4ZZCA

The glic pentameric ligand-gated ion channel open form complexed to xenon
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural Basis for Xenon Inhibition in a Cationic Pentameric Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4zzcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zzcA01
2BG9A 5L47A 3C79A 4UXUA 3TLUA 2BR8A 2ZJUA 3UU3A 5AFLA 2LM2A 3EAMA 1OEDB 5HEHA 4Z91A 4PIRA 2PH9A 2W8FA 2Y58A 3RI5A 4LMJA 4QH4A 2BYRA 3GUAA 3ZKRA 3WTIA 4TNVA 4WV9A 3U8KA 4ZRUA 5HEOA 4EZ1A 4UM3P 4QH1A 2XQ9A 2XNTA 4ILAA 3WIPA 4UM1A 2YOEA 3JAFA 3JAEA 4QABA 3SIOA 3UU8A 3T4MA 1OEDC 2MAWA 4TWFA 3C84A 3WTOA 2M6IA 4LMLA 3UUBA 2Y54A 4UY2A 4D01A 4ZK4A 4HFEA 2BYPA 3SQ9A 4ZJSA 3ZDGA 4UM3S 3RQWA 5J0ZA 2XNVA 5AFKA 5KE4A 2XNUA 5KZUA 3WTKA 2BG9B 2KSRA 2XYSA 4HQPA 3UQ4A 5BP0A 5L4EA 2LKGA 2ZJVA 2BYSA 3UU4A 2BYNA 2YKSA 3ZDHA 4A98A 3RIAA 4X5TA 5IUXA 5SYOA 5BRXA 2WZYA 4F8HA 3U8NA 5L4HA 2QC1B 2C9TA 4TNWA 4AFTA 5AFMB 2M6BA 4IL4A 5HEUA 5LG3A 2W8GA 2XQ6A 3EI0A 1UX2A 5HCMA 5HCJA 5HEJA 2XZ6A 2BJ0A 1OEDE 3WTJA 3WTHA 3P4WA 2WN9A 4B5DA 1I9BA 1OEDA 2YMEA 4Z90A 3RQUA 5AINA 2Y56A 3UU5A 3PMZA 4BQTA 5AFHA 4NPPA 2WNCA 4QAAA 5AFJA 2X00D 2WNJA 3TLVA 3UQ7A 3U8JA 3WTLA 4NZBA 4HFBA 2XQ5A 4FRRA 2LKHA 4QACA 4A97A 4HFCA 4AFHA 5HEGA 3TLWA 2WNLA 3SH1A 4IREA 4ILCA 5LXBA 2BYQA 4UM3A 5CFBA 4ZZCA 2BG9E 4ZJTA 4HFDA 3IGQA 4BFQA 2BG9C 2XQ8A 2XQ4A 2Y7YA 2BR7A 3U8MA 4ZR6A 2PGZA 5FJVA 5JMEA 2XQAA 4TWDA 4IL9A 1UV6A 3TLSA 5J5GA 2YN6A 4ZK1A 2UZ6A 3UU6A 3LSVA 4HFHA 2XQ7A 5J5IA 5J5HA 4ZZBA 4TWHA 4QH5A 4ILBA 2X00A 4XK9A 4AFGA 5AFMA 5J5FA 3RIFA 4LMKA 2XZ5A 4XHEA 5TVCA 2YMDA 3WTNA 2Y57A 4ALXA 3JADA 3TLTA 2LLYA 3PEOA 3WTMA 1UW6A 5AFNA 2XYTA 4HFIA 3SQ6A 3U8LA 4DBMA 4COFA 2XQ3A 3P50A 5CO5A 3RHWA 5BW2A 3EHZA 2VL0A
chains in the Genus database with same CATH superfamily
1HX8A 3O1JA 5L47A 1FIOA 5GONE 2VK9A 4IE6A 5JH7E 4E7ZA 2UXNB 2W8FA 2KWIB 4L5GA 3UTKA 1WYCA 5ABFA 4DR1T 2V5CA 3V5SA 4G2AA 4IE5A 4EEBA 4YJ3E 2CBJA 3T4MA 2LE8A 3C84A 4LMLA 2P9BA 2D9DA 2DWGA 1WFDA 4UEMA 3VRAA 5LMNT 4UM3S 5AFKA 1YKHB 2LEHA 2KNDA 3ETVA 3PUYF 2ACXA 3WAJA 5FMNA 3CX6B 3NRXA 1UX2A 1VCTA 5FL1A 1N33T 1Y64B 3ZN1B 3OPCA 4EEDA 5CGMA 1QSDA 4GKJT 3TLVA 3AAEB 2V6YA 5AQTB 5HXCA 1S94A 5AQUB 2IW5B 4ILCA 1WR6A 3EDUA 3SFDA 4UM3A 3P4QA 3RC3A 4F6RC 3BK9A 3AE3A 2AXDS 4U3CA 3N9OA 3LK2B 3H37A 3L8RA 3WTNA 5IHYA 2LLYA 1WRDA 3MACA 4A5XA 3EVYA 1BR4A 4PNIA 3N2OA 3CMLA 2HH7A 1D0YA 5C3JA 4TNVA 4KX6A 2F4VT 1UX5A 3FZKB 4XAXB 4GKKT 3AEFA 1YQ4A 3KBTA 3JAEA 3ZCIA 4Q25A 3ZMTB 4B6XA 2KWHA 3PUVF 2WCAA 2DHRA 3SQ9A 2XAQB 4KUMB 3LBXB 2XYSA 5LOVE 4ZI7E 2IMLA 2WP9A 2RA1A 3ZC1A 4QXHB 2X0HA 5LYJE 3MKDA 1M62A 1OEDE 2X67A 2VQFT 1LVFA 3EUHA 4NPPA 5AFJA 5FXWA 5L3DB 3KV9A 1T72A 2A3DA 2UUCT 1D1CA 1N36T 3K8PC 1MMDA 4QWNB 4ZJTA 3CX8B 3JC6D 3ESLA 2ZM2A 1SHZC 4L0RA 3T1HT 4TWDA 4IDZA 5AQRB 3SWHA 2XQ7A 3K3NA 4AFGA 2OA5A 3F57A 2MOZA 3AE9A 2JRKA 2I59A 2X0YA 2LSIA 1U5PA 4LFAT 4IE0A 4PAGA 2ZMAA 2R6GF 5EZYE 1NAFA 1N32T 5FL0A 2CXLA 1E1HB 4EZ1A 3N2GE 2C5JA 2JQHA 3JAFA 3AE6A 4C90A 2X9HA 5FYMA 3OKQA 5JDQA 3UUMA 3ZEFB 3MZKB 2EHOD 4ILUA 2XNVA 2W67A 3BQLA 4NUVA 3ZMZB 2M67A 3UQ4A 1FJGT 3I9YA 5IUXA 3KVAA 2Q9QB 5CA1E 2LSJA 1D0XA 3FBLA 4TV8E 2W61A 4P09A 4TNWA 2K9AA 2W8GA 4X1KE 4UXNB 2JQ9A 4AIUA 2WWUA 4AKRB 5AFHA 3HKEE 3RYCE 2E8IA 2ACZA 2OLTA 4DR4T 1KNPA 4WZXA 1YW0A 2V5DA 2VVNA 3UT5E 2NW8A 1ZV4X 3EDVA 3NWIA 4U72A 2X0LB 1UV6A 4YY3T 5CB4E 5KX5E 4ZI3D 2BVMA 4DR6T 3ONLC 4IT4A 2XYTA 4OX9T 3U78A 2XSAA 4TV9E 3P50A 3DJBA 4CN4A 5BW2A 3EHZA 3C79A 5HYAA 2L9QA 1XDPA 5FVKA 4AQYT 5LHGB 2X9XA 3RI5A 2BYRA 3KVBA 2VURA 2N2NA 1T7SA 4EYUA 3N9NA 4EZHA 2BS2A 2NTXA 2WM9A 1HG2A 5JR9B 5ABHA 2LHNA 4ZK4A 2RP4A 1MIYA 5KZUA 3QUJA 3HL6A 4AKLA 1QLBA 4O2BE 1AJ3A 1Z8UA 1D0ZA 3QC9A 4JLEA 5J2UE 5LG3A 2CLYC 5HEJA 4QKNA 2UUAT 2XZ6A 2BJ0A 3AXJB 2VVSA 