2XQ3A

Pentameric ligand gated ion channel glic in complex with br-lidocaine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq3A01
4ZR6A 4ZZBA 5AINA 1I9BA 2BYRA 5J5GA 3UU8A 2C9TA 4HFEA 3JADA 2X00A 5SYOA 2WN9A 2BG9A 5J5HA 5HCJA 4Z90A 3WTKA 5HEUA 3EAMA 4D01A 2WNJA 2M6BA 3T4MA 4AFHA 3WTHA 4ZK1A 3U8MA 3UUBA 5L4HA 3U8LA 5BP0A 2BYSA 4ZK4A 4A97A 2XQ8A 3UQ7A 4XK9A 5HEHA 3LSVA 4COFA 3WTOA 3UU4A 3UU3A 4ILCA 3RQWA 2BJ0A 3PMZA 5KE4A 2XNVA 2BG9C 4QABA 4UXUA 3SQ9A 4WV9A 4TWDA 2XQ7A 3RQUA 4ILAA 2BYPA 3C84A 5IUXA 4LMJA 5L47A 5LG3A 1UV6A 2UZ6A 3WTIA 2WNCA 3UU5A 3TLTA 3ZKRA 4XHEA 2PH9A 4HQPA 5HCMA 2XQ6A 4HFDA 5L4EA 2KSRA 2WNLA 5CO5A 5HEOA 3UQ4A 2BYQA 4ALXA 2WZYA 5AFNA 3WTJA 3EHZA 3EI0A 5J0ZA 2LLYA 4ZJTA 4AFGA 5AFMB 4TNVA 4ZRUA 2XZ5A 2Y54A 2XNUA 4HFHA 3U8KA 1UW6A 2W8FA 5J5FA 2XQ4A 4AFTA 4NPPA 4UM3A 4IL9A 3UU6A 3RI5A 4NZBA 4TWHA 5FJVA 3SQ6A 2BR8A 2XNTA 3WTMA 5LXBA 4TWFA 2M6IA 2BG9B 2LM2A 2XQ9A 5HEGA 4A98A 5CFBA 4B5DA 4DBMA 5AFLA 4UM1A 4QH5A 4IL4A 4Z91A 4BQTA 2ZJVA 2XQ3A 1OEDC 2XQ5A 5J5IA 4HFIA 5BW2A 5KZUA 3P50A 3GUAA 2QC1B 2BR7A 4FRRA 5AFJA 5AFMA 4ZZCA 4UM3P 4HFBA 3WIPA 4X5TA 5TVCA 3TLSA 3RIFA 3ZDGA 2YN6A 2XZ6A 3TLWA 3U8JA 4UY2A 2PGZA 2VL0A 4ILBA 4LMLA 3WTNA 3JAFA 1OEDB 3P4WA 4PIRA 5JMEA 2Y56A 4HFCA 2LKGA 4QAAA 3TLVA 4F8HA 2BYNA 2XYTA 4QACA 2XQAA 2Y58A 3TLUA 4ZJSA 2W8GA 5BRXA 1UX2A 5AFHA 3RHWA 3IGQA 3SIOA 3RIAA 2YKSA 4BFQA 2X00D 2Y7YA 1OEDE 2LKHA 3WTLA 2Y57A 5HEJA 3U8NA 3ZDHA 2MAWA 3JAEA 4QH1A 3PEOA 4TNWA 4EZ1A 4IREA 2YMEA 4LMKA 4UM3S 2BG9E 5AFKA 2YOEA 4QH4A 2YMDA 2ZJUA 1OEDA 3C79A 3SH1A 2XYSA
chains in the Genus database with same CATH superfamily
3SWHA 5KX5E 3ZYMA 3AAEB 4HFEA 1N33T 3ZMZB 5HCJA 2BBJA 5AQQB 1W0AA 2D9DA 5CA1E 1UCUA 2OLTA 3ABVA 4UF0A 1HX1B 1IJ5A 2KZ7B 5KMGP 3SQ9A 4WV9A 4QXHB 2BBHA 1U4QA 4HWDA 1X9BA 3K1SA 2CE7A 2CWYA 2WZHA 4YY3T 1MMAA 3M3ZB 4AQFC 4AKGA 2QGSA 4Q25A 5LNKA 5L3DB 2CHNA 3OVUA 4L0RA 5AQJB 4AKIA 5AQKB 1H7CA 1XDPA 1UGOA 2LM2A 4DV0T 4IDPA 2CM0A 3ZN0B 4UR9A 1GQEA 5L3EB 3FXEB 4BA9A 5M4YA 5ABFB 4LF7T 2CPTA 3FXDB 4YLHA 3KV4A 1UX2A 3RHWA 2IC6A 3SIOA 1WFDA 4HEAA 1YQ4A 3AA7B 3ZN1B 4UELA 3PEOA 2VK9A 4CN1A 3I0QA 4LMKA 2QRXA 3R6NA 5AFKA 4E7SA 4AKHA 1OEDA 4YHJA 5LMNT 2J62A 4ZZBA 4IDZA 2VVSA 5HXCA 4OYJA 1J5WA 4ZHQE 4DVDA 4XZCA 4XBFB 4UIGA 2GK9A 4COFA 4DBQA 3WTOA 4X66T 2V26A 2A2FX 3C50A 2YK0A 4HTEA 5KE4A 4ILAA 2SPCA 3BK9A 4CN6A 2E5VA 4FI5A 2IHR1 1UV6A 4WYVA 2WMNA 2JIWA 4JI2T 2CXLA 1HG2A 3MK7C 3O1HA 2UU9T 4U31A 5ADXL 1AJ3A 4UM3A 1WR6A 4QXCB 4TWHA 4UVBB 4DR5T 5AFLA 3OBVE 2A72A 2NWBA 3J9X1 3E08A 2UXDT 5FMNA 2YINA 3N2OA 4I0UA 2BS4A 1NENA 2UXBT 2LRKA 3U8JA 1W0BA 3AEEA 4I43B 2KMFA 5F5WA 3WAJA 3ZMVB 4PIRA 5ABGA 2LKGA 4AISA 3P4RA 4LF5T 2UUBT 4DR1T 4QWNB 4FJOA 5IHYA 3SS1A 2AE9A 4H9QC 5FY0A 2ZM6T 4IREA 2JRKA 2YMEA 4MHCA 2F4VT 1BR4A 4KMCA 4GIWA 3SFDA 3N9OA 5LHGB 4WW0A 3FBLA 3EDVA 4JEHB 3M65A 3LK3B 2VKOA 4ZS3A 5AQFB 2UUCT 4ZK4A 2MBGA 4A97A 3AAAB 5HWXA 4G2AA 4ILCA 3RQWA 1UX5A 2NR4A 2XY8B 3ZT5A 5JH7E 3K3OA 5IUXA 3QB5K 5H6RB 4DR2T 3UU5A 2C5KT 3BQLA 5LOVE 1X79A 2XQ6A 2WZYA 3WTJA 1SE7A 3HL6A 4WZXA 5HYAA 2D5UA 1W09A 3F57A 4TWFA 3KDSE 4YJ3E 1MIWA 4JV5T 2XM1A 5J1GA 4X64T 3ZC1A 2BS3A 1FIOA 5FNVE 2IW5B 3AE8A 5KXJA 5IYZE 2LSKA 2ACZA 5AQSB 3ZT6A 2K48A 3WTLA 1YQ3A 2FBWA 3ZC0A 2CXDA 5KDMC 4EZHA 3C51A 4IHJE 3AE6A 3Q5XA 3I1AA 5HXEA 1ZKEA 3AVRA 2XASB 3AEGA 4B3RT 3JADA 2XQYA 4MBQA 5FVKA 3B5MA 3OYXA 1D0XA 1CUNA 2BDEA 3ZCJA 3AEAA 1J1JA 3QC9A 2CLYC 2BG9C 4IE5A 3U78A 3L3PA 5H6QB 3CX8B 5BMVE 3SRZA 2X66A 4DR4T 2G0UA 3RKGA 1EZ3A 4UXNB 4AXPA 3H3AA 3KINB 5JDQA 4MFRA 5J5FA 4AFTA 2WDVA 5LMUT 5FJVA 5AQNB 4OX9T 3C4WA 3VRBA 1XNQT 3PU3A 4I4TE 3CIRA 4U7YA 4ZZCA 3WIPA 3IEEA 3TLSA 3L8RA 4DV2T 3ZPOA 2VL0A 4ILBA 2DNXA 3P4WA 2K24A 4TN7B 2RA1A 3OJAA 2XM2A 4ZI2C 3LK2B 2HH7A 4XAXB 3AEDA 4GK0E 