3PMZA

Crystal structure of the complex of acetylcholine binding protein and d-tubocurarine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Choline-binding protein
molecule keywords Soluble acetylcholine receptor
publication title The Curare Alkaloids: Analyzing the Poses of Complexes with the Acetylcholine Binding Protein in Relation to Structure and Binding Energies
rcsb
source organism Aplysia californica
total genus 53
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3pmzA00
2YMDA 4HFCA 4HFEA 5HEOA 4ZK4A 3UU6A 4ALXA 4DBMA 2XQ7A 4ILCA 3EAMA 3JAEA 3WTJA 4D01A 3U8KA 4BFQA 4ILAA 2Y54A 2YOEA 2ZJVA 4UM3A 4B5DA 3U8LA 2BYPA 3ZDGA 3GUAA 4LMKA 4AFGA 3WTOA 4COFA 4LMJA 2C9TA 2XQ4A 2XNVA 4QH4A 3P4WA 5CO5A 5AFNA 2Y7YA 4A97A 3EI0A 4EZ1A 4TNWA 3RI5A 3TLSA 4HFBA 2BG9C 4WV9A 5AINA 3TLVA 4PIRA 4ZZBA 4QABA 5HEJA 5L4EA 4F8HA 5AFJA 5LG3A 2QC1B 5SYOA 3WIPA 3WTIA 5IUXA 4ZR6A 3T4MA 2XQ3A 2WNCA 4IL9A 4IREA 4TWDA 2BR7A 2VL0A 2WN9A 3RIFA 4UM1A 3TLUA 3P50A 2PGZA 2XYTA 4UM3S 2Y57A 5L4HA 4AFTA 4QH1A 2W8FA 2BYRA 4HQPA 5AFMA 5J5GA 3ZKRA 3WTKA 5HCMA 2YKSA 2BG9A 4TWHA 2YN6A 3RIAA 4AFHA 3U8JA 2Y56A 5BP0A 3UU4A 1I9BA 2PH9A 5J5HA 3PMZA 5HCJA 4ILBA 3SIOA 2UZ6A 2YMEA 4X5TA 3UQ4A 5CFBA 5HEGA 3SQ6A 4UXUA 3RQWA 3SQ9A 3UU5A 3UU3A 3SH1A 5AFLA 5AFKA 3ZDHA 2ZJUA 4NZBA 5AFMB 4TWFA 1UV6A 4FRRA 4A98A 3JAFA 3PEOA 3WTHA 2XNUA 1UW6A 4QH5A 4ZJSA 2BG9B 3C79A 4NPPA 4ZRUA 2BYSA 4HFDA 4ZK1A 2XZ5A 2W8GA 2BG9E 4QAAA 4Z91A 3RHWA 2BYNA 4TNVA 3WTNA 5L47A 2XZ6A 4UY2A 2XQ5A 4IL4A 3TLWA 2XYSA 4UM3P 3WTMA 2XQ6A 3IGQA 4QACA 5HEUA 4LMLA 4HFHA 5BW2A 3U8NA 3JADA 4ZZCA 5BRXA 2XQ8A 3EHZA 4Z90A 2X00D 5LXBA 5J0ZA 2XQ9A 3TLTA 3UUBA 5HEHA 4BQTA 2Y58A 5TVCA 3UU8A 4HFIA 2WZYA 5JMEA 5J5IA 5KZUA 3WTLA 2BYQA 3U8MA 2WNJA 2X00A 4XK9A 5FJVA 2XQAA 3UQ7A 5AFHA 2XNTA 2BJ0A 4ZJTA 2WNLA 4XHEA 3C84A 3LSVA 3RQUA 5KE4A 5J5FA 2BR8A 1UX2A
chains in the Genus database with same CATH superfamily