4DV1T 3PMZA 4WBNE 3P8CD 4J2CA 2WNCA 3O4XE 2WNJA 5L2LA 5AQPB 2C5IT 4PJMA 2DWKA 4TZ4C 3IGQA 2QA7A 1MMGA 2C0SA 5E0OA 4BFQA 2CXFA 2FJBA 2BR7A 1UK5A 3P4PA 2D0UA 2LJLA 3QB5A 3SS1A 4NIQA 3F31A 4IDOA 4ZK1A 4PK4A 3AECA 2UXDT 2ZM0A 1W0BA 2DLRA 1Z0PA 1EZ3A 2BKNA 3D0TA 5JR9A 2Y6XA 2LHRA 5KXJA 2WSSV 1LRZA 2XAFB 4QXBB 4WBOA 2LSYA 1SA0E 5JTGA 4XBFB 3FBZA 5C8YE 2XM2A 2YDRA 5FVLA 3PV0F 3GUAA 4UELA 3HI2A 4ZRUA 4GIWA 3AXJA 2MYSA 3HKCE 2WQYA 4ISTA 3A5XA 3QOFA 3UUBA 4PFOA 4MHCA 4U74A 2KSRA 4AKHA 1YKEB 2ZJVA 2MBGA 4A98A 4DR5T 5BRXA 2QRXA 3U8NA 3KBUA 2VASA 2E9XD 3VRBA 3EI0A 3X1DA 5ADXL 3P4WA 2IHR1 4UF0B 1I9BA 2ES0A 2IUBA 4NXNT 4GYRA 3UQ7A 3WTLA 2H88A 3MXZA 3PUAA 3P4RA 1J1JA 2JJ9A 3U8MA 4ZR6A 5FY1A 4TX5A 3OJAA 3S4UA 2C5KT 2XQAA 3ZSSA 2XAHB 1NENA 3I0QA 2W2UA 2VKJA 2J1DG 5TVCA 2BZBA 1IBKT 1UGOA 3FZLB 4MFRA 3E22E 2W4XA 5J1GA 5AQKB 2J62A 4UVAB 3KV5A 4HWCA 4UVCB 3FZMB 2WZHA 1HTJF 4HEAA 2LM2A 3C4ZA 3OBVE 4EB6E 2CCQA 1ZKEA 5HWXA 3PU8A 3ZYLA 3ZT5A 2V6YB 3T1YT 3MA9A 3ZT7A 3ZYKA 2BKPA 4IDPA 4HFEA 3C64A 2VKDA 3I0OA 4OYJA 3RQWA 5J0ZA 1GQEA 4JI4T 4LF8T 3RIAA 4X5TA 5H6RB 3GN5A 5LGTB 3N9QA 3RIUA 1G8XA 4B3MT 2GK9A 5HCJA 3WTJA 3ABVA 4AKGA 1X9BA 4Z90A 3A8YC 4O4HE 3I1AA 3ANWB 2NW7A 5IWAT 1HG5A 2CHNA 5JR9C 5HXEA 3UULA 4KI0F 4IE7A 4DMWA 2IIUA 2KT9A 5JMEA 3Q5XA 3L09A 5A1LA 1G73A 1IZNB 2X00A 1W9RA 1QUUA 3OVUA 2XZ5A 2JIWA 2YMDA 2CRBA 2NP9A 4ADZA 4PK5A 3NZPA 2YDQA 3NKZA 4UM3P 2BS4A 4AKIA 2HHHT 2HPLA 5LA6E 3AE1A 3N9PA 3UU3A 5AQGB 5HEHA 4PIRA 3R6NA 4CN6A 4MALA 1KF6A 4X20E 2K48A 2PG8A 2DNXA 2XQ9A 2XNTA 1JNRA 1FEWA 2ODVA 4DIDB 4DV4T 4LF5T 2MAWA 4ZOLE 3IBPA 1OXZA 3OYXA 5KE4A 2CLYB 2PJQA 2L8KA 1VOMA 3ANWA 4YSXA 3ETUA 4U31A 3SFEA 4EIWA 3AA1B 4N78D 2PTFA 2YU1A 5HEUA 4CXYA 4LF9T 4I0UA 2VKHA 4YHHT 4MLKA 4BQTA 4FI5A 2X00D 3FXEB 4NZBA 4QACA 1BR1A 4OFZA 3TLWA 2QGSA 3SRZA 4TN7B 2BYQA 4KMCA 3CQGB 1VRBA 3VU7H 1HNZT 3PUWF 4KHZF 2EHOA 3VHLA 3O9XA 4ZZBA 3RF1A 5HWYA 2XY8B 3DP7A 4ANJA 1W0AA 4BJMA 4H9PC 1UW6A 3N9LA 3U8LA 5JRCA 4HE8A 1LVKA 5F8PA 2BR8A 4UV9B 2HPJA 5JDLA 3CWZB 2UXXB 4Z91A 2DCFA 2UUBT 3RIUC 4WV9A 5JDHA 2FJEA 2WU5A 4JUYA 5DABA 2N9DA 4HN9A 2H7VC 2CWOA 1XMOT 1WYBA 3NRYA 4LF4T 4D01A 1IBLT 1CHUA 3RRWA 3OYZA 2UXCT 2L3LA 4HWHA 3N5LA 2XNUA 4ZEYA 2KZ7B 3BQIA 4NUUA 2CA5A 3IHRA 5SYOA 3ZJ1A 4JI0T 2WZYA 4U7YA 3RYFE 2ZM6T 3GA8A 3AEGA 2FBWA 1V9DA 5JREA 2XQ6A 3CKDA 3K3OA 5HCMA 2V7IA 2LRLA 3WTHA 4ISSA 5AQIB 4Z8XA 2LRKA 4WYVA 2JMKA 4JI8T 4ZI2D 3RGLA 5AQFB 4FRRA 1HCIA 3GWHA 1ZEEA 5HEGA 3RYIE 2V7KA 5AQQB 3LFMA 1UX4A 2WDVA 1NEKA 1LKXA 3P4SA 4K0KT 2Y48B 2XHEB 5FY0A 5AFMA 3L3PA 3RIFA 4EXTA 5C2TA 4X1YE 1J5ET 2DL1A 4HFIA 4UIGA 4JI6T 3SQ6A 3JC6C 5LXBA 4YTPA 4UXUA 5AQSB 3W15B 5AFLA 2Y58A 1KK7A 2D5UA 1HNWT 4QH1A 3KV4A 5FNVE 2FJDA 4JEUB 2CEAA 2YOEA 3SOLA 4PJNA 2XAGB 3Q5WA 2E5LT 4ZS2A 5ABGA 5L3GB 4IE4A 3B13A 5F3JA 5L3CB 4DR3T 3ZDHA 2VB6A 2XZEA 4JBWF 5J2TE 2CWYA 1I94T 4EYYR 5FP3A 2EHOC 2ZM8A 1FMVA 1D1AA 2WAUA 2VWAA 3U8JA 4BAYB 2LKHA 3B57A 3FB2A 2J4GA 4AFHA 4IDQA 2I6HA 5LGNB 5LHHB 3RKGA 2V7LA 3AE5A 4OHFA 4PK6A 4YLHA 2XQ8A 2HN2A 4ERRA 4O4JE 5JDMA 2CM0A 3C50A 2K24A 3C51A 2IDOB 5LGUB 4ILBA 2XQYA 5KDMC 3JADA 3WAKA 3E08A 3N9MA 5AFNA 4JI1T 1T98A 2E9XA 3PUZF 3RHWA 4YTMA 2YU2A 3V5UA 3FZFB 4LF7T 3ZLIA 2PH9A 4ZI3C 5LG4A 1IBMT 3O1IA 5DQWA 5ETWA 4M1PA 3SIOA 1HX1B 4G63A 2Q9QD 2WDRA 3J9X1 3RX6A 2V1DB 1VCSA 3CX7B 2H89A 2LKGA 2WY2A 2YKSA 2BYNA 2G0UA 3AAAB 2B76A 4H63V 3U3IA 5JQGE 1ZP0A 1R8IA 4PJLA 4LFCT 4L9IA 4DV7T 4AQGA 1SUMB 4X65T 4JI2T 3RQUA 4LFBT 2D2SA 4EZ4A 1HR0T 3F2EA 3RRCA 3ZMSB 2H3RA 2JQQA 5HXSA 2CMRA 4HFVA 4XZCA 2XM1A 1XWMA 1KFYA 3EABA 1MMAA 4HTEA 4CI2B 2SPCA 3SH1A 1E7PA 2K5BB 5CFBA 2IAKA 3PUGA 5FJVA 4KP3C 4KHPT 2X66A 4IL9A 1D1BA 2K3WA 2UZ6A 3ZN0B 4HFHA 5J5IA 2PBIA 1YQ3A 5EK4A 5DQVA 5J5FA 4B3RT 5LNKA 3DTOA 4ALXA 4P0BA 3AE7A 4I4TE 3GN5B 4KBMB 4PW8A 