3U8NA 2EHOC 2N9DA 2MAWA 2LJLA 3W15B 2V1DB 3ONJA 4YHHT 3FB2A 3EABA 4QH4A 1W9RA 2EHOD 3PUYF 4ZR6A 3O9XA 3B57A 5J5GA 3H3MA 5AQGB 3FZMB 3EAMA 4AFHA 4PK4A 3GN5A 1QLBA 3RIUA 3WI3A 3QNUA 5JREA 4CZZB 3N9QA 3PV0F 2FUPA 5AFUL 3CQXC 2E8IA 2CWOA 2X9WA 2KT9A 3LJCA 4UV8B 2KINB 2WWUA 2XAGB 3AEBA 4IE7A 3MXZA 3AXJA 2DL1A 3FZHB 2WBLA 1CHUA 3AEFA 5FYMA 3ZSTA 3C64A 5LJMA 4GKKT 4EOZB 2H88A 2IDOB 3RPUA 2WDQA 2WQYA 4GYSA 2XUEA 2I59A 4QH5A 4IL4A 1XDOA 2W66A 4JI5T 2XTLA 4H9PC 1Z8UA 4DV5T 2NTYA 2X0YA 3UFGA 3L39A 3C4XA 4GOUA 5AFHA 3ZSSA 3T1YT 4IT4A 2YKSA 1BR1A 2LKHA 5AQUB 3P4QA 2DCFA 3JAEA 2E5LT 4AQGA 4U74A 4EZ1A 1L0VA 2WM9A 4UVCB 2YOEA 4IE6A 1U5PA 2LOSA 3UFEA 2QYWA 3C79A 5LG4A 4EXTA 2LHRA 3ZMUB 3O1JA 4IE0A 3WTKA 2KWHA 4D01A 2WNJA 2UXNB 2XHEB 3PMZA 3LBXA 2D2SA 4TWDA 4YJ2E 4CXYA 3VHLA 2UZ6A 2WNCA 1UURA 2Q9QD 2BKPA 2KSRA 4NXNT 4HWHA 2XJ7A 3EHZA 3P4PA 1SUMB 5LJNA 4HN9A 1NEKA 4JBWF 5FL1A 4EB6E 1V9DA 5AQHB 3P7IA 2H7OA 2JPFA 4KUMB 5F8PA 4PJMA 2C5IT 4KX6A 3RF1A 2I6HA 2L9QA 3ZYKA 4DV7T 2WY2A 4X1IE 4PW8A 1SA0E 4O2BE 4B3MT 3TLVA 2BS2A 3RX6A 3TLUA 4K0UA 3RLFF 5LGNB 3IGQA 4V1Av 2X9HA 3PUAA 2Y8DA 2Y7YA 1OEDE 3ANWA 5HXRA 2VKHA 2H3RA 3N2KE 1VCTA 3VU7H 4ASKA 2YDRA 3IA3A 4DMWA 4CI3B 3VR9A 4ZOLE 5SYOA 4JI1T 2XAHB 4P1NA 4YSYA 2CBJA 4PNIA 3VR8A 2V7KA 1KF6A 5L3FB 4C90A 2E9XA 3RIUC 2CCQA 2Q9QB 2DWGA 1ZV4X 3AA6B 5HCMA 4GKJT 3UQ4A 5J0ZA 4U33A 1LKXA 4H63V 5JRCA 2CLYB 4X62T 2A9UA 4E7ZA 3QOFA 4TV9E 4K0KT 1E7PA 3EDUA 1MMNA 3ZLIA 5BW2A 3KBUA 4JYAT 3OKQA 2QC1B 5C2TA 2KWIB 2BVMA 2JMKA 3D0TA 3JAFA 2Y56A 4U2ZA 4CI2B 5AQIB 2BYNA 4TUYE 2W8GA 1FMVA 4DV6T 2FJAA 3RIAA 3HA4A 4YSZA 4EYUA 1KK7A 5HEJA 4QH1A 2K9AA 4CN4A 5F3JA 4DV4T 1IJ6A 2ZJUA 1M7KA 3N9LA 3V5UA 2WCAA 3ETVA 4TV8E 2BZBA 4IGUA 4O4IE 2CRBA 5AQTB 1NWMX 2ZM8A 2NW7A 3KV5A 3BQKA 3TKLB 2ODUA 5AQMB 3QB5A 3PUVF 3CVRA 2XNVA 3RQUA 5ETWA 1MMGA 5LBQB 4ZI3D 5LG3A 5DABA 2WP9A 2RP4A 4HFDA 3CMLA 5L4EA 1FJGT 1FEWA 4YTMA 5CA0E 4HE8A 2P9BA 2JQQA 2YEVC 3Q5EA 5FXVA 2V5CA 4F6RC 3QUJA 4NZBA 5LXTE 2YDQA 4EZ4A 2V6YA 4IDQA 2E9XC 4Z91A 4YT0A 5L3GB 5KZUA 3GUAA 4UM3P 4X5TA 2EHOA 5EK3A 3TLWA 5LBMA 3Q5WA 1MNDA 3U3IA 4QAAA 3PUQA 1LVKA 2Q9QC 3I0OA 2XAJB 3GA8A 2LSIA 4WNKA 3B13A 1YXRA 3OYZA 4X20E 4JI7T 3HR0A 4H9RC 2CBIA 3UT5E 1UUSA 3LFMA 4BJNA 5FXZA 2QVAA 3SH1A 5BR8T 4YFSA 5AINA 2BYRA 3UU8A 5LHHB 3PJAA 4C91A 2BG9A 4HWFA 3QK6A 2HHHT 2V6XA 3UUBA 2L3LA 2XSAA 1YD8G 4BAYB 2H7VC 2W67A 4IDNA 3SOLA 5DQWA 2HN1A 3TLTA 3ZKRA 3C98B 2VWAA 2LLYA 5AQVB 5HAXA 4NUUA 4PK5A 4L9IA 4LF8T 4EAHA 2XNUA 4HFHA 2PFVA 3U8KA 2VURA 3RC8A 3I9YA 5LGTB 2NOXA 1N34T 3CQCB 3UTKA 3F2EA 5JR9A 2ZJVA 2XQ3A 1D0ZA 2XQ5A 2C5JA 2H89A 5AFMA 4OYKA 2NP9A 3RIFA 2XZ6A 4HWCA 4LFCT 2D0UA 4A5XA 1OEDB 4P0AA 2LOPA 1XMOT 2V7JA 4U3CA 1I6ZA 1T7SA 3CK6A 5FY1A 2WAUA 5JTGA 5LB7B 3RYHE 2CMRA 3N9MA 2Y57A 2B76A 3ESLA 1G8XA 3RRWA 4EIWA 2WU5A 1HR0T 4EGWA 1O3XA 2NW8A 4KHZF 3J7Yq 2LRLA 4H9SE 5E0OA 4H63H 4ZEYA 4QKNA 2W62A 5DJQC 2NTXA 3S4UA 4QX8B 4LFAT 3KV6A 4ZS2A 3JC6C 5JDLA 1BR0A 1WYBA 3T8OA 3LSVA 2OV9A 2WSSV 1KNPA 1HNZT 1HFAA 3MA9A 2DI4A 5EZYE 3C84A 1XWMA 5L47A 3G06A 4I50E 5HEOA 5AFNA 3VKHA 3EI0A 4TNVA 5LP6E 2PTFA 3AE1A 4AQFA 2KXPB 2IC9A 2X68A 2PJQA 5FL0A 1YW0A 3X1DA 4MALA 4EEDA 1M62A 1ZHCA 2E2AA 5AFJA 2LT3A 4PJJA 3AXJB 4B6XA 3ZYLA 3AE4A 2PGZA 4AKLA 4JEUB 1HF8A 4WBOA 2DLRA 1D0YA 2JMHA 4EYYR 3Q9DA 3NKZA 2X00D 2J1DG 1DU2A 3IF8B 4O8SA 3DP7A 5C8YE 3ZCIA 4DV1T 4DBRA 3KFWX 4P09A 3ZEFB 1NAFA 5JDHA 2VB6A 1LVFA 3ZMTB 3OPCA 2VL8A 5FKYA 3GN5B 2VQET 2QA7A 1MMDA 3PUXF 2N1GA 5LCYA 1OWAA 3WTHA 4PFOA 2C0SA 3MACA 5L3BB 5L2LA 2ODVA 1IBKT 1HS7A 4H9OC 2IAKA 2BJ0A 2XSBA 4UXUA 2YU1A 2WS3A 2LSJA 3ONXA 3RYCE 3WTIA 5FXWA 3C4ZA 4IDOA 2W4XA 3AVSA 4GK5E 5A1LA 5JR9C 2UUAT 3UULA 2Y54A 4LFBT 4DNDA 3A5XA 3Q5DA 4GYRA 4O4LE 3VKGA 3RH3A 3UU6A 3AA0B 5L3CB 3Q2MA 4X1YE 