3PMZA

Crystal structure of the complex of acetylcholine binding protein and d-tubocurarine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title The Curare Alkaloids: Analyzing the Poses of Complexes with the Acetylcholine Binding Protein in Relation to Structure and Binding Energies
rcsb
source organism Aplysia californica
molecule tags Choline-binding protein
total genus 53
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3pmzA00
4FRRA 2XYSA 2X00D 3UU5A 5FJVA 5SYOA 5J5HA 3C79A 4ZJTA 3ZKRA 3U8NA 2W8GA 2YKSA 2BJ0A 3SIOA 3IGQA 2XQ3A 5HCJA 4PIRA 2UZ6A 3WTKA 4AFTA 5AFMB 4ILCA 3WTMA 3JADA 5HEOA 3RIAA 2XQ7A 4BFQA 4HQPA 3TLWA 5AFKA 4IL9A 2WN9A 5AFLA 2XYTA 2W8FA 3U8MA 4TNWA 2ZJVA 3ZDGA 4UM3A 5TVCA 5L4EA 3UU3A 2BG9B 4F8HA 5HEGA 4IL4A 2YMDA 5L47A 3GUAA 5JMEA 3RI5A 4DBMA 3WTHA 4XHEA 2BYPA 4ALXA 5BP0A 3RQUA 4QACA 4Z91A 5AINA 4LMLA 3ZDHA 4UM3S 4BQTA 2WNJA 2Y7YA 4QAAA 5HCMA 3TLTA 4HFIA 5HEJA 3JAFA 2WNLA 4LMJA 2YMEA 3RIFA 3U8LA 4WV9A 5HEUA 3UU8A 2BR7A 4HFBA 5BW2A 2BG9C 2XNTA 4ZR6A 3WIPA 2ZJUA 4UY2A 2XQ5A 4ILBA 3TLVA 2WNCA 4UM1A 1UV6A 3TLSA 4ZZBA 4HFEA 2XNVA 4QH1A 2X00A 3WTLA 3T4MA 4ZK1A 4UXUA 2Y54A 2Y58A 4A97A 3U8KA 3UQ4A 4ZZCA 2VL0A 5J5FA 4TWDA 5L4HA 4A98A 1UX2A 4TWHA 2QC1B 3EI0A 2BYRA 4ZK4A 3EAMA 3RHWA 5J0ZA 5AFJA 3UQ7A 3P50A 2XQ4A 3TLUA 4AFHA 4ZJSA 4QH5A 3PMZA 5HEHA 4TNVA 3WTOA 3WTNA 2BYNA 4QH4A 4TWFA 5KE4A 2XQAA 3SH1A 2PGZA 2YOEA 4AFGA 2WZYA 2BYQA 4X5TA 4ILAA 3LSVA 5AFNA 5CFBA 5IUXA 2Y57A 2XZ6A 3PEOA 5CO5A 5AFHA 5LXBA 1UW6A 4D01A 2XZ5A 4NPPA 4LMKA 3UU4A 2C9TA 2XQ6A 2BR8A 3SQ9A 3WTIA 2XNUA 2BYSA 3UU6A 4B5DA 5AFMA 5J5IA 2YN6A 4HFCA 3U8JA 4Z90A 3EHZA 4HFHA 2PH9A 3C84A 5J5GA 5BRXA 3WTJA 2Y56A 3UUBA 2BG9E 2BG9A 5LG3A 4QABA 4EZ1A 2XQ9A 1I9BA 4HFDA 4ZRUA 2XQ8A 3RQWA 3JAEA 4XK9A 4IREA 3SQ6A 3P4WA 4UM3P 4COFA 4NZBA 5KZUA
chains in the Genus database with same CATH superfamily
