2XQ3A

Pentameric ligand gated ion channel glic in complex with br-lidocaine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq3A01
5CFBA 5J5FA 4COFA 1OEDE 2BYNA 5HEOA 4Z90A 3ZKRA 4QAAA 2YKSA 4NPPA 3WTJA 2XNTA 5FJVA 3WTMA 5BRXA 3UU5A 3TLWA 2YMEA 5J5GA 2XNVA 4ZZBA 1OEDA 2PH9A 2BG9E 2XZ6A 4ILBA 2LM2A 4HFEA 4QH4A 5J0ZA 2KSRA 4TWHA 2M6IA 4ILAA 4IL9A 4LMJA 4TNVA 1UV6A 2XNUA 4LMKA 5LXBA 4QACA 3JADA 2XQ4A 2YOEA 4FRRA 2BYQA 5HEHA 2LLYA 4UM3A 2BR8A 3U8KA 5AFLA 3EHZA 5SYOA 3WTNA 4AFGA 3SQ9A 4ALXA 3RHWA 4B5DA 4NZBA 5AFMA 3C84A 4X5TA 2W8GA 4QH1A 5AFNA 4ZK4A 4HFDA 5HCMA 1UW6A 2WNJA 4HFBA 2XZ5A 5L47A 5CO5A 3TLUA 2XQ3A 4XHEA 2WNCA 3UUBA 4ZJSA 4HFCA 3RIFA 4DBMA 3PMZA 2XQ7A 2PGZA 5BP0A 4IL4A 4QABA 3UU8A 4WV9A 2LKHA 4TWDA 3UQ4A 3RQUA 2Y56A 3TLTA 4BFQA 3RI5A 4AFTA 2XYTA 2Y7YA 3SIOA 4IREA 4AFHA 4UXUA 4Z91A 4UM1A 4HFIA 2BG9B 4ZJTA 3P4WA 5HCJA 5J5HA 2C9TA 2BYRA 5AFHA 2XQ9A 4F8HA 2BYSA 2XYSA 5L4EA 4HFHA 3SH1A 3WTKA 2W8FA 3IGQA 3WIPA 5HEUA 3TLSA 5AFKA 5AFJA 4ZRUA 3SQ6A 5AFMB 2YMDA 3ZDHA 3P50A 2ZJVA 5L4HA 1I9BA 2WN9A 2X00A 4LMLA 4QH5A 3ZDGA 2XQAA 2QC1B 4XK9A 4UM3S 5J5IA 3RQWA 3RIAA 1OEDB 3U8JA 4TWFA 2M6BA 3WTOA 2BG9C 3U8MA 3EI0A 3GUAA 3WTIA 4BQTA 2MAWA 4ZZCA 3WTLA 5KZUA 2Y57A 3JAFA 4ILCA 4D01A 2VL0A 3WTHA 2XQ5A 3EAMA 3TLVA 4EZ1A 2LKGA 2UZ6A 2BJ0A 2XQ8A 3PEOA 3UQ7A 5TVCA 2X00D 5IUXA 5LG3A 5AINA 4PIRA 3JAEA 3LSVA 3UU4A 3T4MA 5HEGA 3U8NA 2WNLA 4ZR6A 3C79A 4A97A 4TNWA 3U8LA 2Y58A 1OEDC 2BG9A 2ZJUA 5HEJA 2BR7A 4UM3P 5KE4A 5BW2A 4A98A 3UU6A 2BYPA 5JMEA 4HQPA 3UU3A 2YN6A 2WZYA 4UY2A 4ZK1A 1UX2A 2XQ6A 2Y54A
chains in the Genus database with same CATH superfamily
1LRZA 3CQCB 2X68A 3ZYKA 2KWHA 1IJ5A 2LM2A 4HFEA 2JPFA 2N9DA 3RYFE 5LGUB 4LMJA 4QHOA 4CXWA 4FRRA 4H9NC 2LLYA 2XAJB 4B5DA 3U78A 4AQGA 3BQIA 2UXNB 2HN2A 2W8GA 5AFNA 1UX5A 4H9SE 3KV6A 2LRKA 4YJ3E 2MPKA 1U5PA 3LK2B 1IBLT 3RIUC 4DO0A 4BFQA 1OXZA 2J62A 4AFTA 4ZI3C 4AKLA 4UM1A 4JI7T 4F8HA 5HXHA 5HXCA 4P1NA 2NOXA 4NUVA 4UXNB 3PUYF 2LSYA 4UV8B 3D0TA 4A5XA 5ADXL 5L3EB 5AQLB 4BAYB 4BQTA 3WTLA 1BR0A 3NRXA 2PFVA 4JI4T 3ZMUB 1KF6A 2GK9A 1HNWT 4H9OC 4LFCT 4B3ST 4AKHA 1E1HB 3IBPA 4E7ZA 4TNWA 2Y58A 4CI2B 5KE4A 5LMUT 5JMEA 4HQPA 3MK7C 2LJLA 2XQ6A 5J5FA 4PFPA 1I6ZA 4QKNA 1XNRT 5F5WA 4TX5A 2JJ9A 4WBNE 5LXBA 3K8PC 5AQKB 5LJMA 1WR0A 2PTFA 2X0HA 2B1EA 2MYSA 4AXPA 4LF8T 2ZM8A 4ZK4A 3L3PA 5FY0A 3PUVF 2UXBT 2RA1A 3PURA 2IIUA 2BBHA 4ZJSA 3PMZA 3IA3A 2VURA 2YDQA 5LXTE 3V5SA 5LHHB 4I43B 3T1HT 4HWHA 2XYTA 4IREA 4B3TT 5HCJA 2W00A 3I0OA 2W8FA 4JEUB 5FL0A 3AE2A 2V5DA 4WNKA 4GKKT 3ZCJA 5L3DB 4NXMT 1Y01A 4M1PA 4O2BE 5HWXA 3U8MA 4E7SA 3WTIA 4ZZCA 3JAFA 3ZMZB 3LJCA 4DV2T 2NTYA 1CUNA 3RH3A 4AQFA 3LSVA 5CJ5A 4IDNA 4JI6T 2E9XD 3ZLIA 4IIJE 3AE4A 2IAKA 3LBXA 2PBIA 4UY2A 3EDVA 4YXDA 1OEDE 2VK9A 4AIUA 5BRXA 1OEDA 2PH9A 3CQGB 4IE6A 5ABGA 2E9XB 2XNUA 2XM1A 3M65A 4PW8A 5LJNA 5L3CB 2UUCT 5HEHA 3SWHA 2BR8A 3PDYA 3SQ9A 1LKXA 2CRBA 4HTEA 3L39A 2W63A 1XMQT 2LSGA 4KHPT 2WNJA 2YINA 4IDQA 4IDPA 1HNXT 3PJAA 4DBMA 2XQ7A 4LFBT 1IBKT 1FJGT 2D9DA 4AKGA 4L9IA 5KX5E 3NZPA 2AXDS 3P4WA 4O4HE 3RLFF 2XQ9A 2BYSA 3PU3A 4DR4T 3ETVA 5LBQB 3LDQB 4IGUA 3UUXB 2I6HA 3TLSA 3CX8B 4IE4A 3P50A 1YKEB 2E5LT 2WBLA 3ZDGA 4X66T 4GK0E 4U2YA 4G63A 5JR9C 2LSKA 1MIYA 4LF5T 2HN1A 3AE5A 4HWDA 3C4XA 1MNDA 3I9YA 2JQQA 2BG9A 1SE7A 3ETUA 5LP6E 3PUZF 2YN6A 4K0UA 2IC6A 2J4GA 3Q5DA 2VQET 4QXHB 4UVBB 2KWIB 2OA5A 3GN5A 1HF8A 2JRKA 5FVLA 4H9PC 3P7IA 4EZHA 4TN7B 2W66A 2KSRA 4JI3T 4JI0T 2WS3A 4CN6A 3SFDA 3Q2MA 4HWCA 2QRXA 3MA9A 4PK6A 4AKRB 4JV5T 3AVRA 4DR5T 1E7PA 2NTXA 1OWAA 2E2AA 2PGZA 2Q9QD 2NR4A 3PE0A 3AE6A 2CLYB 2Y7YA 1E2AA 5AFHA 4DV3T 3K3NA 4CI1B 3GMIA 3SQ6A 3N5LA 2V7IA 2XQYA 5GONE 2BVLA 2BZBA 4MBQA 2H7OA 2XAHB 3L09A 5LYJE 3NRYA 3RYCE 3RKGA 4ZI2C 4O2AE 3R84B 2CCQA 1D0XA 3HR0A 3RKOA 1ZKEA 3AEBA 1IJ6A 