1HNWT 4DBMA 3WAKA 4BQTA 1HNXT 1QUUA 2KNDA 1XNRT 4UVAB 2WWVA 2BR7A 5TVCA 1Z0PA 3LG7A 4UY2A 2N2NA 3RYFE 2W0GA 3FZFB 2LEHA 4QHOA 2ZM0A 5JDMA 2CHOA 4YTPA 4JUYA 5CB4E 1J5ET 2XQAA 2Y58A 3T1HT 3NRXA 1IZNB 1JNZA 2JJ9A 3PDYA 1S94A 2YDSA 3PUWF 2Z6EA 4O4JE 3CQGB 3IBPA 2R6GF 3AE3A 5GONE 1WRDA 4JI4T 2ZLYA 2VASA 2YU2A 4Z90A 1VCSA 3AE9A 3LDQB 5HEUA 4PJLA 5L4HA 2IMLA 5BP0A 3DJBA 2HPJA 2V6YB 4CQIA 4X65T 3AE5A 2XQ7A 4O2AE 2L8KA 3N9PA 4U2YA 2W2UA 2CA5A 2VQFT 5DQVA 3PE0A 2LSYA 4TX5A 4JI6T 2OA5A 4IIJE 5LA6E 4ALXA 2XAQB 1E1HB 2WZIA 2MOZA 2M67A 2WDRA 4AFGA 2XZ5A 4JI0T 3ZJ1A 1IBLT 2MTQA 3PTRB 4ZI2D 1G73A 1SHZC 2V7MA 5FY7A 5LHIB 2MYSA 3MKDA 2M6IA 4A56A 2BG9B 2XAFB 5HEGA 4UM1A 3FZKB 1WYCA 3P50A 3DTOA 1VOMA 4HFBA 2PBIA 2IUBA 3AB3B 3BQIA 4DR3T 3WTNA 5ABFA 4L5GA 5ABHA 1YKHB 4PK6A 4OFZA 3KBTA 4OHFA 2NW9A 2I0MA 3ZDHA 5AQPB 2BG9E 3RRCA 3AE7A 3NRYA 2HPLA 3OTOT 3CPZA 1I9BA 3AE2A 2LHNA 4U72A 2E9XB 3H37A 2M6BA 3CX6B 3N9NA 3JCFA 3A7MA 5J2UE 2Q9QA 3UQ7A 4UV9B 4DR7T 2MPKA 5JR9B 3UU3A 4YXDA 1ZOYA 4QABA 3PUGA 4LMJA 3KVAA 1Y64B 1S35A 5JDFA 2PH9A 4HQPA 5CO5A 4UEMA 1MNEA 1D1AA 1WLXA 3EVYA 5AFMB 4ISTA 4AKRB 4DUZT 2W8FA 5AQOB 2V7LA 5LYJE 5JRCB 2JQKA 3E22E 4YSXA 4KI0F 4A98A 3ZT7A 4O4HE 2X0HA 2V8SV 4FRRA 2IIUA 1D1CA 2X0LB 3V5SA 5FVLA 1IAPA 1HX8A 3AAIA 4AIUA 4PJNA 4KBMB 3HKBE 2XYTA 4M1PA 2FJDA 1N32T 4QX7B 3K3QC 4ZI3C 2DWKA 4HGAA 4BFQA 4LF6T 5J2TE 4X1KE 4CXWA 3PU8A 3LK42 1ZP0A 2YMDA 2JQHA 3FHNA 4ERRA 3NBXX 4DIDB 3SFEA 2WN9A 1N36T 5J5HA 5JDGA 1KEYA 3N2GE 1JNRA 1MIYA 3U8MA 1BR2A 3FBZA 2Y48B 3N5LA 4XK9A 4LF9T 3JC6D 4NUVA 5C3JA 4I55E 5AQRB 4BJMA 5IWAT 1WR0A 2AXDS 3HKEE 3NZPA 2DHRA 1OXZA 3ANWB 2WNLA 1T72A 1D1BA 4ZJTA 4J2CA 4N78D 3LBXB 3ZJ2A 4IL9A 5EK4A 2BR8A 5LXBA 2CEAA 1T98A 4DV3T 2W61A 3CX7B 2X9YA 2V7IA 3PJAJ 4HFIA 4JI3T 2X51A 3ZDGA 4ZI7E 2E9XD 5JQGE 4EEBA 1I94T 2ZM2A 1HCIA 3IHRA 3I9WA 3UUNA 4H9NC 2CXFA 1YKEB 3PUSA 2EHOB 2D0TA 1UK5A 4B3ST 5TAOA 4KHPT 3O1IA 4HWIB 5BRXA 1VRBA 3EUHA 4YTNA 3RGLA 3HKDE 3AECA 5HXHA 2W63A 4JI8T 2ZMAA 4PFPA 4UM3S 2J47A 5HXSA 2XYSA 4HFVA 4MLKA 1IBMT 3NZQA 2ES0A 1XZYA 1QSDA 4KP3C 3CKDA 5LGUB 2X00A 2UXXB 2WMOA 3O4XE 3T4MA 2BYSA 2XQ8A 4LF4T 5HEHA 3UU4A 1HTJF 4DUYT 4CXXA 2BYPA 2FJBA 4B3TT 2ACXA 4XHEA 4QXBB 3ZMSB 4AI6A 1WCRA 2BKNA 4ZRUA 5JVDE 3E0ZA 2K5BB 5CJ5A 4CI1B 1UX4A 5AQLB 5JDNA 1UW6A 2WU2A 2XPKA 3RI5A 3SQ6A 3HI2A 4AQYT 3R84B 3HKCE 3GMIA 1OEDC 5FXXA 3FZLB 3KV9A 2BVLA 5EK2A 1ZEEA 2V5DA 3K8PC 4PAGA 2VKJA 3MJXA 4LMLA 4JLEA 5JMEA 2FJEA 4QACA 3ETUA 3NWIA 4DR6T 2K3WA 4DO0A 2JQ9A 4TNWA 3K3NA 5CGMA 3A8YC 1KNZA 2C9TA 1XMQT 2X9XA 1B7TA 1KNRA 4ZXLA 2X67A 2J4GA 2LSGA 4ZK1A 3UUXB 2KLQA 3PUZF 1KFYA 3U8LA 2VVNA 4HKAA 3AA1B 4Z8XA 2HN2A 3MZKB 4WBNE 2VKDA 3GWHA 2PG8A 4ILUA 3NVOA 2UXCT 4DMVA 4IE4A 2BYQA 1FMWA 3VRAA 1R8IA 4ADZA 1T8BA 5HWYA 4EV6A 1E2AA 3P8CD 2XQ4A 4NPPA 5ABEA 3WTMA 2XNTA 2RPAA 3RKOA 2XQ9A 5CFBA 3L09A 1US7B 4TZ4C 5FP3A 4B5DA 4G63A 2BKOA 4P0BA 5J5IA 2XZEA 4OK0A 3ONLC 2YN6A 2LE8A 3F31A 2B1EA 4U7IA 4NXMT 2LM9A 1LRZA 2WB5A 4HFCA 3UUMA 4F8HA 4ZJSA 4ISSA 4UF0B 4NIQA 1MIVA 4ANJA 2A3DA 3CWZB 3RC3A 1HG5A 2Y6XA 2W00A 3PURA 1Y01A 3P4SA 3KVBA 3RYIE
chains in the Genus database with same CATH topology
4ZR6A 4ZZBA 5AINA 1I9BA 2BYRA 5J5GA 3UU8A 2C9TA 4HFEA 3JADA 2X00A 5SYOA 2WN9A 2BG9A 5J5HA 5HCJA 4Z90A 3WTKA 5HEUA 3EAMA 4D01A 2WNJA 2M6BA 3T4MA 4AFHA 3WTHA 4ZK1A 3U8MA 3UUBA 5L4HA 3U8LA 5BP0A 2BYSA 4ZK4A 4A97A 2XQ8A 3UQ7A 4XK9A 5HEHA 3LSVA 4COFA 3WTOA 3UU4A 3UU3A 4ILCA 3RQWA 2BJ0A 3PMZA 5KE4A 2XNVA 2BG9C 4QABA 4UXUA 3SQ9A 4WV9A 4TWDA 2XQ7A 3RQUA 4ILAA 2BYPA 3C84A 5IUXA 4LMJA 5L47A 5LG3A 1UV6A 2UZ6A 3WTIA 2WNCA 3UU5A 3TLTA 3ZKRA 4XHEA 2PH9A 4HQPA 5HCMA 2XQ6A 4HFDA 5L4EA 2KSRA 2WNLA 5CO5A 5HEOA 3UQ4A 2BYQA 4ALXA 2WZYA 5AFNA 3WTJA 3EHZA 3EI0A 5J0ZA 2LLYA 4ZJTA 4AFGA 5AFMB 4TNVA 4ZRUA 