4FRRA 2XYSA 2X00D 3UU5A 5FJVA 5SYOA 5J5HA 3C79A 4ZJTA 3ZKRA 3U8NA 2W8GA 2YKSA 2BJ0A 3SIOA 3IGQA 2XQ3A 5HCJA 4PIRA 2UZ6A 3WTKA 4AFTA 5AFMB 4ILCA 3WTMA 3JADA 5HEOA 3RIAA 2XQ7A 4BFQA 4HQPA 3TLWA 5AFKA 4IL9A 2WN9A 5AFLA 2XYTA 2W8FA 3U8MA 4TNWA 2ZJVA 3ZDGA 4UM3A 5TVCA 5L4EA 3UU3A 2BG9B 4F8HA 5HEGA 4IL4A 2YMDA 5L47A 3GUAA 5JMEA 3RI5A 4DBMA 3WTHA 4XHEA 2BYPA 4ALXA 5BP0A 3RQUA 4QACA 4Z91A 5AINA 4LMLA 3ZDHA 4UM3S 4BQTA 2WNJA 2Y7YA 4QAAA 5HCMA 3TLTA 4HFIA 5HEJA 3JAFA 2WNLA 4LMJA 2YMEA 3RIFA 3U8LA 4WV9A 5HEUA 3UU8A 2BR7A 4HFBA 5BW2A 2BG9C 2XNTA 4ZR6A 3WIPA 2ZJUA 4UY2A 2XQ5A 4ILBA 3TLVA 2WNCA 4UM1A 1UV6A 3TLSA 4ZZBA 4HFEA 2XNVA 4QH1A 2X00A 3WTLA 3T4MA 4ZK1A 4UXUA 2Y54A 2Y58A 4A97A 3U8KA 3UQ4A 4ZZCA 2VL0A 5J5FA 4TWDA 5L4HA 4A98A 1UX2A 4TWHA 2QC1B 3EI0A 2BYRA 4ZK4A 3EAMA 3RHWA 5J0ZA 5AFJA 3UQ7A 3P50A 2XQ4A 3TLUA 4AFHA 4ZJSA 4QH5A 3PMZA 5HEHA 4TNVA 3WTOA 3WTNA 2BYNA 4QH4A 4TWFA 5KE4A 2XQAA 3SH1A 2PGZA 2YOEA 4AFGA 2WZYA 2BYQA 4X5TA 4ILAA 3LSVA 5AFNA 5CFBA 5IUXA 2Y57A 2XZ6A 3PEOA 5CO5A 5AFHA 5LXBA 1UW6A 4D01A 2XZ5A 4NPPA 4LMKA 3UU4A 2C9TA 2XQ6A 2BR8A 3SQ9A 3WTIA 2XNUA 2BYSA 3UU6A 4B5DA 5AFMA 5J5IA 2YN6A 4HFCA 3U8JA 4Z90A 3EHZA 4HFHA 2PH9A 3C84A 5J5GA 5BRXA 3WTJA 2Y56A 3UUBA 2BG9E 2BG9A 5LG3A 4QABA 4EZ1A 2XQ9A 1I9BA 4HFDA 4ZRUA 2XQ8A 3RQWA 3JAEA 4XK9A 4IREA 3SQ6A 3P4WA 4UM3P 4COFA 4NZBA 5KZUA
chains in the Genus database with same CATH topology
4FRRA 2XYSA 2X00D 3UU5A 5FJVA 5SYOA 5J5HA 3C79A 4ZJTA 3ZKRA 3U8NA 2W8GA 2YKSA 2BJ0A 3SIOA 3IGQA 2XQ3A 5HCJA 4PIRA 2UZ6A 3WTKA 4AFTA 5AFMB 4ILCA 3WTMA 3JADA 5HEOA 3RIAA 2XQ7A 4BFQA 4HQPA 3TLWA 5AFKA 4IL9A 2WN9A 5AFLA 2XYTA 2W8FA 3U8MA 4TNWA 2ZJVA 3ZDGA 4UM3A 5TVCA 5L4EA 3UU3A 2BG9B 4F8HA 5HEGA 4IL4A 2YMDA 5L47A 3GUAA 5JMEA 3RI5A 4DBMA 3WTHA 4XHEA 2BYPA 4ALXA 5BP0A 3RQUA 4QACA 4Z91A 5AINA 4LMLA 3ZDHA 4UM3S 4BQTA 2WNJA 2Y7YA 4QAAA 5HCMA 3TLTA 4HFIA 5HEJA 3JAFA 2WNLA 4LMJA 2YMEA 3RIFA 3U8LA 4WV9A 5HEUA 3UU8A 2BR7A 4HFBA 5BW2A 2BG9C 2XNTA 4ZR6A 3WIPA 2ZJUA 4UY2A 2XQ5A 4ILBA 3TLVA 2WNCA 4UM1A 1UV6A 3TLSA 4ZZBA 4HFEA 2XNVA 4QH1A 2X00A 3WTLA 3T4MA 4ZK1A 4UXUA 2Y54A 2Y58A 4A97A 3U8KA 3UQ4A 4ZZCA 2VL0A 5J5FA 4TWDA 5L4HA 4A98A 1UX2A 4TWHA 2QC1B 3EI0A 2BYRA 4ZK4A 3EAMA 3RHWA 5J0ZA 5AFJA 3UQ7A 3P50A 2XQ4A 3TLUA 4AFHA 4ZJSA 4QH5A 3PMZA 5HEHA 4TNVA 3WTOA 3WTNA 2BYNA 4QH4A 4TWFA 5KE4A 2XQAA 3SH1A 2PGZA 2YOEA 4AFGA 2WZYA 2BYQA 4X5TA 4ILAA 3LSVA 5AFNA 5CFBA 5IUXA 2Y57A 2XZ6A 3PEOA 5CO5A 5AFHA 5LXBA 1UW6A 4D01A 2XZ5A 4NPPA 4LMKA 3UU4A 2C9TA 2XQ6A 