3WI3A 3RYHE 2XTLA 2XZEA 3NBXX 2WZYA 1J1JA 2Y54A 5CFBA 4X1KE 2BYNA 4OHFA 4WW0A 2I59A 5J2TE 3GWHA 4UR9A 2XZ6A 1I94T 5FP3A 3QOFA 3KDSE 1QSDA 4H63V 4TZ4C 3UFGA 1D0YA 3N2OA 2FUPA 2Q9QA 2IC9A 2E9XC 1FEWA 4UF0A 2XASB 3ZN1B 4H63H 4XAXB 4C91A 2FJDA 5L47A 1LVFA 4GYRA 3VRBA 2HPLA 5AQVB 2K3WA 4QABA 5IYZE 1UK5A 2Y56A 5DJQC 4HEAA 4HFVA 5JREA 5FNVE 4WZXA 4U2ZA 4Z91A 4JI5T 2OV9A 3RYIE 4EEBA 4KMCA 2L9QA 3RIAA 3Q5EA 3WTOA 4TWFA 4ZHQE 2QA7A 4YTNA 1B7TA 3EAMA 2WMOA 2YK0A 3UU4A 3T4MA 2WP9A 4NXNT 3KBTA 3I1AA 4PJJA 3OJAA 2W67A 4PFOA 4PNIA 4IE0A 5HEJA 4O4LE 3CQXC 3UU3A 3F31A 1UX2A 3KV5A 4UIGA 3AXJA 5FJVA 3UU5A 4WBOA 4X20E 1N32T 2VL8A 4EXTA 3MACA 2ES0A 5C2TA 2M6IA 1M62A 4FJOA 3JADA 2L3LA 2HH7A 4P0AA 2N2NA 3FZKB 5LBMA 2VKJA 2Y48B 1VCSA 4JEHB 4QH1A 2KINB 4PJLA 2VVSA 5LNKA 2XQ3A 2NWBA 3V5UA 4HFCA 1XDOA 2NW8A 2CXLA 3HKEE 2LKHA 2WDVA 5TAOA 5L3BB 4JI1T 5AQJB 4JBWF 3RPUA 5J5HA 1MMGA 2CWOA 5FXXA 5HEUA 3C50A 5JDNA 5L4HA 2CLYC 1T7SA 2D0TA 2DLRA 1ZP0A 2VKDA 4EZ1A 5F3JA 2X66A 1S35A 5TVCA 2LSJA 4I0UA 3Q9DA 2CPTA 2WNLA 3ZT6A 5LHIB 3KV4A 4GK5E 4A98A 2ZLYA 4JI8T 4COFA 5KMGP 4Z90A 3ZJ2A 3ZMTB 3S4UA 3JCFA 3M3ZB 2H7VC 2H89A 3J9X1 4DR7T 1O3XA 2EHOC 2XUEA 3PUWF 2V5CA 2B76A 3EHZA 1UURA 4PK5A 4TUYE 4ANJA 3O1JA 2W61A 1UW6A 2DWKA 4DV4T 3N9MA 4LF6T 4UVAB 3RIFA 2D2SA 4UVCB 3HKDE 1HX1B 3BQLA 4U33A 4OX9T 3AE3A 3KV9A 3SIOA 3MXZA 4CI3B 4CQIA 4KBMB 4IE5A 2FJAA 2FBWA 3LBXB 1HNZT 3IGQA 5FYMA 3KVBA 3H3MA 4I50E 4F6RC 3PUQA 1MMAA 2WN9A 2CBIA 5L3FB 3H37A 3OTOT 1HG5A 3SRZA 5LG4A 1OEDB 5C3JA 3U8JA 4YJ2E 2KLQA 4PJMA 2VQFT 4D01A 4PAGA 5E0OA 5FL1A 2KNDA 3TLVA 1UCUA 3L8RA 1D0ZA 3QUJA 2LEHA 3OYXA 2DWGA 4BA9A 5HEGA 3RX6A 1DU2A 4EOZB 3ZEFB 2IUBA 5EK4A 4EV6A 5FXVA 3RRCA 3P4QA 2JQ9A 5F8PA 1FIOA 4IDOA 3C4ZA 4FI5A 2JIWA 4GKJT 3FBZA 4U74A 3WTNA 3LG7A 4ALXA 3MKDA 2BKPA 1ZOYA 2V7MA 2K24A 2E5VA 1X79A 2HHHT 1EZ3A 2XZ5A 2CWYA 3OYZA 4QWNB 3ZT7A 4UEMA 2IHR1 2K9AA 5EZYE 4HE8A 1YQ4A 3RI5A 4YSZA 3RC8A 3AA1B 3VRAA 2BG9B 2UUBT 5AQHB 1GQEA 2NW9A 2V7LA 3EABA 4BJNA 5JDQA 3HKBE 3ZDHA 3AA7B 2JQHA 3GN5B 2H3RA 2W62A 2ZMAA 3RF1A 2JMKA 2XAGB 2MBGA 2L8KA 2UXDT 3A8YC 3IEEA 4A97A 4CXXA 3EVYA 5HXRA 4EGWA 2R6GF 2BYPA 3AE8A 4CXYA 1MIVA 1HFAA 2AE9A 3K3OA 5AQRB 4CN1A 3AA6B 3WTJA 5CA0E 2UUAT 4C90A 2BG9E 4L0RA 1T8BA 3P4PA 4AQYT 4X64T 4LFAT 4TNVA 3P4SA 4ZS2A 2YU2A 4X1YE 4I55E 3AECA 3QB5A 5AQGB 2XSAA 2PJQA 4MLKA 4N78D 2VWAA 5HYAA 4AFGA 2VKHA 3B5MA 2X67A 2CHOA 2KMFA 3C4WA 1U4QA 2DI4A 4X5TA 5LOVE 5HCMA 1WYBA 4HFBA 3ABVA 2C5JA 3AE9A 3O4XE 2V7JA 2E8IA 4YLHA 3T8OA 4DR6T 5LA6E 3CPZA 4U7IA 4B6XA 3TLTA 1D1BA 1BR2A 4UXUA 4DV1T 1YXRA 4HFIA 1WCRA 4YT0A 2XYSA 3N9PA 2ZM0A 3WTKA 4HFHA 4KI0F 4IT4A 4L5GA 4AQFC 2CXFA 4BJMA 2LSIA 3HA4A 2WZHA 4LMLA 4HWIB 2YDSA 2WAUA 1VCTA 2VVNA 4EIWA 5BR8T 3ZC0A 2A3DA 2H88A 5DQVA 2UZ6A 4YSXA 4YTMA 3PEOA 4QXCB 4ZI3D 4U7YA 5IUXA 2X00D 5AINA 1YKHB 1HCIA 1ZHCA 1HG2A 2CM0A 4AI6A 3C79A 4EYYR 1OEDC 2Q9QB 2ZM6T 3ZCIA 4YHHT 4UF0B 5AFLA 2A72A 4H9RC 3ZKRA 4EZ4A 3ZT5A 5J5GA 4IE7A 4JLEA 3OVUA 5EK2A 4TWHA 3QB5K 2NW7A 1UV6A 1HX8A 5AQTB 4HN9A 3N9OA 3R6NA 4CN4A 1W9RA 3U3IA 5JRCB 3SFEA 3C84A 1NAFA 4PK4A 4MFRA 4MHCA 2YEVC 4DV5T 2KZ7B 4DBQA 3E22E 2J1DG 1KNPA 3RQUA 4DR1T 2DNXA 4DUZT 4JUYA 4X1IE 2BYRA 5L4EA 4X65T 3WIPA 1UUSA 2BS4A 3FBLA 3RIUA 5L3GB 4DV0T 3AXJB 4YTPA 4K0KT 3PUGA 2X00A 5JQGE 1SA0E 2BG9C 3ZJ1A 5FXZA 1SUMB 5IHYA 4KHZF 4DNDA 2X9WA 4ZI7E 2LKGA 4AISA 3WAKA 3ZYMA 4O4JE 3CMLA 4OFZA 1HR0T 5JRCA 2WWUA 3KBUA 1UX4A 3UU6A 3IF8B 1MMNA 4OYKA 3C51A 1XZYA 3BQKA 3WTMA 3ESLA 1M7KA 2MOZA 4ILBA 4AKIA 2G0UA 1FMVA 4U3CA 2DL1A 2P9BA 3PJAJ 4Q25A 2LHNA 1D1AA 4ISTA 3KINB 4DBRA 3UULA 2X51A 2XJ7A 3ONLC 1NEKA 3N9QA 2UXXB 1NWMX 2C5KT 5BP0A 4IL4A 2W4XA 3UQ4A 3G06A 2M67A 2PG8A 1QUUA 2MTQA 5ABFA 4HGAA 2V8SV 2LOPA 3J7Yq 1L0VA 2WDRA 2WU2A 2V6YB 2X9XA 4A56A 2ZJVA 