2XZ5A 2Y54A 2XNUA 4HFHA 3U8KA 1UW6A 2W8FA 5J5FA 2XQ4A 4AFTA 4NPPA 4UM3A 4IL9A 3UU6A 3RI5A 4NZBA 4TWHA 5FJVA 3SQ6A 2BR8A 2XNTA 3WTMA 5LXBA 4TWFA 2M6IA 2BG9B 2LM2A 2XQ9A 5HEGA 4A98A 5CFBA 4B5DA 4DBMA 5AFLA 4UM1A 4QH5A 4IL4A 4Z91A 4BQTA 2ZJVA 2XQ3A 1OEDC 2XQ5A 5J5IA 4HFIA 5BW2A 5KZUA 3P50A 3GUAA 2QC1B 2BR7A 4FRRA 5AFJA 5AFMA 4ZZCA 4UM3P 4HFBA 3WIPA 4X5TA 5TVCA 3TLSA 3RIFA 3ZDGA 2YN6A 2XZ6A 3TLWA 3U8JA 4UY2A 2PGZA 2VL0A 4ILBA 4LMLA 3WTNA 3JAFA 1OEDB 3P4WA 4PIRA 5JMEA 2Y56A 4HFCA 2LKGA 4QAAA 3TLVA 4F8HA 2BYNA 2XYTA 4QACA 2XQAA 2Y58A 3TLUA 4ZJSA 2W8GA 5BRXA 1UX2A 5AFHA 3RHWA 3IGQA 3SIOA 3RIAA 2YKSA 4BFQA 2X00D 2Y7YA 1OEDE 2LKHA 3WTLA 2Y57A 5HEJA 3U8NA 3ZDHA 2MAWA 3JAEA 4QH1A 3PEOA 4TNWA 4EZ1A 4IREA 2YMEA 4LMKA 4UM3S 2BG9E 5AFKA 2YOEA 4QH4A 2YMDA 2ZJUA 1OEDA 3C79A 3SH1A 2XYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZR6 A;  4ZZB A;  5AIN A;  1I9B A;  2BYR A;  5J5G A;  3UU8 A;  2C9T A;  4HFE A;  3JAD A;  2X00 A;  5SYO A;  2WN9 A;  2BG9 A;  5J5H A;  5HCJ A;  4Z90 A;  3WTK A;  5HEU A;  3EAM A;  4D01 A;  2WNJ A;  2M6B A;  3T4M A;  4AFH A;  3WTH A;  4ZK1 A;  3U8M A;  3UUB A;  5L4H A;  3U8L A;  5BP0 A;  2BYS A;  4ZK4 A;  4A97 A;  2XQ8 A;  3UQ7 A;  4XK9 A;  5HEH A;  3LSV A;  4COF A;  3WTO A;  3UU4 A;  3UU3 A;  4ILC A;  3RQW A;  2BJ0 A;  3PMZ A;  5KE4 A;  2XNV A;  2BG9 C;  4QAB A;  4UXU A;  3SQ9 A;  4WV9 A;  4TWD A;  2XQ7 A;  3RQU A;  4ILA A;  2BYP A;  3C84 A;  5IUX A;  4LMJ A;  5L47 A;  5LG3 A;  1UV6 A;  2UZ6 A;  3WTI A;  2WNC A;  3UU5 A;  3TLT A;  3ZKR A;  4XHE A;  2PH9 A;  4HQP A;  5HCM A;  2XQ6 A;  4HFD A;  5L4E A;  2KSR A;  2WNL A;  5CO5 A;  5HEO A;  3UQ4 A;  2BYQ A;  4ALX A;  2WZY A;  5AFN A;  3WTJ A;  3EHZ A;  3EI0 A;  5J0Z A;  2LLY A;  4ZJT A;  4AFG A;  5AFM B;  4TNV A;  4ZRU A;  2XZ5 A;  2Y54 A;  2XNU A;  4HFH A;  3U8K A;  1UW6 A;  2W8F A;  5J5F A;  2XQ4 A;  4AFT A;  4NPP A;  4UM3 A;  4IL9 A;  3UU6 A;  3RI5 A;  4NZB A;  4TWH A;  5FJV A;  3SQ6 A;  2BR8 A;  2XNT A;  3WTM A;  5LXB A;  4TWF A;  2M6I A;  2BG9 B;  2LM2 A;  2XQ9 A;  5HEG A;  4A98 A;  5CFB A;  4B5D A;  4DBM A;  5AFL A;  4UM1 A;  4QH5 A;  4IL4 A;  4Z91 A;  4BQT A;  2ZJV A;  2XQ3 A;  1OED C;  2XQ5 A;  5J5I A;  4HFI A;  5BW2 A;  5KZU A;  3P50 A;  3GUA A;  2QC1 B;  2BR7 A;  4FRR A;  5AFJ A;  5AFM A;  4ZZC A;  4UM3 P;  4HFB A;  3WIP A;  4X5T A;  5TVC A;  3TLS A;  3RIF A;  3ZDG A;  2YN6 A;  2XZ6 A;  3TLW A;  3U8J A;  4UY2 A;  2PGZ A;  2VL0 A;  4ILB A;  4LML A;  3WTN A;  3JAF A;  1OED B;  3P4W A;  4PIR A;  5JME A;  2Y56 A;  4HFC A;  2LKG A;  4QAA A;  3TLV A;  4F8H A;  2BYN A;  2XYT A;  4QAC A;  2XQA A;  2Y58 A;  3TLU A;  4ZJS A;  2W8G A;  5BRX A;  1UX2 A;  5AFH A;  3RHW A;  3IGQ A;  3SIO A;  3RIA A;  2YKS A;  4BFQ A;  2X00 D;  2Y7Y A;  1OED E;  2LKH A;  3WTL A;  2Y57 A;  5HEJ A;  3U8N A;  3ZDH A;  2MAW A;  3JAE A;  4QH1 A;  3PEO A;  4TNW A;  4EZ1 A;  4IRE A;  2YME A;  4LMK A;  4UM3 S;  2BG9 E;  5AFK A;  2YOE A;  4QH4 A;  2YMD A;  2ZJU A;  1OED A;  3C79 A;  3SH1 A;  2XYS A; 
#chains in the Genus database with same CATH topology
 3SWH A;  5KX5 E;  3ZYM A;  3AAE B;  4HFE A;  1N33 T;  3ZMZ B;  5HCJ A;  2BBJ A;  5AQQ B;  1W0A A;  2D9D A;  5CA1 E;  1UCU A;  2OLT A;  3ABV A;  4UF0 A;  1HX1 B;  1IJ5 A;  2KZ7 B;  5KMG P;  3SQ9 A;  4WV9 A;  4QXH B;  2BBH A;  1U4Q A;  4HWD A;  1X9B A;  3K1S A;  2CE7 A;  2CWY A;  2WZH A;  4YY3 T;  1MMA A;  3M3Z B;  4AQF C;  4AKG A;  2QGS A;  4Q25 A;  5LNK A;  5L3D B;  2CHN A;  3OVU A;  4L0R A;  5AQJ B;  4AKI A;  5AQK B;  1H7C A;  1XDP A;  1UGO A;  2LM2 A;  4DV0 T;  4IDP A;  2CM0 A;  3ZN0 B;  4UR9 A;  1GQE A;  5L3E B;  3FXE B;  4BA9 A;  5M4Y A;  5ABF B;  4LF7 T;  2CPT A;  3FXD B;  4YLH A;  3KV4 A;  1UX2 A;  3RHW A;  2IC6 A;  3SIO A;  1WFD A;  4HEA A;  