3AVRA 1MNEA 3UFEA 3N2KE 4UV8B 4U2ZA 3ZPOA 1T8BA 1HFAA 2V7MA 2NW9A 4YHJA 3M65A 1IJ6A 2Z6EA 3HKBE 2XUEA 4PJJA 1B7TA 2Y54A 4UY2A 5LBQB 2VKOA 3WTKA 4HQPA 2BBJA 2BYSA 3GMIA 5TAOA 4JV5T 2E2AA 3RH3A 4U2YA 2W63A 4DV3T 4TUYE 4CZZB 2WMOA 2UXBT 4QHOA 4ZXLA 2A72A 2VL8A 1OEDA 4YXDA 5LMUT 3AE2A 2Y56A 4QX8B 4IHJE 3AEEA 4DUZT 3C4WA 2FUPA 4CN1A 4O8SA 4HGAA 5ABEA 4CI1B 2KXPB 3PUSA 5M4YA 5JVDE 3Q2MA 2E9XC 2W66A 5AQHB 3PUXF 2XQ4A 4DMVA 2Y7YA 2W62A 3TLSA 4CXWA 4X66T 4XHEA 5AQLB 2X9WA 3ZMVB 2CXDA 4I43B 2LT3A 3CPZA 4YJ2E 1IJ5A 1MNDA 4BJNA 4X64T 5EK3A 3ZKRA 4CI3B 2WMNA 3L39A 4MBQA 2RPAA 5L3FB 2KMFA 5IYZE 4TWFA 2M6IA 3HKDE 4ZJSA 4H9NC 3ZT6A 2V6XA 5LB7B 4UVBB 2CHOA 2B1EA 3LK3B 3UU4A 1O3XA 1IAPA 2EHOB 3MK7C 2BDEA 2QC1B 2X68A 3PU3A 3PE0A 4DBQA 2CE7A 2VQET 3RYHE 2X9YA 3VR9A 4AQFA 3AB3B 5JRCB 2XTLA 3JCFA 3AA0B 5LCYA 2AE9A 3C4XA 3CVRA 4O2AE 5FKYA 1HF8A 4HFBA 3ONXA 2A2FX 2NWBA 4YFSA 4IREA 1BR2A 4ZZCA 5DJQC 4PFPA 4P0AA 4DV6T 3H3MA 3UUNA 4YT0A 4DNDA 3QK6A 4XK9A 3HR0A 1HNXT 2QVAA 1H7CA 3ZMUB 2OV9A 1BR0A 3T8OA 3Q5DA 1HS7A 3IF8B 1WCRA 3UFGA 4ASKA 2WZIA 4K0UA 3NZQA 4WW0A 3TLUA 2CBIA 3IA3A 4H9QC 1ZHCA 3KDSE 3U8KA 5H6QB 1OEDC 2JMHA 3WTOA 1DU2A 5AQJB 1UUSA 3ZDGA 1E2AA 2WDQA 1KNRA 2WU2A 5BP0A 2CPTA 4F8HA 4E7SA 5BR8T 2PFVA 3OTOT 4AFTA 4OK0A 5AFMB 3CK6A 1OWAA 3AAIA 5CJ5A 3VKHA 4X62T 4H9RC 1X79A 3NVOA 2YMEA 2X51A 5L3BB 3PJAA 4JI5T 5JDFA 2MTQA 2UU9T 3Q9DA 3PJAJ 4A97A 2LM9A 4DVDA 3QNUA 3B5MA 4ZS3A 2LSGA 2PGZA 3LBXA 2XAJB 2QYWA 2V7JA 3FXDB 3P7IA 2YINA 2DI4A 1XDOA 3RPUA 3H3AA 4LMKA 4CQIA 2A9UA 2HN1A 4FJOA 3I9WA 3RKOA 2WBLA 4V1Av 3ZYMA 4DBMA 4COFA 1MMNA 2BVLA 2Y8DA 5L3EB 4GK5E 3ZC0A 3CIRA 4EV6A 2ZJUA 5LXTE 1MIWA 3ZCJA 1NWMX 3VR8A 4H9SE 5FXZA 5HEOA 2JPFA 1M7KA 1UCUA 4ILAA 1U4QA 4UM1A 3AA7B 3M3ZB 4AQFC 4P1NA 3KINB 5JDGA 3AE8A 4HWDA 2NR4A 2BG9B 2XSBA 4IDNA 5L4EA 4GK0E 4AXPA 1XMQT 5LBMA 2LOSA 2C9TA 1Y01A 2FJAA 2M6BA 2N1GA 4GYSA 2YDSA 4QXCB 4YTNA 2V26A 2LOPA 2V8SV 5HXRA 2WN9A 3PDYA 1UURA 2E9XB 5AINA 3UU5A 3J7Yq 4DV5T 4GOUA 2LSKA 3CQXC 4YSYA 4AISA 4DO0A 1WLXA 4ZHQE 1N34T 4HFCA 2WB5A 1XNRT 3K1SA 2WNLA 5LJNA 4O4LE 2W00A 1W09A 3G06A 5J5GA 2XPKA 2Q9QA 3UU6A 3LSVA 4CXXA 4ZI2C 4TWHA 2W0GA 2MPKA 3ZSTA 3TLTA 2E5VA 4IIJE 4B3TT 3PUQA 3E0ZA 5CO5A 2ZLYA 1YXRA 3AEAA 2BG9A 4B3ST 3RC8A 4DBRA 4EGWA 4LMJA 3WTIA 5FXVA 2KINB 4UR9A 3KFWX 3HA4A 2XJ7A 3AEBA 3WIPA 4U7IA 2IC6A 3UU8A 5AQOB 3FZHB 4NXMT 1KNZA 3BQKA 1I6ZA 5AQNB 3ONJA 2WS3A 1S35A 4EAHA 5AQMB 3AEDA 2H7OA 4IL4A 3TKLB 2YK0A 3FHNA 4I50E 3A7MA 4AI6A 3RLFF 5BMVE 1WR0A 4O4IE 5KMGP 2NOXA 4QX7B 4HWIB 2BBHA 5CA0E 4YSZA 1CUNA 4I55E 3IEEA 2XASB 2KLQA 5LP6E 4HFDA 3WI3A 3R84B 2BS3A 2YN6A 4OYKA 1FMWA 3QB5K 5LHIB 4LF6T 1JNZA 4QH5A 4H9OC 1ZOYA 3MJXA 3C98B 3WTMA 3AE4A 4DV0T 3PEOA 2JQKA 2BKOA 2VL0A 4WNKA 4BA9A 4X1IE 3EAMA 1OEDB 2J47A 4DUYT 4QH4A 3PURA 1XNQT 5LJMA 4HWFA 4HKAA 4EOZB 4QABA 4H63H 3AVSA 5F5WA 5AQVB 2BYPA 2WWVA 3VKGA 5EK2A 3CQCB 1MIVA 4IGUA 1J5WA 3LJCA 3ZJ2A 1YD8G 5L4HA 3AA6B 5FXXA 4JI7T 3LDQB 3PTRB 3LG7A 5JDNA 5AFUL 5ABFB 1XZYA 1KEYA 4B5DA 2Q9QC 4U33A 4QAAA 3O1HA 4JEHB 1SE7A 2XQ5A 5FY7A 3LK42 1US7B 2BG9E 5HAXA 5HXHA 2BG9C 4DR7T 3NBXX 2ODUA 4C91A 3KV6A 4DV2T 2D0TA 5J5HA 3K3QC 2YEVC 4A56A 3UUXB 4JYAT 4JI3T 2Y57A 4DR2T 1L0VA 3Q5EA 2NTYA 2I0MA 4UF0A 2XQ3A 2IC9A
chains in the Genus database with same CATH topology