5FMNA 2XQAA 4UM3S 5JVDE 1CHUA 1J5WA 3ANWB 3Q5WA 2Y57A 1ZEEA 5BMVE 4P09A 3I0QA 3PUAA 3DP7A 2KXPB 2CE7A 3EDUA 5J1GA 3LK3B 2CBJA 3KVAA 1D1CA 1MMDA 3N9LA 4GOUA 3UT5E 2C5IT 2A9UA 2NP9A 2BKNA 2I0MA 3VKGA 4V1Av 4OK0A 2XNVA 5ETWA 1BR1A 2ODUA 2Q9QC 4ISSA 4O8SA 4LMKA 1N36T 5CGMA 5KXJA 5A1LA 3HKCE 1JNZA 1WR6A 2XQ4A 2WQYA 5AQPB 2F4VT 5JDLA 2V7KA 1YW0A 4MALA 2V6YA 4OYJA 3CX7B 4YFSA 2VB6A 4EEDA 5JR9B 3DTOA 5AQNB 2YU1A 4NIQA 1KK7A 4ZXLA 3ANWA 3AEGA 4DV6T 3MZKB 3AE7A 2VASA 1US7B 2CA5A 2X9YA 1YQ3A 4TWDA 3AAEB 2CXDA 2CHNA 4TV9E 5C8YE 3O1IA 3ZSTA 3PV0F 3SOLA 2HPJA 2ZM2A 3UFEA 4DIDB 1QLBA 1N34T 5HXEA 3ZC1A 3OPCA 4ZRUA 3UUMA 1IAPA 4LF4T 4NUUA 2QC1B 3W15B 3GA8A 4KUMB 2BVMA 3P4RA 2M6BA 2ACXA 1WFDA 1AJ3A 4HKAA 2X0YA 3K3QC 4PIRA 3JAEA 1G73A 4XBFB 1MNEA 2V6XA 3B57A 3ONJA 4DUYT 4U72A 5JR9A 4UELA 4ZK1A 3WAJA 4EYUA 5JDMA 4LF7T 2YMEA 4B3RT 2A2FX 4Z8XA 5FVKA 3JC6D 5J0ZA 4QH4A 2LM9A 5AFUL 4ILAA 5FY7A 4ZI2D 2BBJA 1WYCA 2YOEA 5JDHA 5JDFA 3DJBA 3FZFB 3U8KA 1N33T 5SYOA 2JMHA 5AQUB 2RP4A 5L2LA 2WDQA 2WSSV 1WRDA 2JQKA 5IWAT 3QC9A 4DVDA 3TLUA 4ERRA 1R8IA 3OKQA 2BDEA 2LRLA 2LT3A 3UU8A 2XY8B 3C98B 4ILUA 3A7MA 4DMWA 3FXEB 4ZOLE 3RRWA 5AFJA 3AEFA 1VRBA 3NWIA 4J2CA 5LMNT 3AB3B 5HXSA 3EI0A 3K1SA 4DR2T 2VL0A 3WTHA 3PU8A 2BJ0A 1WLXA 3PUXF 1XWMA 4GYSA 2WMNA 4ZR6A 1VOMA 2OLTA 3EUHA 2BR7A 1SHZC 3UUNA 3VR9A 3F2EA 3VKHA 2XNTA 3TLWA 1NENA 2K48A 1H7CA 5J2UE 2QGSA 2C0SA 4IL9A 1V9DA 2K5BB 5HAXA 3HI2A 3CK6A 5H6QB 1ZV4X 3ONXA 3RHWA 3TKLB 3NZQA 4WYVA 3CKDA 2XAFB 2LE8A 2BS2A 4U31A 2N1GA 3UUBA 4JYAT 2J47A 2V1DB 2YDRA 5ABHA 1BR4A 1J5ET 1KFYA 2E9XA 1X9BA 2ACZA 3N2GE 1LVKA 3FB2A 4H9QC 2Y6XA 3PTRB 3N2KE 5EK3A 3AEEA 3VHLA 4PJNA 2DHRA 2YMDA 2WY2A 1T72A 4QH5A 3LK42 4IHJE 4XK9A 2IMLA 3RQWA 4YSYA 5HWYA 5KZUA 1KNZA 3PUSA 3E08A 4ILCA 2XQ5A 3AAIA 2KT9A 2BS3A 2WU5A 2XQ8A 2QVAA 4UV9B 4YY3T 1W0BA 2WWVA 2UU9T 2ZJUA 2XSBA 5ABEA 5BW2A 3T1YT 2CMRA 5FY1A 4P0BA 3N9NA 3AE1A 3RC3A 4QAAA 2YKSA 4NPPA 2XHEB 3LFMA 4IDZA 4ZZBA 2DCFA 3CWZB 5DABA 4QACA 4EAHA 1XNQT 4ZS3A 2BYQA 3ZSSA 3CVRA 4DMVA 2WZIA 3UTKA 2XPKA 5CB4E 3AAAB 5LHGB 4HFDA 2W2UA 4DV7T 4GIWA 1T98A 2IW5B 4XHEA 3H3AA 4G2AA 3O9XA 2QYWA 1Z8UA 4WV9A 2D0UA 2EHOD 3F57A 3ZYLA 4TV8E 2Z6EA 3JC6C 5FKYA 3AA0B 4DR3T 3AVSA 3AEDA 4ASKA 5AFMB 3ZMSB 3HL6A 2WM9A 2VKOA 2EHOB 2BKOA 3VU7H 3B13A 2V26A 2MAWA 3CX6B 5AQOB 4LF9T 1W09A 4O4IE 5LB7B 3O1HA 4X62T 5LG3A 3U8NA 3FZMB 4YHJA 4QXBB 5AQMB 4UM3P 3E0ZA 2LOSA 2RPAA 5HEOA 5AQIB 1KEYA 3VR8A 3NKZA 3QK6A 3AEAA 5JTGA 2LHRA 1XMOT 5DQWA 3FXDB 1XDPA 3MJXA 4UM3A 5CA1E 5ABFB 3BK9A 3ZN0B 3A5XA 3IHRA 4NZBA 1Z0PA 1UGOA 4CZZB 5AFMA 5AQSB 3X1DA 2WCAA 2FJBA 1FMWA 5JH7E 2IDOB 3CIRA 3RGLA 2EHOA 5CO5A 4EB6E 2WNCA 2XAQB 5LGTB 1Y64B 2W0GA 3QNUA 2X0LB 2Y8DA 3SS1A 3FZHB 4XZCA 2FJEA 1W0AA 4KX6A 3ZPOA 1HTJF 3Q5XA 5FXWA 5M4YA 4AFHA 1KNRA 2CEAA 4ZJTA 4HWFA 2C9TA 1HS7A 1JNRA 3FHNA 3SH1A 5AFKA 5AQQB 5LCYA 1YD8G 1I9BA 2UXCT 2WB5A 5J5IA 3C64A 2X9HA 3GUAA 2D5UA 1IZNB 4QX7B 3NVOA 4ZEYA 5JDGA 4I4TE 2XM2A 4JI2T 5AQFB 3FZLB 3ZMVB 3UQ7A 1G8XA 5H6RB 4KP3C 3I9WA 1IBMT 2SPCA 3OBVE 2ODVA 3U8LA 1S94A 4QX8B 3P8CD 5LGNB 4ADZA 5KDMC 4B3MT 1MIWA 3KFWX
chains in the Genus database with same CATH topology
5CFBA 5J5FA 4COFA 1OEDE 2BYNA 5HEOA 4Z90A 3ZKRA 4QAAA 2YKSA 4NPPA 3WTJA 2XNTA 5FJVA 3WTMA 5BRXA 3UU5A 3TLWA 2YMEA 5J5GA 2XNVA 4ZZBA 1OEDA 2PH9A 2BG9E 2XZ6A 4ILBA 2LM2A 4HFEA 4QH4A 5J0ZA 2KSRA 4TWHA 2M6IA 4ILAA 4IL9A 4LMJA 4TNVA 1UV6A 2XNUA 4LMKA 5LXBA 4QACA 3JADA 2XQ4A 2YOEA 4FRRA 2BYQA 5HEHA 2LLYA 4UM3A 2BR8A 3U8KA 5AFLA 3EHZA 5SYOA 3WTNA 4AFGA 3SQ9A 4ALXA 3RHWA 4B5DA 4NZBA 5AFMA 3C84A 4X5TA 2W8GA 4QH1A 5AFNA 4ZK4A 4HFDA 5HCMA 1UW6A 2WNJA 4HFBA 2XZ5A 5L47A 5CO5A 3TLUA 2XQ3A 4XHEA 2WNCA 3UUBA 4ZJSA 4HFCA 3RIFA 4DBMA 3PMZA 2XQ7A 2PGZA 5BP0A 4IL4A 4QABA 3UU8A 4WV9A 2LKHA 4TWDA 3UQ4A 