2BR8A 3SQ9A 3WTIA 2XNUA 2BYSA 3UU6A 4B5DA 5AFMA 5J5IA 2YN6A 4HFCA 3U8JA 4Z90A 3EHZA 4HFHA 2PH9A 3C84A 5J5GA 5BRXA 3WTJA 2Y56A 3UUBA 2BG9E 2BG9A 5LG3A 4QABA 4EZ1A 2XQ9A 1I9BA 4HFDA 4ZRUA 2XQ8A 3RQWA 3JAEA 4XK9A 4IREA 3SQ6A 3P4WA 4UM3P 4COFA 4NZBA 5KZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRR A;  2XYS A;  2X00 D;  3UU5 A;  5FJV A;  5SYO A;  5J5H A;  3C79 A;  4ZJT A;  3ZKR A;  3U8N A;  2W8G A;  2YKS A;  2BJ0 A;  3SIO A;  3IGQ A;  2XQ3 A;  5HCJ A;  4PIR A;  2UZ6 A;  3WTK A;  4AFT A;  5AFM B;  4ILC A;  3WTM A;  3JAD A;  5HEO A;  3RIA A;  2XQ7 A;  4BFQ A;  4HQP A;  3TLW A;  5AFK A;  4IL9 A;  2WN9 A;  5AFL A;  2XYT A;  2W8F A;  3U8M A;  4TNW A;  2ZJV A;  3ZDG A;  4UM3 A;  5TVC A;  5L4E A;  3UU3 A;  2BG9 B;  4F8H A;  5HEG A;  4IL4 A;  2YMD A;  5L47 A;  3GUA A;  5JME A;  3RI5 A;  4DBM A;  3WTH A;  4XHE A;  2BYP A;  4ALX A;  5BP0 A;  3RQU A;  4QAC A;  4Z91 A;  5AIN A;  4LML A;  3ZDH A;  4UM3 S;  4BQT A;  2WNJ A;  2Y7Y A;  4QAA A;  5HCM A;  3TLT A;  4HFI A;  5HEJ A;  3JAF A;  2WNL A;  4LMJ A;  2YME A;  3RIF A;  3U8L A;  4WV9 A;  5HEU A;  3UU8 A;  2BR7 A;  4HFB A;  5BW2 A;  2BG9 C;  2XNT A;  4ZR6 A;  3WIP A;  2ZJU A;  4UY2 A;  2XQ5 A;  4ILB A;  3TLV A;  2WNC A;  4UM1 A;  1UV6 A;  3TLS A;  4ZZB A;  4HFE A;  2XNV A;  4QH1 A;  2X00 A;  3WTL A;  3T4M A;  4ZK1 A;  4UXU A;  2Y54 A;  2Y58 A;  4A97 A;  3U8K A;  3UQ4 A;  4ZZC A;  2VL0 A;  5J5F A;  4TWD A;  5L4H A;  4A98 A;  1UX2 A;  4TWH A;  2QC1 B;  3EI0 A;  2BYR A;  4ZK4 A;  3EAM A;  3RHW A;  5J0Z A;  5AFJ A;  3UQ7 A;  3P50 A;  2XQ4 A;  3TLU A;  4AFH A;  4ZJS A;  4QH5 A;  3PMZ A;  5HEH A;  4TNV A;  3WTO A;  3WTN A;  2BYN A;  4QH4 A;  4TWF A;  5KE4 A;  2XQA A;  3SH1 A;  2PGZ A;  2YOE A;  4AFG A;  2WZY A;  2BYQ A;  4X5T A;  4ILA A;  3LSV A;  5AFN A;  5CFB A;  5IUX A;  2Y57 A;  2XZ6 A;  3PEO A;  5CO5 A;  5AFH A;  5LXB A;  1UW6 A;  4D01 A;  2XZ5 A;  4NPP A;  4LMK A;  3UU4 A;  2C9T A;  2XQ6 A;  2BR8 A;  3SQ9 A;  3WTI A;  2XNU A;  2BYS A;  3UU6 A;  4B5D A;  5AFM A;  5J5I A;  2YN6 A;  4HFC A;  3U8J A;  4Z90 A;  3EHZ A;  4HFH A;  2PH9 A;  3C84 A;  5J5G A;  5BRX A;  3WTJ A;  2Y56 A;  3UUB A;  2BG9 E;  2BG9 A;  5LG3 A;  4QAB A;  4EZ1 A;  2XQ9 A;  1I9B A;  4HFD A;  4ZRU A;  2XQ8 A;  3RQW A;  3JAE A;  4XK9 A;  4IRE A;  3SQ6 A;  3P4W A;  4UM3 P;  4COF A;  4NZB A;  5KZU A; 