1YQ4 A;  3AA7 B;  3ZN1 B;  4UEL A;  3PEO A;  2VK9 A;  4CN1 A;  3I0Q A;  4LMK A;  2QRX A;  3R6N A;  5AFK A;  4E7S A;  4AKH A;  1OED A;  4YHJ A;  5LMN T;  2J62 A;  4ZZB A;  4IDZ A;  2VVS A;  5HXC A;  4OYJ A;  1J5W A;  4ZHQ E;  4DVD A;  4XZC A;  4XBF B;  4UIG A;  2GK9 A;  4COF A;  4DBQ A;  3WTO A;  4X66 T;  2V26 A;  2A2F X;  3C50 A;  2YK0 A;  4HTE A;  5KE4 A;  4ILA A;  2SPC A;  3BK9 A;  4CN6 A;  2E5V A;  4FI5 A;  2IHR 1;  1UV6 A;  4WYV A;  2WMN A;  2JIW A;  4JI2 T;  2CXL A;  1HG2 A;  3MK7 C;  3O1H A;  2UU9 T;  4U31 A;  5ADX L;  1AJ3 A;  4UM3 A;  1WR6 A;  4QXC B;  4TWH A;  4UVB B;  4DR5 T;  5AFL A;  3OBV E;  2A72 A;  2NWB A;  3J9X 1;  3E08 A;  2UXD T;  5FMN A;  2YIN A;  3N2O A;  4I0U A;  2BS4 A;  1NEN A;  2UXB T;  2LRK A;  3U8J A;  1W0B A;  3AEE A;  4I43 B;  2KMF A;  5F5W A;  3WAJ A;  3ZMV B;  4PIR A;  5ABG A;  2LKG A;  4AIS A;  3P4R A;  4LF5 T;  2UUB T;  4DR1 T;  4QWN B;  4FJO A;  5IHY A;  3SS1 A;  2AE9 A;  4H9Q C;  5FY0 A;  2ZM6 T;  4IRE A;  2JRK A;  2YME A;  4MHC A;  2F4V T;  1BR4 A;  4KMC A;  4GIW A;  3SFD A;  3N9O A;  5LHG B;  4WW0 A;  3FBL A;  3EDV A;  4JEH B;  3M65 A;  3LK3 B;  2VKO A;  4ZS3 A;  5AQF B;  2UUC T;  4ZK4 A;  2MBG A;  4A97 A;  3AAA B;  5HWX A;  4G2A A;  4ILC A;  3RQW A;  1UX5 A;  2NR4 A;  2XY8 B;  3ZT5 A;  5JH7 E;  3K3O A;  5IUX A;  3QB5 K;  5H6R B;  4DR2 T;  3UU5 A;  2C5K T;  3BQL A;  5LOV E;  1X79 A;  2XQ6 A;  2WZY A;  3WTJ A;  1SE7 A;  3HL6 A;  4WZX A;  5HYA A;  2D5U A;  1W09 A;  3F57 A;  4TWF A;  3KDS E;  4YJ3 E;  1MIW A;  4JV5 T;  2XM1 A;  5J1G A;  4X64 T;  3ZC1 A;  2BS3 A;  1FIO A;  5FNV E;  2IW5 B;  3AE8 A;  5KXJ A;  5IYZ E;  2LSK A;  2ACZ A;  5AQS B;  3ZT6 A;  2K48 A;  3WTL A;  1YQ3 A;  2FBW A;  3ZC0 A;  2CXD A;  5KDM C;  4EZH A;  3C51 A;  4IHJ E;  3AE6 A;  3Q5X A;  3I1A A;  5HXE A;  1ZKE A;  3AVR A;  2XAS B;  3AEG A;  4B3R T;  3JAD A;  2XQY A;  4MBQ A;  5FVK A;  3B5M A;  3OYX A;  1D0X A;  1CUN A;  2BDE A;  3ZCJ A;  3AEA A;  1J1J A;  3QC9 A;  2CLY C;  2BG9 C;  4IE5 A;  3U78 A;  3L3P A;  5H6Q B;  3CX8 B;  5BMV E;  3SRZ A;  2X66 A;  4DR4 T;  2G0U A;  3RKG A;  1EZ3 A;  4UXN B;  4AXP A;  3H3A A;  3KIN B;  5JDQ A;  4MFR A;  5J5F A;  4AFT A;  2WDV A;  5LMU T;  5FJV A;  5AQN B;  4OX9 T;  3C4W A;  3VRB A;  1XNQ T;  3PU3 A;  4I4T E;  3CIR A;  4U7Y A;  4ZZC A;  3WIP A;  3IEE A;  3TLS A;  3L8R A;  4DV2 T;  3ZPO A;  2VL0 A;  4ILB A;  2DNX A;  3P4W A;  2K24 A;  4TN7 B;  2RA1 A;  3OJA A;  2XM2 A;  4ZI2 C;  3LK2 B;  2HH7 A;  4XAX B;  3AED A;  4GK0 E;  3U8N A;  2EHO C;  2N9D A;  2MAW A;  2LJL A;  3W15 B;  2V1D B;  3ONJ A;  4YHH T;  3FB2 A;  3EAB A;  4QH4 A;  1W9R A;  2EHO D;  3PUY F;  4ZR6 A;  3O9X A;  3B57 A;  5J5G A;  3H3M A;  5AQG B;  3FZM B;  3EAM A;  4AFH A;  4PK4 A;  3GN5 A;  1QLB A;  3RIU A;  3WI3 A;  3QNU A;  5JRE A;  4CZZ B;  3N9Q A;  3PV0 F;  2FUP A;  5AFU L;  3CQX C;  2E8I A;  2CWO A;  2X9W A;  2KT9 A;  3LJC A;  4UV8 B;  2KIN B;  2WWU A;  2XAG B;  3AEB A;  4IE7 A;  3MXZ A;  3AXJ A;  2DL1 A;  3FZH B;  2WBL A;  1CHU A;  3AEF A;  5FYM A;  3ZST A;  3C64 A;  5LJM A;  4GKK T;  4EOZ B;  2H88 A;  2IDO B;  3RPU A;  2WDQ A;  2WQY A;  4GYS A;  2XUE A;  2I59 A;  4QH5 A;  4IL4 A;  1XDO A;  2W66 A;  4JI5 T;  2XTL A;  4H9P C;  1Z8U A;  4DV5 T;  2NTY A;  2X0Y A;  3UFG A;  3L39 A;  3C4X A;  4GOU A;  5AFH A;  3ZSS A;  3T1Y T;  4IT4 A;  2YKS A;  1BR1 A;  2LKH A;  5AQU B;  3P4Q A;  2DCF A;  3JAE A;  2E5L T;  4AQG A;  4U74 A;  4EZ1 A;  1L0V A;  2WM9 A;  4UVC B;  2YOE A;  4IE6 A;  1U5P A;  2LOS A;  3UFE A;  2QYW A;  3C79 A;  5LG4 A;  4EXT A;  2LHR A;  3ZMU B;  3O1J A;  4IE0 A;  3WTK A;  2KWH A;  4D01 A;  2WNJ A;  2UXN B;  2XHE B;  3PMZ A;  3LBX A;  2D2S A;  4TWD A;  4YJ2 E;  4CXY A;  3VHL A;  2UZ6 A;  2WNC A;  1UUR A;  2Q9Q D;  2BKP A;  