2BG9A 5L47A 3C79A 4UXUA 3TLUA 2BR8A 2ZJUA 3UU3A 5AFLA 2LM2A 3EAMA 1OEDB 5HEHA 4Z91A 4PIRA 2PH9A 2W8FA 2Y58A 3RI5A 4LMJA 4QH4A 2BYRA 3GUAA 3ZKRA 3WTIA 4TNVA 4WV9A 3U8KA 4ZRUA 5HEOA 4EZ1A 4UM3P 4QH1A 2XQ9A 2XNTA 4ILAA 3WIPA 4UM1A 2YOEA 3JAFA 3JAEA 4QABA 3SIOA 3UU8A 3T4MA 1OEDC 2MAWA 4TWFA 3C84A 3WTOA 2M6IA 4LMLA 3UUBA 2Y54A 4UY2A 4D01A 4ZK4A 4HFEA 2BYPA 3SQ9A 4ZJSA 3ZDGA 4UM3S 3RQWA 5J0ZA 2XNVA 5AFKA 5KE4A 2XNUA 5KZUA 3WTKA 2BG9B 2KSRA 2XYSA 4HQPA 3UQ4A 5BP0A 5L4EA 2LKGA 2ZJVA 2BYSA 3UU4A 2BYNA 2YKSA 3ZDHA 4A98A 3RIAA 4X5TA 5IUXA 5SYOA 5BRXA 2WZYA 4F8HA 3U8NA 5L4HA 2QC1B 2C9TA 4TNWA 4AFTA 5AFMB 2M6BA 4IL4A 5HEUA 5LG3A 2W8GA 2XQ6A 3EI0A 1UX2A 5HCMA 5HCJA 5HEJA 2XZ6A 2BJ0A 1OEDE 3WTJA 3WTHA 3P4WA 2WN9A 4B5DA 1I9BA 1OEDA 2YMEA 4Z90A 3RQUA 5AINA 2Y56A 3UU5A 3PMZA 4BQTA 5AFHA 4NPPA 2WNCA 4QAAA 5AFJA 2X00D 2WNJA 3TLVA 3UQ7A 3U8JA 3WTLA 4NZBA 4HFBA 2XQ5A 4FRRA 2LKHA 4QACA 4A97A 4HFCA 4AFHA 5HEGA 3TLWA 2WNLA 3SH1A 4IREA 4ILCA 5LXBA 2BYQA 4UM3A 5CFBA 4ZZCA 2BG9E 4ZJTA 4HFDA 3IGQA 4BFQA 2BG9C 2XQ8A 2XQ4A 2Y7YA 2BR7A 3U8MA 4ZR6A 2PGZA 5FJVA 5JMEA 2XQAA 4TWDA 4IL9A 1UV6A 3TLSA 5J5GA 2YN6A 4ZK1A 2UZ6A 3UU6A 3LSVA 4HFHA 2XQ7A 5J5IA 5J5HA 4ZZBA 4TWHA 4QH5A 4ILBA 2X00A 4XK9A 4AFGA 5AFMA 5J5FA 3RIFA 4LMKA 2XZ5A 4XHEA 5TVCA 2YMDA 3WTNA 2Y57A 4ALXA 3JADA 3TLTA 2LLYA 3PEOA 3WTMA 1UW6A 5AFNA 2XYTA 4HFIA 3SQ6A 3U8LA 4DBMA 4COFA 2XQ3A 3P50A 5CO5A 3RHWA 5BW2A 3EHZA 2VL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG9 A;  5L47 A;  3C79 A;  4UXU A;  3TLU A;  2BR8 A;  2ZJU A;  3UU3 A;  5AFL A;  2LM2 A;  3EAM A;  1OED B;  5HEH A;  4Z91 A;  4PIR A;  2PH9 A;  2W8F A;  2Y58 A;  3RI5 A;  4LMJ A;  4QH4 A;  2BYR A;  3GUA A;  3ZKR A;  3WTI A;  4TNV A;  4WV9 A;  3U8K A;  4ZRU A;  5HEO A;  4EZ1 A;  4UM3 P;  4QH1 A;  2XQ9 A;  2XNT A;  4ILA A;  3WIP A;  4UM1 A;  2YOE A;  3JAF A;  3JAE A;  4QAB A;  3SIO A;  3UU8 A;  3T4M A;  1OED C;  2MAW A;  4TWF A;  3C84 A;  3WTO A;  2M6I A;  4LML A;  3UUB A;  2Y54 A;  4UY2 A;  4D01 A;  4ZK4 A;  4HFE A;  2BYP A;  3SQ9 A;  4ZJS A;  3ZDG A;  4UM3 S;  3RQW A;  5J0Z A;  2XNV A;  5AFK A;  5KE4 A;  2XNU A;  5KZU A;  3WTK A;  2BG9 B;  2KSR A;  2XYS A;  4HQP A;  3UQ4 A;  5BP0 A;  5L4E A;  2LKG A;  2ZJV A;  2BYS A;  3UU4 A;  2BYN A;  2YKS A;  3ZDH A;  4A98 A;  3RIA A;  4X5T A;  5IUX A;  5SYO A;  5BRX A;  2WZY A;  4F8H A;  3U8N A;  5L4H A;  2QC1 B;  2C9T A;  4TNW A;  4AFT A;  5AFM B;  2M6B A;  4IL4 A;  5HEU A;  5LG3 A;  2W8G A;  2XQ6 A;  3EI0 A;  1UX2 A;  5HCM A;  5HCJ A;  5HEJ A;  2XZ6 A;  2BJ0 A;  1OED E;  3WTJ A;  3WTH A;  3P4W A;  2WN9 A;  4B5D A;  1I9B A;  1OED A;  2YME A;  4Z90 A;  3RQU A;  5AIN A;  2Y56 A;  3UU5 A;  3PMZ A;  4BQT A;  5AFH A;  4NPP A;  2WNC A;  4QAA A;  5AFJ A;  2X00 D;  2WNJ A;  3TLV A;  3UQ7 A;  3U8J A;  3WTL A;  4NZB A;  4HFB A;  2XQ5 A;  4FRR A;  2LKH A;  4QAC A;  4A97 A;  4HFC A;  4AFH A;  5HEG A;  3TLW A;  2WNL A;  3SH1 A;  4IRE A;  4ILC A;  5LXB A;  2BYQ A;  4UM3 A;  5CFB A;  4ZZC A;  2BG9 E;  4ZJT A;  4HFD A;  3IGQ A;  4BFQ A;  2BG9 C;  2XQ8 A;  2XQ4 A;  2Y7Y A;  2BR7 A;  3U8M A;  4ZR6 A;  2PGZ A;  5FJV A;  5JME A;  2XQA A;  4TWD A;  4IL9 A;  1UV6 A;  3TLS A;  5J5G A;  2YN6 A;  4ZK1 A;  2UZ6 A;  3UU6 A;  3LSV A;  4HFH A;  2XQ7 A;  5J5I A;  5J5H A;  4ZZB A;  4TWH A;  4QH5 A;  4ILB A;  2X00 A;  4XK9 A;  4AFG A;  5AFM A;  5J5F A;  3RIF A;  4LMK A;  2XZ5 A;  4XHE A;  5TVC A;  2YMD A;  3WTN A;  2Y57 A;  4ALX A;  3JAD A;  3TLT A;  2LLY A;  3PEO A;  3WTM A;  1UW6 A;  5AFN A;  2XYT A;  4HFI A;  3SQ6 A;  3U8L A;  4DBM A;  4COF A;  2XQ3 A;  3P50 A;  5CO5 A;  3RHW A;  5BW2 A;  3EHZ A;  2VL0 A; 
#chains in the Genus database with same CATH topology
 1HX8 A;  3O1J A;  5L47 A;  1FIO A;  5GON E;  2VK9 A;  4IE6 A;  5JH7 E;  4E7Z A;  2UXN B;  2W8F A;  2KWI B;  4L5G A;  3UTK A;  1WYC A;  5ABF A;  4DR1 T;  2V5C A;  3V5S A;  4G2A A;  4IE5 A;  4EEB A;  4YJ3 E;  2CBJ A;  3T4M A;  2LE8 A;  3C84 A;  4LML A;  2P9B A;  2D9D A;  2DWG A;  1WFD A;  4UEM A;  3VRA A;  5LMN T;  4UM3 S;  5AFK A;  1YKH B;  2LEH A;  2KND A;  3ETV A;  3PUY F;  2ACX A;  3WAJ A;  5FMN A;  3CX6 B;  3NRX A;  1UX2 A;  1VCT A;  5FL1 A;  1N33 T;  1Y64 B;  3ZN1 B;  3OPC A;  4EED A;  5CGM A;  1QSD A;  4GKJ T;  3TLV A;  3AAE B;  2V6Y A;  5AQT B;  5HXC A;  1S94 