#chains in the Genus database with same CATH topology
 4FRR A;  2XYS A;  2X00 D;  3UU5 A;  5FJV A;  5SYO A;  5J5H A;  3C79 A;  4ZJT A;  3ZKR A;  3U8N A;  2W8G A;  2YKS A;  2BJ0 A;  3SIO A;  3IGQ A;  2XQ3 A;  5HCJ A;  4PIR A;  2UZ6 A;  3WTK A;  4AFT A;  5AFM B;  4ILC A;  3WTM A;  3JAD A;  5HEO A;  3RIA A;  2XQ7 A;  4BFQ A;  4HQP A;  3TLW A;  5AFK A;  4IL9 A;  2WN9 A;  5AFL A;  2XYT A;  2W8F A;  3U8M A;  4TNW A;  2ZJV A;  3ZDG A;  4UM3 A;  5TVC A;  5L4E A;  3UU3 A;  2BG9 B;  4F8H A;  5HEG A;  4IL4 A;  2YMD A;  5L47 A;  3GUA A;  5JME A;  3RI5 A;  4DBM A;  3WTH A;  4XHE A;  2BYP A;  4ALX A;  5BP0 A;  3RQU A;  4QAC A;  4Z91 A;  5AIN A;  4LML A;  3ZDH A;  4UM3 S;  4BQT A;  2WNJ A;  2Y7Y A;  4QAA A;  5HCM A;  3TLT A;  4HFI A;  5HEJ A;  3JAF A;  2WNL A;  4LMJ A;  2YME A;  3RIF A;  3U8L A;  4WV9 A;  5HEU A;  3UU8 A;  2BR7 A;  4HFB A;  5BW2 A;  2BG9 C;  2XNT A;  4ZR6 A;  3WIP A;  2ZJU A;  4UY2 A;  2XQ5 A;  4ILB A;  3TLV A;  2WNC A;  4UM1 A;  1UV6 A;  3TLS A;  4ZZB A;  4HFE A;  2XNV A;  4QH1 A;  2X00 A;  3WTL A;  3T4M A;  4ZK1 A;  4UXU A;  2Y54 A;  2Y58 A;  4A97 A;  3U8K A;  3UQ4 A;  4ZZC A;  2VL0 A;  5J5F A;  4TWD A;  5L4H A;  4A98 A;  1UX2 A;  4TWH A;  2QC1 B;  3EI0 A;  2BYR A;  4ZK4 A;  3EAM A;  3RHW A;  5J0Z A;  5AFJ A;  3UQ7 A;  3P50 A;  2XQ4 A;  3TLU A;  4AFH A;  4ZJS A;  4QH5 A;  3PMZ A;  5HEH A;  4TNV A;  3WTO A;  3WTN A;  2BYN A;  4QH4 A;  4TWF A;  5KE4 A;  2XQA A;  3SH1 A;  2PGZ A;  2YOE A;  4AFG A;  2WZY A;  2BYQ A;  4X5T A;  4ILA A;  3LSV A;  5AFN A;  5CFB A;  5IUX A;  2Y57 A;  2XZ6 A;  3PEO A;  5CO5 A;  5AFH A;  5LXB A;  1UW6 A;  4D01 A;  2XZ5 A;  4NPP A;  4LMK A;  3UU4 A;  2C9T A;  2XQ6 A;  2BR8 A;  3SQ9 A;  3WTI A;  2XNU A;  2BYS A;  3UU6 A;  4B5D A;  5AFM A;  5J5I A;  2YN6 A;  4HFC A;  3U8J A;  4Z90 A;  3EHZ A;  4HFH A;  2PH9 A;  3C84 A;  5J5G A;  5BRX A;  3WTJ A;  2Y56 A;  3UUB A;  2BG9 E;  2BG9 A;  5LG3 A;  4QAB A;  4EZ1 A;  2XQ9 A;  1I9B A;  4HFD A;  4ZRU A;  2XQ8 A;  3RQW A;  3JAE A;  4XK9 A;  4IRE A;  3SQ6 A;  3P4W A;  4UM3 P;  4COF A;  4NZB A;  5KZU A; 