2KSR A;  4NXN T;  4HWH A;  2XJ7 A;  3EHZ A;  3P4P A;  1SUM B;  5LJN A;  4HN9 A;  1NEK A;  4JBW F;  5FL1 A;  4EB6 E;  1V9D A;  5AQH B;  3P7I A;  2H7O A;  2JPF A;  4KUM B;  5F8P A;  4PJM A;  2C5I T;  4KX6 A;  3RF1 A;  2I6H A;  2L9Q A;  3ZYK A;  4DV7 T;  2WY2 A;  4X1I E;  4PW8 A;  1SA0 E;  4O2B E;  4B3M T;  3TLV A;  2BS2 A;  3RX6 A;  3TLU A;  4K0U A;  3RLF F;  5LGN B;  3IGQ A;  4V1A v;  2X9H A;  3PUA A;  2Y8D A;  2Y7Y A;  1OED E;  3ANW A;  5HXR A;  2VKH A;  2H3R A;  3N2K E;  1VCT A;  3VU7 H;  4ASK A;  2YDR A;  3IA3 A;  4DMW A;  4CI3 B;  3VR9 A;  4ZOL E;  5SYO A;  4JI1 T;  2XAH B;  4P1N A;  4YSY A;  2CBJ A;  4PNI A;  3VR8 A;  2V7K A;  1KF6 A;  5L3F B;  4C90 A;  2E9X A;  3RIU C;  2CCQ A;  2Q9Q B;  2DWG A;  1ZV4 X;  3AA6 B;  5HCM A;  4GKJ T;  3UQ4 A;  5J0Z A;  4U33 A;  1LKX A;  4H63 V;  5JRC A;  2CLY B;  4X62 T;  2A9U A;  4E7Z A;  3QOF A;  4TV9 E;  4K0K T;  1E7P A;  3EDU A;  1MMN A;  3ZLI A;  5BW2 A;  3KBU A;  4JYA T;  3OKQ A;  2QC1 B;  5C2T A;  2KWI B;  2BVM A;  2JMK A;  3D0T A;  3JAF A;  2Y56 A;  4U2Z A;  4CI2 B;  5AQI B;  2BYN A;  4TUY E;  2W8G A;  1FMV A;  4DV6 T;  2FJA A;  3RIA A;  3HA4 A;  4YSZ A;  4EYU A;  1KK7 A;  5HEJ A;  4QH1 A;  2K9A A;  4CN4 A;  5F3J A;  4DV4 T;  1IJ6 A;  2ZJU A;  1M7K A;  3N9L A;  3V5U A;  2WCA A;  3ETV A;  4TV8 E;  2BZB A;  4IGU A;  4O4I E;  2CRB A;  5AQT B;  1NWM X;  2ZM8 A;  2NW7 A;  3KV5 A;  3BQK A;  3TKL B;  2ODU A;  5AQM B;  3QB5 A;  3PUV F;  3CVR A;  2XNV A;  3RQU A;  5ETW A;  1MMG A;  5LBQ B;  4ZI3 D;  5LG3 A;  5DAB A;  2WP9 A;  2RP4 A;  4HFD A;  3CML A;  5L4E A;  1FJG T;  1FEW A;  4YTM A;  5CA0 E;  4HE8 A;  2P9B A;  2JQQ A;  2YEV C;  3Q5E A;  5FXV A;  2V5C A;  4F6R C;  3QUJ A;  4NZB A;  5LXT E;  2YDQ A;  4EZ4 A;  2V6Y A;  4IDQ A;  2E9X C;  4Z91 A;  4YT0 A;  5L3G B;  5KZU A;  3GUA A;  4UM3 P;  4X5T A;  2EHO A;  5EK3 A;  3TLW A;  5LBM A;  3Q5W A;  1MND A;  3U3I A;  4QAA A;  3PUQ A;  1LVK A;  2Q9Q C;  3I0O A;  2XAJ B;  3GA8 A;  2LSI A;  4WNK A;  3B13 A;  1YXR A;  3OYZ A;  4X20 E;  4JI7 T;  3HR0 A;  4H9R C;  2CBI A;  3UT5 E;  1UUS A;  3LFM A;  4BJN A;  5FXZ A;  2QVA A;  3SH1 A;  5BR8 T;  4YFS A;  5AIN A;  2BYR A;  3UU8 A;  5LHH B;  3PJA A;  4C91 A;  2BG9 A;  4HWF A;  3QK6 A;  2HHH T;  2V6X A;  3UUB A;  2L3L A;  2XSA A;  1YD8 G;  4BAY B;  2H7V C;  2W67 A;  4IDN A;  3SOL A;  5DQW A;  2HN1 A;  3TLT A;  3ZKR A;  3C98 B;  2VWA A;  2LLY A;  5AQV B;  5HAX A;  4NUU A;  4PK5 A;  4L9I A;  4LF8 T;  4EAH A;  2XNU A;  4HFH A;  2PFV A;  3U8K A;  2VUR A;  3RC8 A;  3I9Y A;  5LGT B;  2NOX A;  1N34 T;  3CQC B;  3UTK A;  3F2E A;  5JR9 A;  2ZJV A;  2XQ3 A;  1D0Z A;  2XQ5 A;  2C5J A;  2H89 A;  5AFM A;  4OYK A;  2NP9 A;  3RIF A;  2XZ6 A;  4HWC A;  4LFC T;  2D0U A;  4A5X A;  1OED B;  4P0A A;  2LOP A;  1XMO T;  2V7J A;  4U3C A;  1I6Z A;  1T7S A;  3CK6 A;  5FY1 A;  2WAU A;  5JTG A;  5LB7 B;  3RYH E;  2CMR A;  3N9M A;  2Y57 A;  2B76 A;  3ESL A;  1G8X A;  3RRW A;  4EIW A;  2WU5 A;  1HR0 T;  4EGW A;  1O3X A;  2NW8 A;  4KHZ F;  3J7Y q;  2LRL A;  4H9S E;  5E0O A;  4H63 H;  4ZEY A;  4QKN A;  2W62 A;  5DJQ C;  2NTX A;  3S4U A;  4QX8 B;  4LFA T;  3KV6 A;  4ZS2 A;  3JC6 C;  5JDL A;  1BR0 A;  1WYB A;  3T8O A;  3LSV A;  2OV9 A;  2WSS V;  1KNP A;  1HNZ T;  1HFA A;  3MA9 A;  2DI4 A;  5EZY E;  3C84 A;  1XWM A;  5L47 A;  3G06 A;  4I50 E;  5HEO A;  5AFN A;  3VKH A;  3EI0 A;  4TNV A;  5LP6 E;  2PTF A;  3AE1 A;  4AQF A;  2KXP B;  2IC9 A;  2X68 A;  2PJQ A;  5FL0 A;  1YW0 A;  3X1D A;  4MAL A;  4EED A;  1M62 A;  1ZHC A;  2E2A A;  5AFJ A;  2LT3 A;  4PJJ A;  3AXJ B;  4B6X A;  3ZYL A;  3AE4 A;  2PGZ A;  4AKL A;  4JEU B;  1HF8 A;  4WBO A;  2DLR A;  1D0Y A;  2JMH A;  4EYY R;  3Q9D A;  3NKZ A;  2X00 D;  2J1D G;  1DU2 A;  3IF8 B;  4O8S A;  3DP7 A;  5C8Y