3RQUA 2Y56A 3TLTA 4BFQA 3RI5A 4AFTA 2XYTA 2Y7YA 3SIOA 4IREA 4AFHA 4UXUA 4Z91A 4UM1A 4HFIA 2BG9B 4ZJTA 3P4WA 5HCJA 5J5HA 2C9TA 2BYRA 5AFHA 2XQ9A 4F8HA 2BYSA 2XYSA 5L4EA 4HFHA 3SH1A 3WTKA 2W8FA 3IGQA 3WIPA 5HEUA 3TLSA 5AFKA 5AFJA 4ZRUA 3SQ6A 5AFMB 2YMDA 3ZDHA 3P50A 2ZJVA 5L4HA 1I9BA 2WN9A 2X00A 4LMLA 4QH5A 3ZDGA 2XQAA 2QC1B 4XK9A 4UM3S 5J5IA 3RQWA 3RIAA 1OEDB 3U8JA 4TWFA 2M6BA 3WTOA 2BG9C 3U8MA 3EI0A 3GUAA 3WTIA 4BQTA 2MAWA 4ZZCA 3WTLA 5KZUA 2Y57A 3JAFA 4ILCA 4D01A 2VL0A 3WTHA 2XQ5A 3EAMA 3TLVA 4EZ1A 2LKGA 2UZ6A 2BJ0A 2XQ8A 3PEOA 3UQ7A 5TVCA 2X00D 5IUXA 5LG3A 5AINA 4PIRA 3JAEA 3LSVA 3UU4A 3T4MA 5HEGA 3U8NA 2WNLA 4ZR6A 3C79A 4A97A 4TNWA 3U8LA 2Y58A 1OEDC 2BG9A 2ZJUA 5HEJA 2BR7A 4UM3P 5KE4A 5BW2A 4A98A 3UU6A 2BYPA 5JMEA 4HQPA 3UU3A 2YN6A 2WZYA 4UY2A 4ZK1A 1UX2A 2XQ6A 2Y54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFB A;  5J5F A;  4COF A;  1OED E;  2BYN A;  5HEO A;  4Z90 A;  3ZKR A;  4QAA A;  2YKS A;  4NPP A;  3WTJ A;  2XNT A;  5FJV A;  3WTM A;  5BRX A;  3UU5 A;  3TLW A;  2YME A;  5J5G A;  2XNV A;  4ZZB A;  1OED A;  2PH9 A;  2BG9 E;  2XZ6 A;  4ILB A;  2LM2 A;  4HFE A;  4QH4 A;  5J0Z A;  2KSR A;  4TWH A;  2M6I A;  4ILA A;  4IL9 A;  4LMJ A;  4TNV A;  1UV6 A;  2XNU A;  4LMK A;  5LXB A;  4QAC A;  3JAD A;  2XQ4 A;  2YOE A;  4FRR A;  2BYQ A;  5HEH A;  2LLY A;  4UM3 A;  2BR8 A;  3U8K A;  5AFL A;  3EHZ A;  5SYO A;  3WTN A;  4AFG A;  3SQ9 A;  4ALX A;  3RHW A;  4B5D A;  4NZB A;  5AFM A;  3C84 A;  4X5T A;  2W8G A;  4QH1 A;  5AFN A;  4ZK4 A;  4HFD A;  5HCM A;  1UW6 A;  2WNJ A;  4HFB A;  2XZ5 A;  5L47 A;  5CO5 A;  3TLU A;  2XQ3 A;  4XHE A;  2WNC A;  3UUB A;  4ZJS A;  4HFC A;  3RIF A;  4DBM A;  3PMZ A;  2XQ7 A;  2PGZ A;  5BP0 A;  4IL4 A;  4QAB A;  3UU8 A;  4WV9 A;  2LKH A;  4TWD A;  3UQ4 A;  3RQU A;  2Y56 A;  3TLT A;  4BFQ A;  3RI5 A;  4AFT A;  2XYT A;  2Y7Y A;  3SIO A;  4IRE A;  4AFH A;  4UXU A;  4Z91 A;  4UM1 A;  4HFI A;  2BG9 B;  4ZJT A;  3P4W A;  5HCJ A;  5J5H A;  2C9T A;  2BYR A;  5AFH A;  2XQ9 A;  4F8H A;  2BYS A;  2XYS A;  5L4E A;  4HFH A;  3SH1 A;  3WTK A;  2W8F A;  3IGQ A;  3WIP A;  5HEU A;  3TLS A;  5AFK A;  5AFJ A;  4ZRU A;  3SQ6 A;  5AFM B;  2YMD A;  3ZDH A;  3P50 A;  2ZJV A;  5L4H A;  1I9B A;  2WN9 A;  2X00 A;  4LML A;  4QH5 A;  3ZDG A;  2XQA A;  2QC1 B;  4XK9 A;  4UM3 S;  5J5I A;  3RQW A;  3RIA A;  1OED B;  3U8J A;  4TWF A;  2M6B A;  3WTO A;  2BG9 C;  3U8M A;  3EI0 A;  3GUA A;  3WTI A;  4BQT A;  2MAW A;  4ZZC A;  3WTL A;  5KZU A;  2Y57 A;  3JAF A;  4ILC A;  4D01 A;  2VL0 A;  3WTH A;  2XQ5 A;  3EAM A;  3TLV A;  4EZ1 A;  2LKG A;  2UZ6 A;  2BJ0 A;  2XQ8 A;  3PEO A;  3UQ7 A;  5TVC A;  2X00 D;  5IUX A;  5LG3 A;  5AIN A;  4PIR A;  3JAE A;  3LSV A;  3UU4 A;  3T4M A;  5HEG A;  3U8N A;  2WNL A;  4ZR6 A;  3C79 A;  4A97 A;  4TNW A;  3U8L A;  2Y58 A;  1OED C;  2BG9 A;  2ZJU A;  5HEJ A;  2BR7 A;  4UM3 P;  5KE4 A;  5BW2 A;  4A98 A;  3UU6 A;  2BYP A;  5JME A;  4HQP A;  3UU3 A;  2YN6 A;  2WZY A;  4UY2 A;  4ZK1 A;  1UX2 A;  2XQ6 A;  2Y54 A; 
#chains in the Genus database with same CATH topology
 1LRZ A;  3CQC B;  2X68 A;  3ZYK A;  2KWH A;  1IJ5 A;  2LM2 A;  4HFE A;  2JPF A;  2N9D A;  3RYF E;  5LGU B;  4LMJ A;  4QHO A;  4CXW A;  4FRR A;  4H9N C;  2LLY A;  2XAJ B;  4B5D A;  3U78 A;  4AQG A;  3BQI A;  2UXN B;  2HN2 A;  2W8G A;  5AFN A;  1UX5 A;  4H9S E;  3KV6 A;  2LRK A;  4YJ3 E;  2MPK A;  1U5P A;  3LK2 B;  1IBL T;  3RIU C;  4DO0 A;  4BFQ A;  1OXZ A;  2J62 A;  4AFT A;  4ZI3 C;  4AKL A;  4UM1 A;  4JI7 T;  4F8H A;  5HXH A;  5HXC A;  4P1N A;  2NOX A;  4NUV A;  4UXN B;  3PUY F;  2LSY A;  4UV8 B;  3D0T A;  4A5X A;  5ADX L;  5L3E B;  5AQL B;  4BAY B;  4BQT A;  3WTL A;  1BR0 A;  3NRX A;  2PFV A;  4JI4 T;  3ZMU B;  1KF6 A;  2GK9 A;  1HNW T;  4H9O C;  