2YMDA 4HFCA 4HFEA 5HEOA 4ZK4A 3UU6A 4ALXA 4DBMA 2XQ7A 4ILCA 3EAMA 3JAEA 3WTJA 4D01A 3U8KA 4BFQA 4ILAA 2Y54A 2YOEA 2ZJVA 4UM3A 4B5DA 3U8LA 2BYPA 3ZDGA 3GUAA 4LMKA 4AFGA 3WTOA 4COFA 4LMJA 2C9TA 2XQ4A 2XNVA 4QH4A 3P4WA 5CO5A 5AFNA 2Y7YA 4A97A 3EI0A 4EZ1A 4TNWA 3RI5A 3TLSA 4HFBA 2BG9C 4WV9A 5AINA 3TLVA 4PIRA 4ZZBA 4QABA 5HEJA 5L4EA 4F8HA 5AFJA 5LG3A 2QC1B 5SYOA 3WIPA 3WTIA 5IUXA 4ZR6A 3T4MA 2XQ3A 2WNCA 4IL9A 4IREA 4TWDA 2BR7A 2VL0A 2WN9A 3RIFA 4UM1A 3TLUA 3P50A 2PGZA 2XYTA 4UM3S 2Y57A 5L4HA 4AFTA 4QH1A 2W8FA 2BYRA 4HQPA 5AFMA 5J5GA 3ZKRA 3WTKA 5HCMA 2YKSA 2BG9A 4TWHA 2YN6A 3RIAA 4AFHA 3U8JA 2Y56A 5BP0A 3UU4A 1I9BA 2PH9A 5J5HA 3PMZA 5HCJA 4ILBA 3SIOA 2UZ6A 2YMEA 4X5TA 3UQ4A 5CFBA 5HEGA 3SQ6A 4UXUA 3RQWA 3SQ9A 3UU5A 3UU3A 3SH1A 5AFLA 5AFKA 3ZDHA 2ZJUA 4NZBA 5AFMB 4TWFA 1UV6A 4FRRA 4A98A 3JAFA 3PEOA 3WTHA 2XNUA 1UW6A 4QH5A 4ZJSA 2BG9B 3C79A 4NPPA 4ZRUA 2BYSA 4HFDA 4ZK1A 2XZ5A 2W8GA 2BG9E 4QAAA 4Z91A 3RHWA 2BYNA 4TNVA 3WTNA 5L47A 2XZ6A 4UY2A 2XQ5A 4IL4A 3TLWA 2XYSA 4UM3P 3WTMA 2XQ6A 3IGQA 4QACA 5HEUA 4LMLA 4HFHA 5BW2A 3U8NA 3JADA 4ZZCA 5BRXA 2XQ8A 3EHZA 4Z90A 2X00D 5LXBA 5J0ZA 2XQ9A 3TLTA 3UUBA 5HEHA 4BQTA 2Y58A 5TVCA 3UU8A 4HFIA 2WZYA 5JMEA 5J5IA 5KZUA 3WTLA 2BYQA 3U8MA 2WNJA 2X00A 4XK9A 5FJVA 2XQAA 3UQ7A 5AFHA 2XNTA 2BJ0A 4ZJTA 2WNLA 4XHEA 3C84A 3LSVA 3RQUA 5KE4A 5J5FA 2BR8A 1UX2A
chains in the Genus database with same CATH topology
2YMDA 4HFCA 4HFEA 5HEOA 4ZK4A 3UU6A 4ALXA 4DBMA 2XQ7A 4ILCA 3EAMA 3JAEA 3WTJA 4D01A 3U8KA 4BFQA 4ILAA 2Y54A 2YOEA 2ZJVA 4UM3A 4B5DA 3U8LA 2BYPA 3ZDGA 3GUAA 4LMKA 4AFGA 3WTOA 4COFA 4LMJA 2C9TA 2XQ4A 2XNVA 4QH4A 3P4WA 5CO5A 5AFNA 2Y7YA 4A97A 3EI0A 4EZ1A 4TNWA 3RI5A 3TLSA 4HFBA 2BG9C 4WV9A 5AINA 3TLVA 4PIRA 4ZZBA 4QABA 5HEJA 5L4EA 4F8HA 5AFJA 5LG3A 2QC1B 5SYOA 3WIPA 3WTIA 5IUXA 4ZR6A 3T4MA 2XQ3A 2WNCA 4IL9A 4IREA 4TWDA 2BR7A 2VL0A 2WN9A 3RIFA 4UM1A 3TLUA 3P50A 2PGZA 2XYTA 4UM3S 2Y57A 5L4HA 4AFTA 4QH1A 2W8FA 2BYRA 4HQPA 5AFMA 5J5GA 3ZKRA 3WTKA 5HCMA 2YKSA 2BG9A 4TWHA 2YN6A 3RIAA 4AFHA 3U8JA 2Y56A 5BP0A 3UU4A 1I9BA 2PH9A 5J5HA 3PMZA 5HCJA 4ILBA 3SIOA 2UZ6A 2YMEA 4X5TA 3UQ4A 5CFBA 5HEGA 3SQ6A 4UXUA 3RQWA 3SQ9A 3UU5A 3UU3A 3SH1A 5AFLA 5AFKA 3ZDHA 2ZJUA 4NZBA 5AFMB 4TWFA 1UV6A 4FRRA 4A98A 3JAFA 3PEOA 3WTHA 2XNUA 1UW6A 4QH5A 4ZJSA 2BG9B 3C79A 4NPPA 4ZRUA 2BYSA 4HFDA 4ZK1A 2XZ5A 2W8GA 2BG9E 4QAAA 4Z91A 3RHWA 2BYNA 4TNVA 3WTNA 5L47A 2XZ6A 4UY2A 2XQ5A 4IL4A 3TLWA 2XYSA 4UM3P 3WTMA 2XQ6A 3IGQA 4QACA 5HEUA 4LMLA 4HFHA 