#chains in the Genus database with same CATH homology
 4FRR A;  2XYS A;  2X00 D;  3UU5 A;  5FJV A;  5SYO A;  5J5H A;  3C79 A;  4ZJT A;  3ZKR A;  3U8N A;  2W8G A;  2YKS A;  2BJ0 A;  3SIO A;  3IGQ A;  2XQ3 A;  5HCJ A;  4PIR A;  2UZ6 A;  3WTK A;  4AFT A;  5AFM B;  4ILC A;  3WTM A;  3JAD A;  5HEO A;  3RIA A;  2XQ7 A;  4BFQ A;  4HQP A;  3TLW A;  5AFK A;  4IL9 A;  2WN9 A;  5AFL A;  2XYT A;  2W8F A;  3U8M A;  4TNW A;  2ZJV A;  3ZDG A;  4UM3 A;  5TVC A;  5L4E A;  3UU3 A;  2BG9 B;  4F8H A;  5HEG A;  4IL4 A;  2YMD A;  5L47 A;  3GUA A;  5JME A;  3RI5 A;  4DBM A;  3WTH A;  4XHE A;  2BYP A;  4ALX A;  5BP0 A;  3RQU A;  4QAC A;  4Z91 A;  5AIN A;  4LML A;  3ZDH A;  4UM3 S;  4BQT A;  2WNJ A;  2Y7Y A;  4QAA A;  5HCM A;  3TLT A;  4HFI A;  5HEJ A;  3JAF A;  2WNL A;  4LMJ A;  2YME A;  3RIF A;  3U8L A;  4WV9 A;  5HEU A;  3UU8 A;  2BR7 A;  4HFB A;  5BW2 A;  2BG9 C;  2XNT A;  4ZR6 A;  3WIP A;  2ZJU A;  4UY2 A;  2XQ5 A;  4ILB A;  3TLV A;  2WNC A;  4UM1 A;  1UV6 A;  3TLS A;  4ZZB A;  4HFE A;  2XNV A;  4QH1 A;  2X00 A;  3WTL A;  3T4M A;  4ZK1 A;  4UXU A;  2Y54 A;  2Y58 A;  4A97 A;  3U8K A;  3UQ4 A;  4ZZC A;  2VL0 A;  5J5F A;  4TWD A;  5L4H A;  4A98 A;  1UX2 A;  4TWH A;  2QC1 B;  3EI0 A;  2BYR A;  4ZK4 A;  3EAM A;  3RHW A;  5J0Z A;  5AFJ A;  3UQ7 A;  3P50 A;  2XQ4 A;  3TLU A;  4AFH A;  4ZJS A;  4QH5 A;  3PMZ A;  5HEH A;  4TNV A;  3WTO A;  3WTN A;  2BYN A;  4QH4 A;  4TWF A;  5KE4 A;  2XQA A;  3SH1 A;  2PGZ A;  2YOE A;  4AFG A;  2WZY A;  2BYQ A;  4X5T A;  4ILA A;  3LSV A;  5AFN A;  5CFB A;  5IUX A;  2Y57 A;  2XZ6 A;  3PEO A;  5CO5 A;  5AFH A;  5LXB A;  1UW6 A;  4D01 A;  2XZ5 A;  4NPP A;  4LMK A;  3UU4 A;  2C9T A;  2XQ6 A;  2BR8 A;  3SQ9 A;  3WTI A;  2XNU A;  2BYS A;  3UU6 A;  4B5D A;  5AFM A;  5J5I A;  2YN6 A;  4HFC A;  3U8J A;  4Z90 A;  3EHZ A;  4HFH A;  2PH9 A;  3C84 A;  5J5G A;  5BRX A;  3WTJ A;  2Y56 A;  3UUB A;  2BG9 E;  2BG9 A;  5LG3 A;  4QAB A;  4EZ1 A;  2XQ9 A;  1I9B A;  4HFD A;  4ZRU A;  2XQ8 A;  3RQW A;  3JAE A;  4XK9 A;  4IRE A;  3SQ6 A;  3P4W A;  4UM3 P;  4COF A;  4NZB A;  5KZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...