4LFC T;  4B3S T;  4AKH A;  1E1H B;  3IBP A;  4E7Z A;  4TNW A;  2Y58 A;  4CI2 B;  5KE4 A;  5LMU T;  5JME A;  4HQP A;  3MK7 C;  2LJL A;  2XQ6 A;  5J5F A;  4PFP A;  1I6Z A;  4QKN A;  1XNR T;  5F5W A;  4TX5 A;  2JJ9 A;  4WBN E;  5LXB A;  3K8P C;  5AQK B;  5LJM A;  1WR0 A;  2PTF A;  2X0H A;  2B1E A;  2MYS A;  4AXP A;  4LF8 T;  2ZM8 A;  4ZK4 A;  3L3P A;  5FY0 A;  3PUV F;  2UXB T;  2RA1 A;  3PUR A;  2IIU A;  2BBH A;  4ZJS A;  3PMZ A;  3IA3 A;  2VUR A;  2YDQ A;  5LXT E;  3V5S A;  5LHH B;  4I43 B;  3T1H T;  4HWH A;  2XYT A;  4IRE A;  4B3T T;  5HCJ A;  2W00 A;  3I0O A;  2W8F A;  4JEU B;  5FL0 A;  3AE2 A;  2V5D A;  4WNK A;  4GKK T;  3ZCJ A;  5L3D B;  4NXM T;  1Y01 A;  4M1P A;  4O2B E;  5HWX A;  3U8M A;  4E7S A;  3WTI A;  4ZZC A;  3JAF A;  3ZMZ B;  3LJC A;  4DV2 T;  2NTY A;  1CUN A;  3RH3 A;  4AQF A;  3LSV A;  5CJ5 A;  4IDN A;  4JI6 T;  2E9X D;  3ZLI A;  4IIJ E;  3AE4 A;  2IAK A;  3LBX A;  2PBI A;  4UY2 A;  3EDV A;  4YXD A;  1OED E;  2VK9 A;  4AIU A;  5BRX A;  1OED A;  2PH9 A;  3CQG B;  4IE6 A;  5ABG A;  2E9X B;  2XNU A;  2XM1 A;  3M65 A;  4PW8 A;  5LJN A;  5L3C B;  2UUC T;  5HEH A;  3SWH A;  2BR8 A;  3PDY A;  3SQ9 A;  1LKX A;  2CRB A;  4HTE A;  3L39 A;  2W63 A;  1XMQ T;  2LSG A;  4KHP T;  2WNJ A;  2YIN A;  4IDQ A;  4IDP A;  1HNX T;  3PJA A;  4DBM A;  2XQ7 A;  4LFB T;  1IBK T;  1FJG T;  2D9D A;  4AKG A;  4L9I A;  5KX5 E;  3NZP A;  2AXD S;  3P4W A;  4O4H E;  3RLF F;  2XQ9 A;  2BYS A;  3PU3 A;  4DR4 T;  3ETV A;  5LBQ B;  3LDQ B;  4IGU A;  3UUX B;  2I6H A;  3TLS A;  3CX8 B;  4IE4 A;  3P50 A;  1YKE B;  2E5L T;  2WBL A;  3ZDG A;  4X66 T;  4GK0 E;  4U2Y A;  4G63 A;  5JR9 C;  2LSK A;  1MIY A;  4LF5 T;  2HN1 A;  3AE5 A;  4HWD A;  3C4X A;  1MND A;  3I9Y A;  2JQQ A;  2BG9 A;  1SE7 A;  3ETU A;  5LP6 E;  3PUZ F;  2YN6 A;  4K0U A;  2IC6 A;  2J4G A;  3Q5D A;  2VQE T;  4QXH B;  4UVB B;  2KWI B;  2OA5 A;  3GN5 A;  1HF8 A;  2JRK A;  5FVL A;  4H9P C;  3P7I A;  4EZH A;  4TN7 B;  2W66 A;  2KSR A;  4JI3 T;  4JI0 T;  2WS3 A;  4CN6 A;  3SFD A;  3Q2M A;  4HWC A;  2QRX A;  3MA9 A;  4PK6 A;  4AKR B;  4JV5 T;  3AVR A;  4DR5 T;  1E7P A;  2NTX A;  1OWA A;  2E2A A;  2PGZ A;  2Q9Q D;  2NR4 A;  3PE0 A;  3AE6 A;  2CLY B;  2Y7Y A;  1E2A A;  5AFH A;  4DV3 T;  3K3N A;  4CI1 B;  3GMI A;  3SQ6 A;  3N5L A;  2V7I A;  2XQY A;  5GON E;  2BVL A;  2BZB A;  4MBQ A;  2H7O A;  2XAH B;  3L09 A;  5LYJ E;  3NRY A;  3RYC E;  3RKG A;  4ZI2 C;  4O2A E;  3R84 B;  2CCQ A;  1D0X A;  3HR0 A;  3RKO A;  1ZKE A;  3AEB A;  1IJ6 A;  3WI3 A;  3RYH E;  2XTL A;  2XZE A;  3NBX X;  2WZY A;  1J1J A;  2Y54 A;  5CFB A;  4X1K E;  2BYN A;  4OHF A;  4WW0 A;  2I59 A;  5J2T E;  3GWH A;  4UR9 A;  2XZ6 A;  1I94 T;  5FP3 A;  3QOF A;  3KDS E;  1QSD A;  4H63 V;  4TZ4 C;  3UFG A;  1D0Y A;  3N2O A;  2FUP A;  2Q9Q A;  2IC9 A;  2E9X C;  1FEW A;  4UF0 A;  2XAS B;  3ZN1 B;  4H63 H;  4XAX B;  4C91 A;  2FJD A;  5L47 A;  1LVF A;  4GYR A;  3VRB A;  2HPL A;  5AQV B;  2K3W A;  4QAB A;  5IYZ E;  1UK5 A;  2Y56 A;  5DJQ C;  4HEA A;  4HFV A;  5JRE A;  5FNV E;  4WZX A;  4U2Z A;  4Z91 A;  4JI5 T;  2OV9 A;  3RYI E;  4EEB A;  4KMC A;  2L9Q A;  3RIA A;  3Q5E A;  3WTO A;  4TWF A;  4ZHQ E;  2QA7 A;  4YTN A;  1B7T A;  3EAM A;  2WMO A;  2YK0 A;  3UU4 A;  3T4M A;  2WP9 A;  4NXN T;  3KBT A;  3I1A A;  4PJJ A;  3OJA A;  2W67 A;  4PFO A;  4PNI A;  4IE0 A;  5HEJ A;  4O4L E;  3CQX C;  3UU3 A;  3F31 A;  1UX2 A;  3KV5 A;  4UIG A;  3AXJ A;  5FJV A;  3UU5 A;  4WBO A;  4X20 E;  1N32 T;  2VL8 A;  4EXT A;  3MAC A;  2ES0 A;  5C2T A;  2M6I A;  1M62 A;  4FJO A;  3JAD A;  2L3L A;  2HH7 A;  4P0A A;  2N2N A;  3FZK B;  5LBM A;  2VKJ A;  2Y48 B;  1VCS A;  4JEH B;  4QH1 A;  2KIN B;  4PJL A;  2VVS A;  5LNK A;  2XQ3 A;  2NWB A;  3V5U A;  4HFC A;  1XDO A;  2NW8 A;  2CXL A;  