5BW2A 3U8NA 3JADA 4ZZCA 5BRXA 2XQ8A 3EHZA 4Z90A 2X00D 5LXBA 5J0ZA 2XQ9A 3TLTA 3UUBA 5HEHA 4BQTA 2Y58A 5TVCA 3UU8A 4HFIA 2WZYA 5JMEA 5J5IA 5KZUA 3WTLA 2BYQA 3U8MA 2WNJA 2X00A 4XK9A 5FJVA 2XQAA 3UQ7A 5AFHA 2XNTA 2BJ0A 4ZJTA 2WNLA 4XHEA 3C84A 3LSVA 3RQUA 5KE4A 5J5FA 2BR8A 1UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMD A;  4HFC A;  4HFE A;  5HEO A;  4ZK4 A;  3UU6 A;  4ALX A;  4DBM A;  2XQ7 A;  4ILC A;  3EAM A;  3JAE A;  3WTJ A;  4D01 A;  3U8K A;  4BFQ A;  4ILA A;  2Y54 A;  2YOE A;  2ZJV A;  4UM3 A;  4B5D A;  3U8L A;  2BYP A;  3ZDG A;  3GUA A;  4LMK A;  4AFG A;  3WTO A;  4COF A;  4LMJ A;  2C9T A;  2XQ4 A;  2XNV A;  4QH4 A;  3P4W A;  5CO5 A;  5AFN A;  2Y7Y A;  4A97 A;  3EI0 A;  4EZ1 A;  4TNW A;  3RI5 A;  3TLS A;  4HFB A;  2BG9 C;  4WV9 A;  5AIN A;  3TLV A;  4PIR A;  4ZZB A;  4QAB A;  5HEJ A;  5L4E A;  4F8H A;  5AFJ A;  5LG3 A;  2QC1 B;  5SYO A;  3WIP A;  3WTI A;  5IUX A;  4ZR6 A;  3T4M A;  2XQ3 A;  2WNC A;  4IL9 A;  4IRE A;  4TWD A;  2BR7 A;  2VL0 A;  2WN9 A;  3RIF A;  4UM1 A;  3TLU A;  3P50 A;  2PGZ A;  2XYT A;  4UM3 S;  2Y57 A;  5L4H A;  4AFT A;  4QH1 A;  2W8F A;  2BYR A;  4HQP A;  5AFM A;  5J5G A;  3ZKR A;  3WTK A;  5HCM A;  2YKS A;  2BG9 A;  4TWH A;  2YN6 A;  3RIA A;  4AFH A;  3U8J A;  2Y56 A;  5BP0 A;  3UU4 A;  1I9B A;  2PH9 A;  5J5H A;  3PMZ A;  5HCJ A;  4ILB A;  3SIO A;  2UZ6 A;  2YME A;  4X5T A;  3UQ4 A;  5CFB A;  5HEG A;  3SQ6 A;  4UXU A;  3RQW A;  3SQ9 A;  3UU5 A;  3UU3 A;  3SH1 A;  5AFL A;  5AFK A;  3ZDH A;  2ZJU A;  4NZB A;  5AFM B;  4TWF A;  1UV6 A;  4FRR A;  4A98 A;  3JAF A;  3PEO A;  3WTH A;  2XNU A;  1UW6 A;  4QH5 A;  4ZJS A;  2BG9 B;  3C79 A;  4NPP A;  4ZRU A;  2BYS A;  4HFD A;  4ZK1 A;  2XZ5 A;  2W8G A;  2BG9 E;  4QAA A;  4Z91 A;  3RHW A;  2BYN A;  4TNV A;  3WTN A;  5L47 A;  2XZ6 A;  4UY2 A;  2XQ5 A;  4IL4 A;  3TLW A;  2XYS A;  4UM3 P;  3WTM A;  2XQ6 A;  3IGQ A;  4QAC A;  5HEU A;  4LML A;  4HFH A;  5BW2 A;  3U8N A;  3JAD A;  4ZZC A;  5BRX A;  2XQ8 A;  3EHZ A;  4Z90 A;  2X00 D;  5LXB A;  5J0Z A;  2XQ9 A;  3TLT A;  3UUB A;  5HEH A;  4BQT A;  2Y58 A;  5TVC A;  3UU8 A;  4HFI A;  2WZY A;  5JME A;  5J5I A;  5KZU A;  3WTL A;  2BYQ A;  3U8M A;  2WNJ A;  2X00 A;  4XK9 A;  5FJV A;  2XQA A;  3UQ7 A;  5AFH A;  2XNT A;  2BJ0 A;  4ZJT A;  2WNL A;  4XHE A;  3C84 A;  3LSV A;  3RQU A;  5KE4 A;  5J5F A;  2BR8 A;  1UX2 A; 