A;  5AQU B;  2IW5 B;  4ILC A;  1WR6 A;  3EDU A;  3SFD A;  4UM3 A;  3P4Q A;  3RC3 A;  4F6R C;  3BK9 A;  3AE3 A;  2AXD S;  4U3C A;  3N9O A;  3LK2 B;  3H37 A;  3L8R A;  3WTN A;  5IHY A;  2LLY A;  1WRD A;  3MAC A;  4A5X A;  3EVY A;  1BR4 A;  4PNI A;  3N2O A;  3CML A;  2HH7 A;  1D0Y A;  5C3J A;  4TNV A;  4KX6 A;  2F4V T;  1UX5 A;  3FZK B;  4XAX B;  4GKK T;  3AEF A;  1YQ4 A;  3KBT A;  3JAE A;  3ZCI A;  4Q25 A;  3ZMT B;  4B6X A;  2KWH A;  3PUV F;  2WCA A;  2DHR A;  3SQ9 A;  2XAQ B;  4KUM B;  3LBX B;  2XYS A;  5LOV E;  4ZI7 E;  2IML A;  2WP9 A;  2RA1 A;  3ZC1 A;  4QXH B;  2X0H A;  5LYJ E;  3MKD A;  1M62 A;  1OED E;  2X67 A;  2VQF T;  1LVF A;  3EUH A;  4NPP A;  5AFJ A;  5FXW A;  5L3D B;  3KV9 A;  1T72 A;  2A3D A;  2UUC T;  1D1C A;  1N36 T;  3K8P C;  1MMD A;  4QWN B;  4ZJT A;  3CX8 B;  3JC6 D;  3ESL A;  2ZM2 A;  1SHZ C;  4L0R A;  3T1H T;  4TWD A;  4IDZ A;  5AQR B;  3SWH A;  2XQ7 A;  3K3N A;  4AFG A;  2OA5 A;  3F57 A;  2MOZ A;  3AE9 A;  2JRK A;  2I59 A;  2X0Y A;  2LSI A;  1U5P A;  4LFA T;  4IE0 A;  4PAG A;  2ZMA A;  2R6G F;  5EZY E;  1NAF A;  1N32 T;  5FL0 A;  2CXL A;  1E1H B;  4EZ1 A;  3N2G E;  2C5J A;  2JQH A;  3JAF A;  3AE6 A;  4C90 A;  2X9H A;  5FYM A;  3OKQ A;  5JDQ A;  3UUM A;  3ZEF B;  3MZK B;  2EHO D;  4ILU A;  2XNV A;  2W67 A;  3BQL A;  4NUV A;  3ZMZ B;  2M67 A;  3UQ4 A;  1FJG T;  3I9Y A;  5IUX A;  3KVA A;  2Q9Q B;  5CA1 E;  2LSJ A;  1D0X A;  3FBL A;  4TV8 E;  2W61 A;  4P09 A;  4TNW A;  2K9A A;  2W8G A;  4X1K E;  4UXN B;  2JQ9 A;  4AIU A;  2WWU A;  4AKR B;  5AFH A;  3HKE E;  3RYC E;  2E8I A;  2ACZ A;  2OLT A;  4DR4 T;  1KNP A;  4WZX A;  1YW0 A;  2V5D A;  2VVN A;  3UT5 E;  2NW8 A;  1ZV4 X;  3EDV A;  3NWI A;  4U72 A;  2X0L B;  1UV6 A;  4YY3 T;  5CB4 E;  5KX5 E;  4ZI3 D;  2BVM A;  4DR6 T;  3ONL C;  4IT4 A;  2XYT A;  4OX9 T;  3U78 A;  2XSA A;  4TV9 E;  3P50 A;  3DJB A;  4CN4 A;  5BW2 A;  3EHZ A;  3C79 A;  5HYA A;  2L9Q A;  1XDP A;  5FVK A;  4AQY T;  5LHG B;  2X9X A;  3RI5 A;  2BYR A;  3KVB A;  2VUR A;  2N2N A;  1T7S A;  4EYU A;  3N9N A;  4EZH A;  2BS2 A;  2NTX A;  2WM9 A;  1HG2 A;  5JR9 B;  5ABH A;  2LHN A;  4ZK4 A;  2RP4 A;  1MIY A;  5KZU A;  3QUJ A;  3HL6 A;  4AKL A;  1QLB A;  4O2B E;  1AJ3 A;  1Z8U A;  1D0Z A;  3QC9 A;  4JLE A;  5J2U E;  5LG3 A;  2CLY C;  5HEJ A;  4QKN A;  2UUA T;  2XZ6 A;  2BJ0 A;  3AXJ B;  2VVS A;  4DV1 T;  3PMZ A;  4WBN E;  3P8C D;  4J2C A;  2WNC A;  3O4X E;  2WNJ A;  5L2L A;  5AQP B;  2C5I T;  4PJM A;  2DWK A;  4TZ4 C;  3IGQ A;  2QA7 A;  1MMG A;  2C0S A;  5E0O A;  4BFQ A;  2CXF A;  2FJB A;  2BR7 A;  1UK5 A;  3P4P A;  2D0U A;  2LJL A;  3QB5 A;  3SS1 A;  4NIQ A;  3F31 A;  4IDO A;  4ZK1 A;  4PK4 A;  3AEC A;  2UXD T;  2ZM0 A;  1W0B A;  2DLR A;  1Z0P A;  1EZ3 A;  2BKN A;  3D0T A;  5JR9 A;  2Y6X A;  2LHR A;  5KXJ A;  2WSS V;  1LRZ A;  2XAF B;  4QXB B;  4WBO A;  2LSY A;  1SA0 E;  5JTG A;  4XBF B;  3FBZ A;  5C8Y E;  2XM2 A;  2YDR A;  5FVL A;  3PV0 F;  3GUA A;  4UEL A;  3HI2 A;  4ZRU A;  4GIW A;  3AXJ A;  2MYS A;  3HKC E;  2WQY A;  4IST A;  3A5X A;  3QOF A;  3UUB A;  4PFO A;  4MHC A;  4U74 A;  2KSR A;  4AKH A;  1YKE B;  2ZJV A;  2MBG A;  4A98 A;  4DR5 T;  5BRX A;  2QRX A;  3U8N A;  3KBU A;  2VAS A;  2E9X D;  3VRB A;  3EI0 A;  3X1D A;  5ADX L;  3P4W A;  2IHR 1;  4UF0 B;  1I9B A;  2ES0 A;  2IUB A;  4NXN T;  4GYR A;  3UQ7 A;  3WTL A;  2H88 A;  3MXZ A;  3PUA A;  3P4R A;  1J1J A;  2JJ9 A;  3U8M A;  4ZR6 A;  5FY1 A;  4TX5 A;  3OJA A;  3S4U A;  2C5K T;  2XQA A;  3ZSS A;  2XAH B;  1NEN A;  3I0Q A;  2W2U A;  2VKJ A;  2J1D G;  5TVC A;  2BZB A;  1IBK T;  1UGO A;  3FZL B;  4MFR A;  3E22 E;  2W4X A;  5J1G A;  5AQK B;  2J62 A;  4UVA B;  3KV5 A;  4HWC A;  4UVC B;  3FZM B;  2WZH A;  1HTJ F;  4HEA A;  2LM2 A;  3C4Z A;  3OBV E;  4EB6 E;  2CCQ A;  1ZKE A;  5HWX