3HKE E;  2LKH A;  2WDV A;  5TAO A;  5L3B B;  4JI1 T;  5AQJ B;  4JBW F;  3RPU A;  5J5H A;  1MMG A;  2CWO A;  5FXX A;  5HEU A;  3C50 A;  5JDN A;  5L4H A;  2CLY C;  1T7S A;  2D0T A;  2DLR A;  1ZP0 A;  2VKD A;  4EZ1 A;  5F3J A;  2X66 A;  1S35 A;  5TVC A;  2LSJ A;  4I0U A;  3Q9D A;  2CPT A;  2WNL A;  3ZT6 A;  5LHI B;  3KV4 A;  4GK5 E;  4A98 A;  2ZLY A;  4JI8 T;  4COF A;  5KMG P;  4Z90 A;  3ZJ2 A;  3ZMT B;  3S4U A;  3JCF A;  3M3Z B;  2H7V C;  2H89 A;  3J9X 1;  4DR7 T;  1O3X A;  2EHO C;  2XUE A;  3PUW F;  2V5C A;  2B76 A;  3EHZ A;  1UUR A;  4PK5 A;  4TUY E;  4ANJ A;  3O1J A;  2W61 A;  1UW6 A;  2DWK A;  4DV4 T;  3N9M A;  4LF6 T;  4UVA B;  3RIF A;  2D2S A;  4UVC B;  3HKD E;  1HX1 B;  3BQL A;  4U33 A;  4OX9 T;  3AE3 A;  3KV9 A;  3SIO A;  3MXZ A;  4CI3 B;  4CQI A;  4KBM B;  4IE5 A;  2FJA A;  2FBW A;  3LBX B;  1HNZ T;  3IGQ A;  5FYM A;  3KVB A;  3H3M A;  4I50 E;  4F6R C;  3PUQ A;  1MMA A;  2WN9 A;  2CBI A;  5L3F B;  3H37 A;  3OTO T;  1HG5 A;  3SRZ A;  5LG4 A;  1OED B;  5C3J A;  3U8J A;  4YJ2 E;  2KLQ A;  4PJM A;  2VQF T;  4D01 A;  4PAG A;  5E0O A;  5FL1 A;  2KND A;  3TLV A;  1UCU A;  3L8R A;  1D0Z A;  3QUJ A;  2LEH A;  3OYX A;  2DWG A;  4BA9 A;  5HEG A;  3RX6 A;  1DU2 A;  4EOZ B;  3ZEF B;  2IUB A;  5EK4 A;  4EV6 A;  5FXV A;  3RRC A;  3P4Q A;  2JQ9 A;  5F8P A;  1FIO A;  4IDO A;  3C4Z A;  4FI5 A;  2JIW A;  4GKJ T;  3FBZ A;  4U74 A;  3WTN A;  3LG7 A;  4ALX A;  3MKD A;  2BKP A;  1ZOY A;  2V7M A;  2K24 A;  2E5V A;  1X79 A;  2HHH T;  1EZ3 A;  2XZ5 A;  2CWY A;  3OYZ A;  4QWN B;  3ZT7 A;  4UEM A;  2IHR 1;  2K9A A;  5EZY E;  4HE8 A;  1YQ4 A;  3RI5 A;  4YSZ A;  3RC8 A;  3AA1 B;  3VRA A;  2BG9 B;  2UUB T;  5AQH B;  1GQE A;  2NW9 A;  2V7L A;  3EAB A;  4BJN A;  5JDQ A;  3HKB E;  3ZDH A;  3AA7 B;  2JQH A;  3GN5 B;  2H3R A;  2W62 A;  2ZMA A;  3RF1 A;  2JMK A;  2XAG B;  2MBG A;  2L8K A;  2UXD T;  3A8Y C;  3IEE A;  4A97 A;  4CXX A;  3EVY A;  5HXR A;  4EGW A;  2R6G F;  2BYP A;  3AE8 A;  4CXY A;  1MIV A;  1HFA A;  2AE9 A;  3K3O A;  5AQR B;  4CN1 A;  3AA6 B;  3WTJ A;  5CA0 E;  2UUA T;  4C90 A;  2BG9 E;  4L0R A;  1T8B A;  3P4P A;  4AQY T;  4X64 T;  4LFA T;  4TNV A;  3P4S A;  4ZS2 A;  2YU2 A;  4X1Y E;  4I55 E;  3AEC A;  3QB5 A;  5AQG B;  2XSA A;  2PJQ A;  4MLK A;  4N78 D;  2VWA A;  5HYA A;  4AFG A;  2VKH A;  3B5M A;  2X67 A;  2CHO A;  2KMF A;  3C4W A;  1U4Q A;  2DI4 A;  4X5T A;  5LOV E;  5HCM A;  1WYB A;  4HFB A;  3ABV A;  2C5J A;  3AE9 A;  3O4X E;  2V7J A;  2E8I A;  4YLH A;  3T8O A;  4DR6 T;  5LA6 E;  3CPZ A;  4U7I A;  4B6X A;  3TLT A;  1D1B A;  1BR2 A;  4UXU A;  4DV1 T;  1YXR A;  4HFI A;  1WCR A;  4YT0 A;  2XYS A;  3N9P A;  2ZM0 A;  3WTK A;  4HFH A;  4KI0 F;  4IT4 A;  4L5G A;  4AQF C;  2CXF A;  4BJM A;  2LSI A;  3HA4 A;  2WZH A;  4LML A;  4HWI B;  2YDS A;  2WAU A;  1VCT A;  2VVN A;  4EIW A;  5BR8 T;  3ZC0 A;  2A3D A;  2H88 A;  5DQV A;  2UZ6 A;  4YSX A;  4YTM A;  3PEO A;  4QXC B;  4ZI3 D;  4U7Y A;  5IUX A;  2X00 D;  5AIN A;  1YKH B;  1HCI A;  1ZHC A;  1HG2 A;  2CM0 A;  4AI6 A;  3C79 A;  4EYY R;  1OED C;  2Q9Q B;  2ZM6 T;  3ZCI A;  4YHH T;  4UF0 B;  5AFL A;  2A72 A;  4H9R C;  3ZKR A;  4EZ4 A;  3ZT5 A;  5J5G A;  4IE7 A;  4JLE A;  3OVU A;  5EK2 A;  4TWH A;  3QB5 K;  2NW7 A;  1UV6 A;  1HX8 A;  5AQT B;  4HN9 A;  3N9O A;  3R6N A;  4CN4 A;  1W9R A;  3U3I A;  5JRC B;  3SFE A;  3C84 A;  1NAF A;  4PK4 A;  4MFR A;  4MHC A;  2YEV C;  4DV5 T;  2KZ7 B;  4DBQ A;  3E22 E;  2J1D G;  1KNP A;  3RQU A;  4DR1 T;  2DNX A;  4DUZ T;  4JUY A;  4X1I E;  2BYR A;  5L4E A;  4X65 T;  3WIP A;  1UUS A;  2BS4 A;  3FBL A;  3RIU A;  5L3G B;  4DV0 T;  3AXJ B;  4YTP A;  4K0K T;  3PUG A;  2X00 A;  5JQG E;  1SA0 E;  2BG9 C;  3ZJ1 A;  5FXZ A;  1SUM B;  5IHY A;  4KHZ F;  4DND A;  2X9W A;  4ZI7 E;  2LKG