E;  3ZCI A;  4DV1 T;  4DBR A;  3KFW X;  4P09 A;  3ZEF B;  1NAF A;  5JDH A;  2VB6 A;  1LVF A;  3ZMT B;  3OPC A;  2VL8 A;  5FKY A;  3GN5 B;  2VQE T;  2QA7 A;  1MMD A;  3PUX F;  2N1G A;  5LCY A;  1OWA A;  3WTH A;  4PFO A;  2C0S A;  3MAC A;  5L3B B;  5L2L A;  2ODV A;  1IBK T;  1HS7 A;  4H9O C;  2IAK A;  2BJ0 A;  2XSB A;  4UXU A;  2YU1 A;  2WS3 A;  2LSJ A;  3ONX A;  3RYC E;  3WTI A;  5FXW A;  3C4Z A;  4IDO A;  2W4X A;  3AVS A;  4GK5 E;  5A1L A;  5JR9 C;  2UUA T;  3UUL A;  2Y54 A;  4LFB T;  4DND A;  3A5X A;  3Q5D A;  4GYR A;  4O4L E;  3VKG A;  3RH3 A;  3UU6 A;  3AA0 B;  5L3C B;  3Q2M A;  4X1Y E;  1HNW T;  4DBM A;  3WAK A;  4BQT A;  1HNX T;  1QUU A;  2KND A;  1XNR T;  4UVA B;  2WWV A;  2BR7 A;  5TVC A;  1Z0P A;  3LG7 A;  4UY2 A;  2N2N A;  3RYF E;  2W0G A;  3FZF B;  2LEH A;  4QHO A;  2ZM0 A;  5JDM A;  2CHO A;  4YTP A;  4JUY A;  5CB4 E;  1J5E T;  2XQA A;  2Y58 A;  3T1H T;  3NRX A;  1IZN B;  1JNZ A;  2JJ9 A;  3PDY A;  1S94 A;  2YDS A;  3PUW F;  2Z6E A;  4O4J E;  3CQG B;  3IBP A;  2R6G F;  3AE3 A;  5GON E;  1WRD A;  4JI4 T;  2ZLY A;  2VAS A;  2YU2 A;  4Z90 A;  1VCS A;  3AE9 A;  3LDQ B;  5HEU A;  4PJL A;  5L4H A;  2IML A;  5BP0 A;  3DJB A;  2HPJ A;  2V6Y B;  4CQI A;  4X65 T;  3AE5 A;  2XQ7 A;  4O2A E;  2L8K A;  3N9P A;  4U2Y A;  2W2U A;  2CA5 A;  2VQF T;  5DQV A;  3PE0 A;  2LSY A;  4TX5 A;  4JI6 T;  2OA5 A;  4IIJ E;  5LA6 E;  4ALX A;  2XAQ B;  1E1H B;  2WZI A;  2MOZ A;  2M67 A;  2WDR A;  4AFG A;  2XZ5 A;  4JI0 T;  3ZJ1 A;  1IBL T;  2MTQ A;  3PTR B;  4ZI2 D;  1G73 A;  1SHZ C;  2V7M A;  5FY7 A;  5LHI B;  2MYS A;  3MKD A;  2M6I A;  4A56 A;  2BG9 B;  2XAF B;  5HEG A;  4UM1 A;  3FZK B;  1WYC A;  3P50 A;  3DTO A;  1VOM A;  4HFB A;  2PBI A;  2IUB A;  3AB3 B;  3BQI A;  4DR3 T;  3WTN A;  5ABF A;  4L5G A;  5ABH A;  1YKH B;  4PK6 A;  4OFZ A;  3KBT A;  4OHF A;  2NW9 A;  2I0M A;  3ZDH A;  5AQP B;  2BG9 E;  3RRC A;  3AE7 A;  3NRY A;  2HPL A;  3OTO T;  3CPZ A;  1I9B A;  3AE2 A;  2LHN A;  4U72 A;  2E9X B;  3H37 A;  2M6B A;  3CX6 B;  3N9N A;  3JCF A;  3A7M A;  5J2U E;  2Q9Q A;  3UQ7 A;  4UV9 B;  4DR7 T;  2MPK A;  5JR9 B;  3UU3 A;  4YXD A;  1ZOY A;  4QAB A;  3PUG A;  4LMJ A;  3KVA A;  1Y64 B;  1S35 A;  5JDF A;  2PH9 A;  4HQP A;  5CO5 A;  4UEM A;  1MNE A;  1D1A A;  1WLX A;  3EVY A;  5AFM B;  4IST A;  4AKR B;  4DUZ T;  2W8F A;  5AQO B;  2V7L A;  5LYJ E;  5JRC B;  2JQK A;  3E22 E;  4YSX A;  4KI0 F;  4A98 A;  3ZT7 A;  4O4H E;  2X0H A;  2V8S V;  4FRR A;  2IIU A;  1D1C A;  2X0L B;  3V5S A;  5FVL A;  1IAP A;  1HX8 A;  3AAI A;  4AIU A;  4PJN A;  4KBM B;  3HKB E;  2XYT A;  4M1P A;  2FJD A;  1N32 T;  4QX7 B;  3K3Q C;  4ZI3 C;  2DWK A;  4HGA A;  4BFQ A;  4LF6 T;  5J2T E;  4X1K E;  4CXW A;  3PU8 A;  3LK4 2;  1ZP0 A;  2YMD A;  2JQH A;  3FHN A;  4ERR A;  3NBX X;  4DID B;  3SFE A;  2WN9 A;  1N36 T;  5J5H A;  5JDG A;  1KEY A;  3N2G E;  1JNR A;  1MIY A;  3U8M A;  1BR2 A;  3FBZ A;  2Y48 B;  3N5L A;  4XK9 A;  4LF9 T;  3JC6 D;  4NUV A;  5C3J A;  4I55 E;  5AQR B;  4BJM A;  5IWA T;  1WR0 A;  2AXD S;  3HKE E;  3NZP A;  2DHR A;  1OXZ A;  3ANW B;  2WNL A;  1T72 A;  1D1B A;  4ZJT A;  4J2C A;  4N78 D;  3LBX B;  3ZJ2 A;  4IL9 A;  5EK4 A;  2BR8 A;  5LXB A;  2CEA A;  1T98 A;  4DV3 T;  2W61 A;  3CX7 B;  2X9Y A;  2V7I A;  3PJA J;  4HFI A;  4JI3 T;  2X51 A;  3ZDG A;  4ZI7 E;  2E9X D;  5JQG E;  4EEB A;  1I94 T;  2ZM2 A;  1HCI A;  3IHR A;  3I9W A;  3UUN A;  4H9N C;  2CXF A;  1YKE B;  3PUS A;  2EHO B;  2D0T A;  1UK5 A;  4B3S T;  5TAO A;  4KHP T;  3O1I A;  4HWI B;  5BRX A;  1VRB A;  3EUH A;  4YTN A;  3RGL A;  3HKD E;  3AEC A;  5HXH A;  2W63 A;  4JI8 T;  2ZMA A;  4PFP A;  4UM3 S;  2J47 A;  5HXS A;  2XYS A;  4HFV A;  4MLK A;  1IBM T;  3NZQ A;  2ES0 A;  1XZY A;  1QSD A;  4KP3 C;  3CKD A;  5LGU B;  