TWH A;  2Y57 A;  3JAE A;  2XQ4 A;  5IUX A;  1UX2 A;  5J5F A;  2BG9 A;  4PIR A;  5HEJ A;  4NZB A;  3UU5 A;  4ZJS A;  4ZR6 A;  1I9B A;  3C79 A;  2BYP A;  2X00 A;  5L4E A;  4HFI A;  2WNJ A;  2XZ6 A;  2YME A;  1OED A;  3GUA A;  3RIF A;  2Y7Y A;  4AFT A;  4BQT A;  4Z90 A;  5BRX A;  4D01 A;  3P50 A;  3RHW A;  5AFM B;  4COF A;  3JAD A;  5FJV A;  4HFE A;  4QH1 A;  3T4M A;  5CFB A;  4B5D A;  5L47 A;  3U8N A;  2XQ8 A;  5AFH A;  3RIA A;  4HFH A;  2WN9 A;  4ZK4 A;  3SH1 A;  3SIO A;  5AFL A;  2YN6 A;  3C84 A;  2BR8 A;  2UZ6 A;  3ZDG A;  1OED E;  3RI5 A;  4NPP A;  3UU6 A;  5JME A;  5HCM A;  2ZJV A;  4A97 A;  3RQW A;  4F8H A;  3LSV A;  3WTL A;  4IRE A;  5J0Z A;  3UU4 A;  5SYO A;  3WIP A;  3P4W A;  4TWF A;  2KSR A;  2XQA A;  5HEU A;  2BYN A;  4QAC A;  3SQ9 A;  2YKS A;  4HFB A;  3U8M A;  2XQ5 A;  4EZ1 A;  4TNW A;  2MAW A;  5LG3 A;  4WV9 A;  1OED C;  2XQ3 A;  4LML A;  1OED B;  2WNC A;  4ALX A;  3WTK A;  5J5I A;  3UUB A;  2BR7 A;  5BW2 A;  4ILC A;  4BFQ A;  1UW6 A;  5HEO A;  5AIN A;  4HQP A;  4UXU A;  4ZZC A;  5AFK A;  4A98 A;  5AFJ A;  2M6I A;  3WTN A;  5L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...