A;  4AIS A;  3WAK A;  3ZYM A;  4O4J E;  3CML A;  4OFZ A;  1HR0 T;  5JRC A;  2WWU A;  3KBU A;  1UX4 A;  3UU6 A;  3IF8 B;  1MMN A;  4OYK A;  3C51 A;  1XZY A;  3BQK A;  3WTM A;  3ESL A;  1M7K A;  2MOZ A;  4ILB A;  4AKI A;  2G0U A;  1FMV A;  4U3C A;  2DL1 A;  2P9B A;  3PJA J;  4Q25 A;  2LHN A;  1D1A A;  4IST A;  3KIN B;  4DBR A;  3UUL A;  2X51 A;  2XJ7 A;  3ONL C;  1NEK A;  3N9Q A;  2UXX B;  1NWM X;  2C5K T;  5BP0 A;  4IL4 A;  2W4X A;  3UQ4 A;  3G06 A;  2M67 A;  2PG8 A;  1QUU A;  2MTQ A;  5ABF A;  4HGA A;  2V8S V;  2LOP A;  3J7Y q;  1L0V A;  2WDR A;  2WU2 A;  2V6Y B;  2X9X A;  4A56 A;  2ZJV A;  5FMN A;  2XQA A;  4UM3 S;  5JVD E;  1CHU A;  1J5W A;  3ANW B;  3Q5W A;  2Y57 A;  1ZEE A;  5BMV E;  4P09 A;  3I0Q A;  3PUA A;  3DP7 A;  2KXP B;  2CE7 A;  3EDU A;  5J1G A;  3LK3 B;  2CBJ A;  3KVA A;  1D1C A;  1MMD A;  3N9L A;  4GOU A;  3UT5 E;  2C5I T;  2A9U A;  2NP9 A;  2BKN A;  2I0M A;  3VKG A;  4V1A v;  4OK0 A;  2XNV A;  5ETW A;  1BR1 A;  2ODU A;  2Q9Q C;  4ISS A;  4O8S A;  4LMK A;  1N36 T;  5CGM A;  5KXJ A;  5A1L A;  3HKC E;  1JNZ A;  1WR6 A;  2XQ4 A;  2WQY A;  5AQP B;  2F4V T;  5JDL A;  2V7K A;  1YW0 A;  4MAL A;  2V6Y A;  4OYJ A;  3CX7 B;  4YFS A;  2VB6 A;  4EED A;  5JR9 B;  3DTO A;  5AQN B;  2YU1 A;  4NIQ A;  1KK7 A;  4ZXL A;  3ANW A;  3AEG A;  4DV6 T;  3MZK B;  3AE7 A;  2VAS A;  1US7 B;  2CA5 A;  2X9Y A;  1YQ3 A;  4TWD A;  3AAE B;  2CXD A;  2CHN A;  4TV9 E;  5C8Y E;  3O1I A;  3ZST A;  3PV0 F;  3SOL A;  2HPJ A;  2ZM2 A;  3UFE A;  4DID B;  1QLB A;  1N34 T;  5HXE A;  3ZC1 A;  3OPC A;  4ZRU A;  3UUM A;  1IAP A;  4LF4 T;  4NUU A;  2QC1 B;  3W15 B;  3GA8 A;  4KUM B;  2BVM A;  3P4R A;  2M6B A;  2ACX A;  1WFD A;  1AJ3 A;  4HKA A;  2X0Y A;  3K3Q C;  4PIR A;  3JAE A;  1G73 A;  4XBF B;  1MNE A;  2V6X A;  3B57 A;  3ONJ A;  4DUY T;  4U72 A;  5JR9 A;  4UEL A;  4ZK1 A;  3WAJ A;  4EYU A;  5JDM A;  4LF7 T;  2YME A;  4B3R T;  2A2F X;  4Z8X A;  5FVK A;  3JC6 D;  5J0Z A;  4QH4 A;  2LM9 A;  5AFU L;  4ILA A;  5FY7 A;  4ZI2 D;  2BBJ A;  1WYC A;  2YOE A;  5JDH A;  5JDF A;  3DJB A;  3FZF B;  3U8K A;  1N33 T;  5SYO A;  2JMH A;  5AQU B;  2RP4 A;  5L2L A;  2WDQ A;  2WSS V;  1WRD A;  2JQK A;  5IWA T;  3QC9 A;  4DVD A;  3TLU A;  4ERR A;  1R8I A;  3OKQ A;  2BDE A;  2LRL A;  2LT3 A;  3UU8 A;  2XY8 B;  3C98 B;  4ILU A;  3A7M A;  4DMW A;  3FXE B;  4ZOL E;  3RRW A;  5AFJ A;  3AEF A;  1VRB A;  3NWI A;  4J2C A;  5LMN T;  3AB3 B;  5HXS A;  3EI0 A;  3K1S A;  4DR2 T;  2VL0 A;  3WTH A;  3PU8 A;  2BJ0 A;  1WLX A;  3PUX F;  1XWM A;  4GYS A;  2WMN A;  4ZR6 A;  1VOM A;  2OLT A;  3EUH A;  2BR7 A;  1SHZ C;  3UUN A;  3VR9 A;  3F2E A;  3VKH A;  2XNT A;  3TLW A;  1NEN A;  2K48 A;  1H7C A;  5J2U E;  2QGS A;  2C0S A;  4IL9 A;  1V9D A;  2K5B B;  5HAX A;  3HI2 A;  3CK6 A;  5H6Q B;  1ZV4 X;  3ONX A;  3RHW A;  3TKL B;  3NZQ A;  4WYV A;  3CKD A;  2XAF B;  2LE8 A;  2BS2 A;  4U31 A;  2N1G A;  3UUB A;  4JYA T;  2J47 A;  2V1D B;  2YDR A;  5ABH A;  1BR4 A;  1J5E T;  1KFY A;  2E9X A;  1X9B A;  2ACZ A;  3N2G E;  1LVK A;  3FB2 A;  4H9Q C;  2Y6X A;  3PTR B;  3N2K E;  5EK3 A;  3AEE A;  3VHL A;  4PJN A;  2DHR A;  2YMD A;  2WY2 A;  1T72 A;  4QH5 A;  3LK4 2;  4IHJ E;  4XK9 A;  2IML A;  3RQW A;  4YSY A;  5HWY A;  5KZU A;  1KNZ A;  3PUS A;  3E08 A;  4ILC A;  2XQ5 A;  3AAI A;  2KT9 A;  2BS3 A;  2WU5 A;  2XQ8 A;  2QVA A;  4UV9 B;  4YY3 T;  1W0B A;  2WWV A;  2UU9 T;  2ZJU A;  2XSB A;  5ABE A;  5BW2 A;  3T1Y T;  2CMR A;  5FY1 A;  4P0B A;  3N9N A;  3AE1 A;  3RC3 A;  4QAA A;  2YKS A;  4NPP A;  2XHE B;  3LFM A;  4IDZ A;  4ZZB A;  2DCF A;  3CWZ B;  5DAB A;  4QAC A;  4EAH A;  1XNQ T;  4ZS3 A;  2BYQ A;  3ZSS A;  3CVR A;  4DMV A;  2WZI A;  3UTK A;  2XPK A;  5CB4 E;  3AAA B;  5LHG B;  4HFD A;  2W2U A;  4DV7 T;  4GIW A;  