2X00 A;  2UXX B;  2WMO A;  3O4X E;  3T4M A;  2BYS A;  2XQ8 A;  4LF4 T;  5HEH A;  3UU4 A;  1HTJ F;  4DUY T;  4CXX A;  2BYP A;  2FJB A;  4B3T T;  2ACX A;  4XHE A;  4QXB B;  3ZMS B;  4AI6 A;  1WCR A;  2BKN A;  4ZRU A;  5JVD E;  3E0Z A;  2K5B B;  5CJ5 A;  4CI1 B;  1UX4 A;  5AQL B;  5JDN A;  1UW6 A;  2WU2 A;  2XPK A;  3RI5 A;  3SQ6 A;  3HI2 A;  4AQY T;  3R84 B;  3HKC E;  3GMI A;  1OED C;  5FXX A;  3FZL B;  3KV9 A;  2BVL A;  5EK2 A;  1ZEE A;  2V5D A;  3K8P C;  4PAG A;  2VKJ A;  3MJX A;  4LML A;  4JLE A;  5JME A;  2FJE A;  4QAC A;  3ETU A;  3NWI A;  4DR6 T;  2K3W A;  4DO0 A;  2JQ9 A;  4TNW A;  3K3N A;  5CGM A;  3A8Y C;  1KNZ A;  2C9T A;  1XMQ T;  2X9X A;  1B7T A;  1KNR A;  4ZXL A;  2X67 A;  2J4G A;  2LSG A;  4ZK1 A;  3UUX B;  2KLQ A;  3PUZ F;  1KFY A;  3U8L A;  2VVN A;  4HKA A;  3AA1 B;  4Z8X A;  2HN2 A;  3MZK B;  4WBN E;  2VKD A;  3GWH A;  2PG8 A;  4ILU A;  3NVO A;  2UXC T;  4DMV A;  4IE4 A;  2BYQ A;  1FMW A;  3VRA A;  1R8I A;  4ADZ A;  1T8B A;  5HWY A;  4EV6 A;  1E2A A;  3P8C D;  2XQ4 A;  4NPP A;  5ABE A;  3WTM A;  2XNT A;  2RPA A;  3RKO A;  2XQ9 A;  5CFB A;  3L09 A;  1US7 B;  4TZ4 C;  5FP3 A;  4B5D A;  4G63 A;  2BKO A;  4P0B A;  5J5I A;  2XZE A;  4OK0 A;  3ONL C;  2YN6 A;  2LE8 A;  3F31 A;  2B1E A;  4U7I A;  4NXM T;  2LM9 A;  1LRZ A;  2WB5 A;  4HFC A;  3UUM A;  4F8H A;  4ZJS A;  4ISS A;  4UF0 B;  4NIQ A;  1MIV A;  4ANJ A;  2A3D A;  3CWZ B;  3RC3 A;  1HG5 A;  2Y6X A;  2W00 A;  3PUR A;  1Y01 A;  3P4S A;  3KVB A;  3RYI E; 
#chains in the Genus database with same CATH homology
 4ZR6 A;  4ZZB A;  5AIN A;  1I9B A;  2BYR A;  5J5G A;  3UU8 A;  2C9T A;  4HFE A;  3JAD A;  2X00 A;  5SYO A;  2WN9 A;  2BG9 A;  5J5H A;  5HCJ A;  4Z90 A;  3WTK A;  5HEU A;  3EAM A;  4D01 A;  2WNJ A;  2M6B A;  3T4M A;  4AFH A;  3WTH A;  4ZK1 A;  3U8M A;  3UUB A;  5L4H A;  3U8L A;  5BP0 A;  2BYS A;  4ZK4 A;  4A97 A;  2XQ8 A;  3UQ7 A;  4XK9 A;  5HEH A;  3LSV A;  4COF A;  3WTO A;  3UU4 A;  3UU3 A;  4ILC A;  3RQW A;  2BJ0 A;  3PMZ A;  5KE4 A;  2XNV A;  2BG9 C;  4QAB A;  4UXU A;  3SQ9 A;  4WV9 A;  4TWD A;  2XQ7 A;  3RQU A;  4ILA A;  2BYP A;  3C84 A;  5IUX A;  4LMJ A;  5L47 A;  5LG3 A;  1UV6 A;  2UZ6 A;  3WTI A;  2WNC A;  3UU5 A;  3TLT A;  3ZKR A;  4XHE A;  2PH9 A;  4HQP A;  5HCM A;  2XQ6 A;  4HFD A;  5L4E A;  2KSR A;  2WNL A;  5CO5 A;  5HEO A;  3UQ4 A;  2BYQ A;  4ALX A;  2WZY A;  5AFN A;  3WTJ A;  3EHZ A;  3EI0 A;  5J0Z A;  2LLY A;  4ZJT A;  4AFG A;  5AFM B;  4TNV A;  4ZRU A;  2XZ5 A;  2Y54 A;  2XNU A;  4HFH A;  3U8K A;  1UW6 A;  2W8F A;  5J5F A;  2XQ4 A;  4AFT A;  4NPP A;  4UM3 A;  4IL9 A;  3UU6 A;  3RI5 A;  4NZB A;  4TWH A;  5FJV A;  3SQ6 A;  2BR8 A;  2XNT A;  3WTM A;  5LXB A;  4TWF A;  2M6I A;  2BG9 B;  2LM2 A;  2XQ9 A;  5HEG A;  4A98 A;  5CFB A;  4B5D A;  4DBM A;  5AFL A;  4UM1 A;  4QH5 A;  4IL4 A;  4Z91 A;  4BQT A;  2ZJV A;  2XQ3 A;  1OED C;  2XQ5 A;  5J5I A;  4HFI A;  5BW2 A;  5KZU A;  3P50 A;  3GUA A;  2QC1 B;  2BR7 A;  4FRR A;  5AFJ A;  5AFM A;  4ZZC A;  4UM3 P;  4HFB A;  3WIP A;  4X5T A;  5TVC A;  3TLS A;  3RIF A;  3ZDG A;  2YN6 A;  2XZ6 A;  3TLW A;  3U8J A;  4UY2 A;  2PGZ A;  2VL0 A;  4ILB A;  4LML A;  3WTN A;  3JAF A;  1OED B;  3P4W A;  4PIR A;  5JME A;  2Y56 A;  4HFC A;  2LKG A;  4QAA A;  3TLV A;  4F8H A;  2BYN A;  2XYT A;  4QAC A;  2XQA A;  2Y58 A;  3TLU A;  4ZJS A;  2W8G A;  5BRX A;  1UX2 A;  5AFH A;  3RHW A;  3IGQ A;  3SIO A;  3RIA A;  2YKS A;  4BFQ A;  2X00 D;  2Y7Y A;  1OED E;  2LKH A;  3WTL A;  2Y57 A;  5HEJ A;  3U8N A;  3ZDH A;  2MAW A;  3JAE A;  4QH1 A;  3PEO A;  4TNW A;  4EZ1 A;  4IRE A;  2YME A;  4LMK A;  4UM3 S;  2BG9 E;  5AFK A;  2YOE A;  4QH4 A;  2YMD A;  2ZJU A;  1OED A;  3C79 A;  3SH1 A;  2XYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...