#chains in the Genus database with same CATH topology
 2YMD A;  4HFC A;  4HFE A;  5HEO A;  4ZK4 A;  3UU6 A;  4ALX A;  4DBM A;  2XQ7 A;  4ILC A;  3EAM A;  3JAE A;  3WTJ A;  4D01 A;  3U8K A;  4BFQ A;  4ILA A;  2Y54 A;  2YOE A;  2ZJV A;  4UM3 A;  4B5D A;  3U8L A;  2BYP A;  3ZDG A;  3GUA A;  4LMK A;  4AFG A;  3WTO A;  4COF A;  4LMJ A;  2C9T A;  2XQ4 A;  2XNV A;  4QH4 A;  3P4W A;  5CO5 A;  5AFN A;  2Y7Y A;  4A97 A;  3EI0 A;  4EZ1 A;  4TNW A;  3RI5 A;  3TLS A;  4HFB A;  2BG9 C;  4WV9 A;  5AIN A;  3TLV A;  4PIR A;  4ZZB A;  4QAB A;  5HEJ A;  5L4E A;  4F8H A;  5AFJ A;  5LG3 A;  2QC1 B;  5SYO A;  3WIP A;  3WTI A;  5IUX A;  4ZR6 A;  3T4M A;  2XQ3 A;  2WNC A;  4IL9 A;  4IRE A;  4TWD A;  2BR7 A;  2VL0 A;  2WN9 A;  3RIF A;  4UM1 A;  3TLU A;  3P50 A;  2PGZ A;  2XYT A;  4UM3 S;  2Y57 A;  5L4H A;  4AFT A;  4QH1 A;  2W8F A;  2BYR A;  4HQP A;  5AFM A;  5J5G A;  3ZKR A;  3WTK A;  5HCM A;  2YKS A;  2BG9 A;  4TWH A;  2YN6 A;  3RIA A;  4AFH A;  3U8J A;  2Y56 A;  5BP0 A;  3UU4 A;  1I9B A;  2PH9 A;  5J5H A;  3PMZ A;  5HCJ A;  4ILB A;  3SIO A;  2UZ6 A;  2YME A;  4X5T A;  3UQ4 A;  5CFB A;  5HEG A;  3SQ6 A;  4UXU A;  3RQW A;  3SQ9 A;  3UU5 A;  3UU3 A;  3SH1 A;  5AFL A;  5AFK A;  3ZDH A;  2ZJU A;  4NZB A;  5AFM B;  4TWF A;  1UV6 A;  4FRR A;  4A98 A;  3JAF A;  3PEO A;  3WTH A;  2XNU A;  1UW6 A;  4QH5 A;  4ZJS A;  2BG9 B;  3C79 A;  4NPP A;  4ZRU A;  2BYS A;  4HFD A;  4ZK1 A;  2XZ5 A;  2W8G A;  2BG9 E;  4QAA A;  4Z91 A;  3RHW A;  2BYN A;  4TNV A;  3WTN A;  5L47 A;  2XZ6 A;  4UY2 A;  2XQ5 A;  4IL4 A;  3TLW A;  2XYS A;  4UM3 P;  3WTM A;  2XQ6 A;  3IGQ A;  4QAC A;  5HEU A;  4LML A;  4HFH A;  5BW2 A;  3U8N A;  3JAD A;  4ZZC A;  5BRX A;  2XQ8 A;  3EHZ A;  4Z90 A;  2X00 D;  5LXB A;  5J0Z A;  2XQ9 A;  3TLT A;  3UUB A;  5HEH A;  4BQT A;  2Y58 A;  5TVC A;  3UU8 A;  4HFI A;  2WZY A;  5JME A;  5J5I A;  5KZU A;  3WTL A;  2BYQ A;  3U8M A;  2WNJ A;  2X00 A;  4XK9 A;  5FJV A;  2XQA A;  3UQ7 A;  5AFH A;  2XNT A;  2BJ0 A;  4ZJT A;  2WNL A;  4XHE A;  3C84 A;  3LSV A;  3RQU A;  5KE4 A;  5J5F A;  2BR8 A;  1UX2 A; 