A;  3PU8 A;  3ZYL A;  3ZT5 A;  2V6Y B;  3T1Y T;  3MA9 A;  3ZT7 A;  3ZYK A;  2BKP A;  4IDP A;  4HFE A;  3C64 A;  2VKD A;  3I0O A;  4OYJ A;  3RQW A;  5J0Z A;  1GQE A;  4JI4 T;  4LF8 T;  3RIA A;  4X5T A;  5H6R B;  3GN5 A;  5LGT B;  3N9Q A;  3RIU A;  1G8X A;  4B3M T;  2GK9 A;  5HCJ A;  3WTJ A;  3ABV A;  4AKG A;  1X9B A;  4Z90 A;  3A8Y C;  4O4H E;  3I1A A;  3ANW B;  2NW7 A;  5IWA T;  1HG5 A;  2CHN A;  5JR9 C;  5HXE A;  3UUL A;  4KI0 F;  4IE7 A;  4DMW A;  2IIU A;  2KT9 A;  5JME A;  3Q5X A;  3L09 A;  5A1L A;  1G73 A;  1IZN B;  2X00 A;  1W9R A;  1QUU A;  3OVU A;  2XZ5 A;  2JIW A;  2YMD A;  2CRB A;  2NP9 A;  4ADZ A;  4PK5 A;  3NZP A;  2YDQ A;  3NKZ A;  4UM3 P;  2BS4 A;  4AKI A;  2HHH T;  2HPL A;  5LA6 E;  3AE1 A;  3N9P A;  3UU3 A;  5AQG B;  5HEH A;  4PIR A;  3R6N A;  4CN6 A;  4MAL A;  1KF6 A;  4X20 E;  2K48 A;  2PG8 A;  2DNX A;  2XQ9 A;  2XNT A;  1JNR A;  1FEW A;  2ODV A;  4DID B;  4DV4 T;  4LF5 T;  2MAW A;  4ZOL E;  3IBP A;  1OXZ A;  3OYX A;  5KE4 A;  2CLY B;  2PJQ A;  2L8K A;  1VOM A;  3ANW A;  4YSX A;  3ETU A;  4U31 A;  3SFE A;  4EIW A;  3AA1 B;  4N78 D;  2PTF A;  2YU1 A;  5HEU A;  4CXY A;  4LF9 T;  4I0U A;  2VKH A;  4YHH T;  4MLK A;  4BQT A;  4FI5 A;  2X00 D;  3FXE B;  4NZB A;  4QAC A;  1BR1 A;  4OFZ A;  3TLW A;  2QGS A;  3SRZ A;  4TN7 B;  2BYQ A;  4KMC A;  3CQG B;  1VRB A;  3VU7 H;  1HNZ T;  3PUW F;  4KHZ F;  2EHO A;  3VHL A;  3O9X A;  4ZZB A;  3RF1 A;  5HWY A;  2XY8 B;  3DP7 A;  4ANJ A;  1W0A A;  4BJM A;  4H9P C;  1UW6 A;  3N9L A;  3U8L A;  5JRC A;  4HE8 A;  1LVK A;  5F8P A;  2BR8 A;  4UV9 B;  2HPJ A;  5JDL A;  3CWZ B;  2UXX B;  4Z91 A;  2DCF A;  2UUB T;  3RIU C;  4WV9 A;  5JDH A;  2FJE A;  2WU5 A;  4JUY A;  5DAB A;  2N9D A;  4HN9 A;  2H7V C;  2CWO A;  1XMO T;  1WYB A;  3NRY A;  4LF4 T;  4D01 A;  1IBL T;  1CHU A;  3RRW A;  3OYZ A;  2UXC T;  2L3L A;  4HWH A;  3N5L A;  2XNU A;  4ZEY A;  2KZ7 B;  3BQI A;  4NUU A;  2CA5 A;  3IHR A;  5SYO A;  3ZJ1 A;  4JI0 T;  2WZY A;  4U7Y A;  3RYF E;  2ZM6 T;  3GA8 A;  3AEG A;  2FBW A;  1V9D A;  5JRE A;  2XQ6 A;  3CKD A;  3K3O A;  5HCM A;  2V7I A;  2LRL A;  3WTH A;  4ISS A;  5AQI B;  4Z8X A;  2LRK A;  4WYV A;  2JMK A;  4JI8 T;  4ZI2 D;  3RGL A;  5AQF B;  4FRR A;  1HCI A;  3GWH A;  1ZEE A;  5HEG A;  3RYI E;  2V7K A;  5AQQ B;  3LFM A;  1UX4 A;  2WDV A;  1NEK A;  1LKX A;  3P4S A;  4K0K T;  2Y48 B;  2XHE B;  5FY0 A;  5AFM A;  3L3P A;  3RIF A;  4EXT A;  5C2T A;  4X1Y E;  1J5E T;  2DL1 A;  4HFI A;  4UIG A;  4JI6 T;  3SQ6 A;  3JC6 C;  5LXB A;  4YTP A;  4UXU A;  5AQS B;  3W15 B;  5AFL A;  2Y58 A;  1KK7 A;  2D5U A;  1HNW T;  4QH1 A;  3KV4 A;  5FNV E;  2FJD A;  4JEU B;  2CEA A;  2YOE A;  3SOL A;  4PJN A;  2XAG B;  3Q5W A;  2E5L T;  4ZS2 A;  5ABG A;  5L3G B;  4IE4 A;  3B13 A;  5F3J A;  5L3C B;  4DR3 T;  3ZDH A;  2VB6 A;  2XZE A;  4JBW F;  5J2T E;  2CWY A;  1I94 T;  4EYY R;  5FP3 A;  2EHO C;  2ZM8 A;  1FMV A;  1D1A A;  2WAU A;  2VWA A;  3U8J A;  4BAY B;  2LKH A;  3B57 A;  3FB2 A;  2J4G A;  4AFH A;  4IDQ A;  2I6H A;  5LGN B;  5LHH B;  3RKG A;  2V7L A;  3AE5 A;  4OHF A;  4PK6 A;  4YLH A;  2XQ8 A;  2HN2 A;  4ERR A;  4O4J E;  5JDM A;  2CM0 A;  3C50 A;  2K24 A;  3C51 A;  2IDO B;  5LGU B;  4ILB A;  2XQY A;  5KDM C;  3JAD A;  3WAK A;  3E08 A;  3N9M A;  5AFN A;  4JI1 T;  1T98 A;  2E9X A;  3PUZ F;  3RHW A;  4YTM A;  2YU2 A;  3V5U A;  3FZF B;  4LF7 T;  3ZLI A;  2PH9 A;  4ZI3 C;  5LG4 A;  1IBM T;  3O1I A;  5DQW A;  5ETW A;  4M1P A;  3SIO A;  1HX1 B;  4G63 A;  2Q9Q D;  2WDR A;  3J9X 1;  3RX6 A;  2V1D B;  1VCS A;  3CX7 B;  2H89 A;  2LKG A;  2WY2 A;  2YKS A;  2BYN A;  2G0U A;  3AAA B;  2B76 A;  4H63 V;  3U3I A;  5JQG E;  1ZP0 A;  1R8I A;  4PJL A;  4LFC T;  4L9I A;  4DV7 T;  4AQG A;  1SUM B;  4X65 T;  4JI2 T;  3RQU A;  4LFB T;  2D2S A;  4EZ4 A;  1HR0 