1T98 A;  2IW5 B;  4XHE A;  3H3A A;  4G2A A;  3O9X A;  2QYW A;  1Z8U A;  4WV9 A;  2D0U A;  2EHO D;  3F57 A;  3ZYL A;  4TV8 E;  2Z6E A;  3JC6 C;  5FKY A;  3AA0 B;  4DR3 T;  3AVS A;  3AED A;  4ASK A;  5AFM B;  3ZMS B;  3HL6 A;  2WM9 A;  2VKO A;  2EHO B;  2BKO A;  3VU7 H;  3B13 A;  2V26 A;  2MAW A;  3CX6 B;  5AQO B;  4LF9 T;  1W09 A;  4O4I E;  5LB7 B;  3O1H A;  4X62 T;  5LG3 A;  3U8N A;  3FZM B;  4YHJ A;  4QXB B;  5AQM B;  4UM3 P;  3E0Z A;  2LOS A;  2RPA A;  5HEO A;  5AQI B;  1KEY A;  3VR8 A;  3NKZ A;  3QK6 A;  3AEA A;  5JTG A;  2LHR A;  1XMO T;  5DQW A;  3FXD B;  1XDP A;  3MJX A;  4UM3 A;  5CA1 E;  5ABF B;  3BK9 A;  3ZN0 B;  3A5X A;  3IHR A;  4NZB A;  1Z0P A;  1UGO A;  4CZZ B;  5AFM A;  5AQS B;  3X1D A;  2WCA A;  2FJB A;  1FMW A;  5JH7 E;  2IDO B;  3CIR A;  3RGL A;  2EHO A;  5CO5 A;  4EB6 E;  2WNC A;  2XAQ B;  5LGT B;  1Y64 B;  2W0G A;  3QNU A;  2X0L B;  2Y8D A;  3SS1 A;  3FZH B;  4XZC A;  2FJE A;  1W0A A;  4KX6 A;  3ZPO A;  1HTJ F;  3Q5X A;  5FXW A;  5M4Y A;  4AFH A;  1KNR A;  2CEA A;  4ZJT A;  4HWF A;  2C9T A;  1HS7 A;  1JNR A;  3FHN A;  3SH1 A;  5AFK A;  5AQQ B;  5LCY A;  1YD8 G;  1I9B A;  2UXC T;  2WB5 A;  5J5I A;  3C64 A;  2X9H A;  3GUA A;  2D5U A;  1IZN B;  4QX7 B;  3NVO A;  4ZEY A;  5JDG A;  4I4T E;  2XM2 A;  4JI2 T;  5AQF B;  3FZL B;  3ZMV B;  3UQ7 A;  1G8X A;  5H6R B;  4KP3 C;  3I9W A;  1IBM T;  2SPC A;  3OBV E;  2ODV A;  3U8L A;  1S94 A;  4QX8 B;  3P8C D;  5LGN B;  4ADZ A;  5KDM C;  4B3M T;  1MIW A;  3KFW X; 
#chains in the Genus database with same CATH homology
 5CFB A;  5J5F A;  4COF A;  1OED E;  2BYN A;  5HEO A;  4Z90 A;  3ZKR A;  4QAA A;  2YKS A;  4NPP A;  3WTJ A;  2XNT A;  5FJV A;  3WTM A;  5BRX A;  3UU5 A;  3TLW A;  2YME A;  5J5G A;  2XNV A;  4ZZB A;  1OED A;  2PH9 A;  2BG9 E;  2XZ6 A;  4ILB A;  2LM2 A;  4HFE A;  4QH4 A;  5J0Z A;  2KSR A;  4TWH A;  2M6I A;  4ILA A;  4IL9 A;  4LMJ A;  4TNV A;  1UV6 A;  2XNU A;  4LMK A;  5LXB A;  4QAC A;  3JAD A;  2XQ4 A;  2YOE A;  4FRR A;  2BYQ A;  5HEH A;  2LLY A;  4UM3 A;  2BR8 A;  3U8K A;  5AFL A;  3EHZ A;  5SYO A;  3WTN A;  4AFG A;  3SQ9 A;  4ALX A;  3RHW A;  4B5D A;  4NZB A;  5AFM A;  3C84 A;  4X5T A;  2W8G A;  4QH1 A;  5AFN A;  4ZK4 A;  4HFD A;  5HCM A;  1UW6 A;  2WNJ A;  4HFB A;  2XZ5 A;  5L47 A;  5CO5 A;  3TLU A;  2XQ3 A;  4XHE A;  2WNC A;  3UUB A;  4ZJS A;  4HFC A;  3RIF A;  4DBM A;  3PMZ A;  2XQ7 A;  2PGZ A;  5BP0 A;  4IL4 A;  4QAB A;  3UU8 A;  4WV9 A;  2LKH A;  4TWD A;  3UQ4 A;  3RQU A;  2Y56 A;  3TLT A;  4BFQ A;  3RI5 A;  4AFT A;  2XYT A;  2Y7Y A;  3SIO A;  4IRE A;  4AFH A;  4UXU A;  4Z91 A;  4UM1 A;  4HFI A;  2BG9 B;  4ZJT A;  3P4W A;  5HCJ A;  5J5H A;  2C9T A;  2BYR A;  5AFH A;  2XQ9 A;  4F8H A;  2BYS A;  2XYS A;  5L4E A;  4HFH A;  3SH1 A;  3WTK A;  2W8F A;  3IGQ A;  3WIP A;  5HEU A;  3TLS A;  5AFK A;  5AFJ A;  4ZRU A;  3SQ6 A;  5AFM B;  2YMD A;  3ZDH A;  3P50 A;  2ZJV A;  5L4H A;  1I9B A;  2WN9 A;  2X00 A;  4LML A;  4QH5 A;  3ZDG A;  2XQA A;  2QC1 B;  4XK9 A;  4UM3 S;  5J5I A;  3RQW A;  3RIA A;  1OED B;  3U8J A;  4TWF A;  2M6B A;  3WTO A;  2BG9 C;  3U8M A;  3EI0 A;  3GUA A;  3WTI A;  4BQT A;  2MAW A;  4ZZC A;  3WTL A;  5KZU A;  2Y57 A;  3JAF A;  4ILC A;  4D01 A;  2VL0 A;  3WTH A;  2XQ5 A;  3EAM A;  3TLV A;  4EZ1 A;  2LKG A;  2UZ6 A;  2BJ0 A;  2XQ8 A;  3PEO A;  3UQ7 A;  5TVC A;  2X00 D;  5IUX A;  5LG3 A;  5AIN A;  4PIR A;  3JAE A;  3LSV A;  3UU4 A;  3T4M A;  5HEG A;  3U8N A;  2WNL A;  4ZR6 A;  3C79 A;  4A97 A;  4TNW A;  3U8L A;  2Y58 A;  1OED C;  2BG9 A;  2ZJU A;  5HEJ A;  2BR7 A;  4UM3 P;  5KE4 A;  5BW2 A;  4A98 A;  3UU6 A;  2BYP A;  5JME A;  4HQP A;  3UU3 A;  2YN6 A;  2WZY A;  4UY2 A;  4ZK1 A;  1UX2 A;  2XQ6 A;  2Y54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...