#chains in the Genus database with same CATH homology
 2YMD A;  4HFC A;  4HFE A;  5HEO A;  4ZK4 A;  3UU6 A;  4ALX A;  4DBM A;  2XQ7 A;  4ILC A;  3EAM A;  3JAE A;  3WTJ A;  4D01 A;  3U8K A;  4BFQ A;  4ILA A;  2Y54 A;  2YOE A;  2ZJV A;  4UM3 A;  4B5D A;  3U8L A;  2BYP A;  3ZDG A;  3GUA A;  4LMK A;  4AFG A;  3WTO A;  4COF A;  4LMJ A;  2C9T A;  2XQ4 A;  2XNV A;  4QH4 A;  3P4W A;  5CO5 A;  5AFN A;  2Y7Y A;  4A97 A;  3EI0 A;  4EZ1 A;  4TNW A;  3RI5 A;  3TLS A;  4HFB A;  2BG9 C;  4WV9 A;  5AIN A;  3TLV A;  4PIR A;  4ZZB A;  4QAB A;  5HEJ A;  5L4E A;  4F8H A;  5AFJ A;  5LG3 A;  2QC1 B;  5SYO A;  3WIP A;  3WTI A;  5IUX A;  4ZR6 A;  3T4M A;  2XQ3 A;  2WNC A;  4IL9 A;  4IRE A;  4TWD A;  2BR7 A;  2VL0 A;  2WN9 A;  3RIF A;  4UM1 A;  3TLU A;  3P50 A;  2PGZ A;  2XYT A;  4UM3 S;  2Y57 A;  5L4H A;  4AFT A;  4QH1 A;  2W8F A;  2BYR A;  4HQP A;  5AFM A;  5J5G A;  3ZKR A;  3WTK A;  5HCM A;  2YKS A;  2BG9 A;  4TWH A;  2YN6 A;  3RIA A;  4AFH A;  3U8J A;  2Y56 A;  5BP0 A;  3UU4 A;  1I9B A;  2PH9 A;  5J5H A;  3PMZ A;  5HCJ A;  4ILB A;  3SIO A;  2UZ6 A;  2YME A;  4X5T A;  3UQ4 A;  5CFB A;  5HEG A;  3SQ6 A;  4UXU A;  3RQW A;  3SQ9 A;  3UU5 A;  3UU3 A;  3SH1 A;  5AFL A;  5AFK A;  3ZDH A;  2ZJU A;  4NZB A;  5AFM B;  4TWF A;  1UV6 A;  4FRR A;  4A98 A;  3JAF A;  3PEO A;  3WTH A;  2XNU A;  1UW6 A;  4QH5 A;  4ZJS A;  2BG9 B;  3C79 A;  4NPP A;  4ZRU A;  2BYS A;  4HFD A;  4ZK1 A;  2XZ5 A;  2W8G A;  2BG9 E;  4QAA A;  4Z91 A;  3RHW A;  2BYN A;  4TNV A;  3WTN A;  5L47 A;  2XZ6 A;  4UY2 A;  2XQ5 A;  4IL4 A;  3TLW A;  2XYS A;  4UM3 P;  3WTM A;  2XQ6 A;  3IGQ A;  4QAC A;  5HEU A;  4LML A;  4HFH A;  5BW2 A;  3U8N A;  3JAD A;  4ZZC A;  5BRX A;  2XQ8 A;  3EHZ A;  4Z90 A;  2X00 D;  5LXB A;  5J0Z A;  2XQ9 A;  3TLT A;  3UUB A;  5HEH A;  4BQT A;  2Y58 A;  5TVC A;  3UU8 A;  4HFI A;  2WZY A;  5JME A;  5J5I A;  5KZU A;  3WTL A;  2BYQ A;  3U8M A;  2WNJ A;  2X00 A;  4XK9 A;  5FJV A;  2XQA A;  3UQ7 A;  5AFH A;  2XNT A;  2BJ0 A;  4ZJT A;  2WNL A;  4XHE A;  3C84 A;  3LSV A;  3RQU A;  5KE4 A;  5J5F A;  2BR8 A;  1UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...