T;  3F2E A;  3RRC A;  3ZMS B;  2H3R A;  2JQQ A;  5HXS A;  2CMR A;  4HFV A;  4XZC A;  2XM1 A;  1XWM A;  1KFY A;  3EAB A;  1MMA A;  4HTE A;  4CI2 B;  2SPC A;  3SH1 A;  1E7P A;  2K5B B;  5CFB A;  2IAK A;  3PUG A;  5FJV A;  4KP3 C;  4KHP T;  2X66 A;  4IL9 A;  1D1B A;  2K3W A;  2UZ6 A;  3ZN0 B;  4HFH A;  5J5I A;  2PBI A;  1YQ3 A;  5EK4 A;  5DQV A;  5J5F A;  4B3R T;  5LNK A;  3DTO A;  4ALX A;  4P0B A;  3AE7 A;  4I4T E;  3GN5 B;  4KBM B;  4PW8 A;  3AVR A;  1MNE A;  3UFE A;  3N2K E;  4UV8 B;  4U2Z A;  3ZPO A;  1T8B A;  1HFA A;  2V7M A;  2NW9 A;  4YHJ A;  3M65 A;  1IJ6 A;  2Z6E A;  3HKB E;  2XUE A;  4PJJ A;  1B7T A;  2Y54 A;  4UY2 A;  5LBQ B;  2VKO A;  3WTK A;  4HQP A;  2BBJ A;  2BYS A;  3GMI A;  5TAO A;  4JV5 T;  2E2A A;  3RH3 A;  4U2Y A;  2W63 A;  4DV3 T;  4TUY E;  4CZZ B;  2WMO A;  2UXB T;  4QHO A;  4ZXL A;  2A72 A;  2VL8 A;  1OED A;  4YXD A;  5LMU T;  3AE2 A;  2Y56 A;  4QX8 B;  4IHJ E;  3AEE A;  4DUZ T;  3C4W A;  2FUP A;  4CN1 A;  4O8S A;  4HGA A;  5ABE A;  4CI1 B;  2KXP B;  3PUS A;  5M4Y A;  5JVD E;  3Q2M A;  2E9X C;  2W66 A;  5AQH B;  3PUX F;  2XQ4 A;  4DMV A;  2Y7Y A;  2W62 A;  3TLS A;  4CXW A;  4X66 T;  4XHE A;  5AQL B;  2X9W A;  3ZMV B;  2CXD A;  4I43 B;  2LT3 A;  3CPZ A;  4YJ2 E;  1IJ5 A;  1MND A;  4BJN A;  4X64 T;  5EK3 A;  3ZKR A;  4CI3 B;  2WMN A;  3L39 A;  4MBQ A;  2RPA A;  5L3F B;  2KMF A;  5IYZ E;  4TWF A;  2M6I A;  3HKD E;  4ZJS A;  4H9N C;  3ZT6 A;  2V6X A;  5LB7 B;  4UVB B;  2CHO A;  2B1E A;  3LK3 B;  3UU4 A;  1O3X A;  1IAP A;  2EHO B;  3MK7 C;  2BDE A;  2QC1 B;  2X68 A;  3PU3 A;  3PE0 A;  4DBQ A;  2CE7 A;  2VQE T;  3RYH E;  2X9Y A;  3VR9 A;  4AQF A;  3AB3 B;  5JRC B;  2XTL A;  3JCF A;  3AA0 B;  5LCY A;  2AE9 A;  3C4X A;  3CVR A;  4O2A E;  5FKY A;  1HF8 A;  4HFB A;  3ONX A;  2A2F X;  2NWB A;  4YFS A;  4IRE A;  1BR2 A;  4ZZC A;  5DJQ C;  4PFP A;  4P0A A;  4DV6 T;  3H3M A;  3UUN A;  4YT0 A;  4DND A;  3QK6 A;  4XK9 A;  3HR0 A;  1HNX T;  2QVA A;  1H7C A;  3ZMU B;  2OV9 A;  1BR0 A;  3T8O A;  3Q5D A;  1HS7 A;  3IF8 B;  1WCR A;  3UFG A;  4ASK A;  2WZI A;  4K0U A;  3NZQ A;  4WW0 A;  3TLU A;  2CBI A;  3IA3 A;  4H9Q C;  1ZHC A;  3KDS E;  3U8K A;  5H6Q B;  1OED C;  2JMH A;  3WTO A;  1DU2 A;  5AQJ B;  1UUS A;  3ZDG A;  1E2A A;  2WDQ A;  1KNR A;  2WU2 A;  5BP0 A;  2CPT A;  4F8H A;  4E7S A;  5BR8 T;  2PFV A;  3OTO T;  4AFT A;  4OK0 A;  5AFM B;  3CK6 A;  1OWA A;  3AAI A;  5CJ5 A;  3VKH A;  4X62 T;  4H9R C;  1X79 A;  3NVO A;  2YME A;  2X51 A;  5L3B B;  3PJA A;  4JI5 T;  5JDF A;  2MTQ A;  2UU9 T;  3Q9D A;  3PJA J;  4A97 A;  2LM9 A;  4DVD A;  3QNU A;  3B5M A;  4ZS3 A;  2LSG A;  2PGZ A;  3LBX A;  2XAJ B;  2QYW A;  2V7J A;  3FXD B;  3P7I A;  2YIN A;  2DI4 A;  1XDO A;  3RPU A;  3H3A A;  4LMK A;  4CQI A;  2A9U A;  2HN1 A;  4FJO A;  3I9W A;  3RKO A;  2WBL A;  4V1A v;  3ZYM A;  4DBM A;  4COF A;  1MMN A;  2BVL A;  2Y8D A;  5L3E B;  4GK5 E;  3ZC0 A;  3CIR A;  4EV6 A;  2ZJU A;  5LXT E;  1MIW A;  3ZCJ A;  1NWM X;  3VR8 A;  4H9S E;  5FXZ A;  5HEO A;  2JPF A;  1M7K A;  1UCU A;  4ILA A;  1U4Q A;  4UM1 A;  3AA7 B;  3M3Z B;  4AQF C;  4P1N A;  3KIN B;  5JDG A;  3AE8 A;  4HWD A;  2NR4 A;  2BG9 B;  2XSB A;  4IDN A;  5L4E A;  4GK0 E;  4AXP A;  1XMQ T;  5LBM A;  2LOS A;  2C9T A;  1Y01 A;  2FJA A;  2M6B A;  2N1G A;  4GYS A;  2YDS A;  4QXC B;  4YTN A;  2V26 A;  2LOP A;  2V8S V;  5HXR A;  2WN9 A;  3PDY A;  1UUR A;  2E9X B;  5AIN A;  3UU5 A;  3J7Y q;  4DV5 T;  4GOU A;  2LSK A;  3CQX C;  4YSY A;  4AIS A;  4DO0 A;  1WLX A;  4ZHQ E;  1N34 T;  4HFC A;  2WB5 A;  1XNR T;  3K1S A;  2WNL A;  5LJN A;  4O4L E;  2W00 A;  1W09 A;  3G06 A;  5J5G A;  2XPK A;  2Q9Q A;  3UU6 A;  3LSV A;  4CXX A;  4ZI2 C;  4TWH A;  2W0G A;  2MPK A;  3ZST A;  3TLT A;  2E5V A;  4IIJ E;  4B3T T;  3PUQ A;  3E0Z A;  5CO5 A;  2ZLY A;  1YXR A;  3AEA A;  2BG9 A;  4B3S T;  3RC8 A;  4DBR A;  4EGW A;  4LMJ A;  3WTI A;  5FXV A;  2KIN B;  4UR9 A;  3KFW X;  3HA4 A;  2XJ7 A;  3AEB A;  3WIP A;  4U7I A;  2IC6 A;  3UU8 A;  5AQO B;  3FZH B;  4NXM T;  1KNZ A;  3BQK A;  1I6Z A;  5AQN B;  3ONJ A;  2WS3 A;  1S35 A;  4EAH A;  5AQM B;  3AED A;  2H7O A;  4IL4 A;  3TKL B;  2YK0 A;  3FHN A;  4I50 E;  3A7M A;  4AI6 A;  3RLF F;  5BMV E;  1WR0 A;  4O4I E;  5KMG P;  2NOX A;  4QX7 B;  4HWI B;  2BBH A;  5CA0 E;  4YSZ A;  1CUN A;  4I55 E;  3IEE A;  2XAS B;  2KLQ A;  5LP6 E;  4HFD A;  3WI3 A;  3R84 B;  2BS3 A;  2YN6 A;  4OYK A;  1FMW A;  3QB5 K;  5LHI B;  4LF6 T;  1JNZ A;  4QH5 A;  4H9O C;  1ZOY A;  3MJX A;  3C98 B;  3WTM A;  3AE4 A;  4DV0 T;  3PEO A;  2JQK A;  2BKO A;  2VL0 A;  4WNK A;  4BA9 A;  4X1I E;  3EAM A;  1OED B;  2J47 A;  4DUY T;  4QH4 A;  3PUR A;  1XNQ T;  5LJM A;  4HWF A;  4HKA A;  4EOZ B;  4QAB A;  4H63 H;  3AVS A;  5F5W A;  5AQV B;  2BYP A;  2WWV A;  3VKG A;  5EK2 A;  3CQC B;  1MIV A;  4IGU A;  1J5W A;  3LJC A;  3ZJ2 A;  1YD8 G;  5L4H A;  3AA6 B;  5FXX A;  4JI7 T;  3LDQ B;  3PTR B;  3LG7 A;  5JDN A;  5AFU L;  5ABF B;  1XZY A;  1KEY A;  4B5D A;  2Q9Q C;  4U33 A;  4QAA A;  3O1H A;  4JEH B;  1SE7 A;  2XQ5 A;  5FY7 A;  3LK4 2;  1US7 B;  2BG9 E;  5HAX A;  5HXH A;  2BG9 C;  4DR7 T;  3NBX X;  2ODU A;  4C91 A;  3KV6 A;  4DV2 T;  2D0T A;  5J5H A;  3K3Q C;  2YEV C;  4A56 A;  3UUX B;  4JYA T;  4JI3 T;  2Y57 A;  4DR2 T;  1L0V A;  3Q5E A;  2NTY A;  2I0M A;  4UF0 A;  2XQ3 A;  2IC9 A; 
#chains in the Genus database with same CATH homology
 2BG9 A;  5L47 A;  3C79 A;  4UXU A;  3TLU A;  2BR8 A;  2ZJU A;  3UU3 A;  5AFL A;  2LM2 A;  3EAM A;  1OED B;  5HEH A;  4Z91 A;  4PIR A;  2PH9 A;  2W8F A;  2Y58 A;  3RI5 A;  4LMJ A;  4QH4 A;  2BYR A;  3GUA A;  3ZKR A;  3WTI A;  4TNV A;  4WV9 A;  3U8K A;  4ZRU A;  5HEO A;  4EZ1 A;  4UM3 P;  4QH1 A;  2XQ9 A;  2XNT A;  4ILA A;  3WIP A;  4UM1 A;  2YOE A;  3JAF A;  3JAE A;  4QAB A;  3SIO A;  3UU8 A;  3T4M A;  1OED C;  2MAW A;  4TWF A;  3C84 A;  3WTO A;  2M6I A;  4LML A;  3UUB A;  2Y54 A;  4UY2 A;  4D01 A;  4ZK4 A;  4HFE A;  2BYP A;  3SQ9 A;  4ZJS A;  3ZDG A;  4UM3 S;  3RQW A;  5J0Z A;  2XNV A;  5AFK A;  5KE4 A;  2XNU A;  5KZU A;  3WTK A;  2BG9 B;  2KSR A;  2XYS A;  4HQP A;  3UQ4 A;  5BP0 A;  5L4E A;  2LKG A;  2ZJV A;  2BYS A;  3UU4 A;  2BYN A;  2YKS A;  3ZDH A;  4A98 A;  3RIA A;  4X5T A;  5IUX A;  5SYO A;  5BRX A;  2WZY A;  4F8H A;  3U8N A;  5L4H A;  2QC1 B;  2C9T A;  4TNW A;  4AFT A;  5AFM B;  2M6B A;  4IL4 A;  5HEU A;  5LG3 A;  2W8G A;  2XQ6 A;  3EI0 A;  1UX2 A;  5HCM A;  5HCJ A;  5HEJ A;  2XZ6 A;  2BJ0 A;  1OED E;  3WTJ A;  3WTH A;  3P4W A;  2WN9 A;  4B5D A;  1I9B A;  1OED A;  2YME A;  4Z90 A;  3RQU A;  5AIN A;  2Y56 A;  3UU5 A;  3PMZ A;  4BQT A;  5AFH A;  4NPP A;  2WNC A;  4QAA A;  5AFJ A;  2X00 D;  2WNJ A;  3TLV A;  3UQ7 A;  3U8J A;  3WTL A;  4NZB A;  4HFB A;  2XQ5 A;  4FRR A;  2LKH A;  4QAC A;  4A97 A;  4HFC A;  4AFH A;  5HEG A;  3TLW A;  2WNL A;  3SH1 A;  4IRE A;  4ILC A;  5LXB A;  2BYQ A;  4UM3 A;  5CFB A;  4ZZC A;  2BG9 E;  4ZJT A;  4HFD A;  3IGQ A;  4BFQ A;  2BG9 C;  2XQ8 A;  2XQ4 A;  2Y7Y A;  2BR7 A;  3U8M A;  4ZR6 A;  2PGZ A;  5FJV A;  5JME A;  2XQA A;  4TWD A;  4IL9 A;  1UV6 A;  3TLS A;  5J5G A;  2YN6 A;  4ZK1 A;  2UZ6 A;  3UU6 A;  3LSV A;  4HFH A;  2XQ7 A;  5J5I A;  5J5H A;  4ZZB A;  4TWH A;  4QH5 A;  4ILB A;  2X00 A;  4XK9 A;  4AFG A;  5AFM A;  5J5F A;  3RIF A;  4LMK A;  2XZ5 A;  4XHE A;  5TVC A;  2YMD A;  3WTN A;  2Y57 A;  4ALX A;  3JAD A;  3TLT A;  2LLY A;  3PEO A;  3WTM A;  1UW6 A;  5AFN A;  2XYT A;  4HFI A;  3SQ6 A;  3U8L A;  4DBM A;  4COF A;  2XQ3 A;  3P50 A;  5CO5 A;  3RHW A;  5BW2 A;  3EHZ A;  2VL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...