4ZZCA

The glic pentameric ligand-gated ion channel open form complexed to xenon
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural Basis for Xenon Inhibition in a Cationic Pentameric Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4zzcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zzcA01
4QACA 3EHZA 5HEJA 2Y56A 2VL0A 3TLSA 3TLVA 4TWHA 3WIPA 3WTIA 4AFGA 1OEDC 5HEHA 5AFHA 3WTKA 4ILAA 2C9TA 4QAAA 4XHEA 3SH1A 4COFA 5BP0A 4ZK4A 4HFEA 5FJVA 3ZDGA 3WTLA 3RQWA 2XNUA 2XQ7A 4LMKA 2BYNA 4ZZCA 4BFQA 2BYRA 4HFIA 4X5TA 4Z91A 4IREA 5HEGA 2UZ6A 4QH5A 2PH9A 2Y7YA 5HCMA 4ZJSA 2W8GA 2YKSA 3JAEA 2WNLA 2XNTA 2BG9E 2Y57A 3WTMA 2XNVA 4UM1A 5J5FA 5LXBA 3U8JA 5AINA 3P50A 3WTHA 2BG9A 3LSVA 2XQ9A 2BJ0A 3UU5A 4UY2A 2WZYA 2M6BA 5AFMB 3EAMA 3U8MA 1UV6A 4AFTA 3ZDHA 5AFLA 3TLUA 1I9BA 4B5DA 2BR8A 2WNJA 2BG9C 4UM3P 2M6IA 5L4HA 4TWFA 3C84A 2KSRA 4HFHA 5HEUA 2BYSA 2LKGA 2WN9A 2XYSA 3T4MA 3UU6A 2BR7A 3WTOA 2BYPA 4QH4A 2LLYA 3UQ4A 3WTJA 5J5IA 3IGQA 5L47A 3U8KA 2XQ5A 3UU3A 3RI5A 4AFHA 4HFDA 4IL9A 4ZR6A 5JMEA 4HQPA 2YOEA 2ZJVA 3UQ7A 4ILBA 4LMJA 3TLTA 4DBMA 5AFKA 2XYTA 5AFMA 4ILCA 3UUBA 2W8FA 4FRRA 4WV9A 4F8HA 5CFBA 3RQUA 4NZBA 2BYQA 2XQAA 3RHWA 2MAWA 5IUXA 5CO5A 3JAFA 3P4WA 5HEOA 3JADA 3SIOA 2Y58A 3U8LA 3TLWA 4QH1A 2XZ5A 2Y54A 2ZJUA 4ZZBA 4A97A 5HCJA 3C79A 4NPPA 2LKHA 2X00D 4XK9A 4HFBA 4ZK1A 5BW2A 5SYOA 3UU8A 3SQ6A 5J0ZA 4UM3A 2XQ3A 2YN6A 3WTNA 1UX2A 2WNCA 4QABA 4BQTA 2X00A 2YMDA 3SQ9A 3U8NA 5J5HA 3PEOA 2LM2A 3UU4A 3PMZA 2XZ6A 4UXUA 4ALXA 4HFCA 4UM3S 3EI0A 5KE4A 5AFJA 2XQ8A 5J5GA 4TNWA 4Z90A 2QC1B 3RIAA 4LMLA 3GUAA 2XQ4A 5KZUA 4EZ1A 3ZKRA 2PGZA 4D01A 2BG9B 1OEDE 1OEDB 5LG3A 4ZRUA 4ZJTA 5BRXA 3RIFA 4PIRA 4A98A 1OEDA 1UW6A 4IL4A 5AFNA 2XQ6A 5TVCA 4TNVA 4TWDA 5L4EA 2YMEA
chains in the Genus database with same CATH superfamily
2BDEA 1MMNA 5J5FA 3EDUA 2YDQA 4ILAA 3ABVA 3RYHE 1Z8UA 3WTLA 3VKGA 1SUMB 5LMUT 5HCMA 2C5JA 1KK7A 3E0ZA 4YSZA 3K1SA 2V8SV 4NXNT 2KWHA 5FP3A 4QXBB 4HWIB 3PUAA 3W15B 3KVBA 4KHPT 2W67A 4HFVA 3T4MA 2BYPA 1ZEEA 4IDQA 3ETVA 2KT9A 2XQ5A 3I0OA 2BBJA 1D0ZA 2DI4A 2OV9A 5KXJA 4F8HA 3RQUA 4EV6A 3LG7A 2IHR1 3P4WA 1O3XA 4DV6T 3EUHA 2N1GA 4PK5A 2Q9QA 2V26A 4AKIA 3UU8A 4YSYA 4YJ3E 5DABA 2X00A 1E1HB 2CHOA 2XAFB 3P8CD 5DQVA 2MOZA 1BR4A 5LB7B 5CA0E 4P1NA 2VL8A 4YSXA 4WBNE 3PE0A 4ISSA 3GN5B 4O4JE 2UXDT 5FY1A 2WMNA 3WTIA 2C9TA 4OHFA 4ZK4A 1UCUA 3P4RA 5FVKA 4E7SA 2X0YA 2C0SA 2JMHA 3L8RA 4U33A 3ANWB 5IYZE 4UIGA 3WTHA 3CKDA 3Q5EA 4B3TT 1I9BA 1HG5A 2FJBA 4ZI2D 3LDQB 3CK6A 1W0AA 2XYSA 2Q9QD 4QH4A 2LLYA 3DTOA 4MBQA 3ZSTA 1FIOA 2FUPA 3FZHB 5J2TE 2V7JA 1J5ET 2HN2A 3ZT5A 2K5BB 3KDSE 3T1YT 4OK0A 3WI3A 2V5DA 3WAKA 4AISA 4CXWA 3KFWX 4DMVA 2LSJA 2KZ7B 5AQQB 3AEGA 4ANJA 4HFCA 3CVRA 3CMLA 4NXMT 5J5GA 4BA9A 4HKAA 4HE8A 3I1AA 3UFEA 4JI2T 4JEHB 4DV5T 3MK7C 1XDPA 2JIWA 1MIVA 3ZJ1A 5CGMA 4U74A 2QA7A 5LGUB 2YMEA 5JDFA 2Y56A 1S35A 3EDVA 1NEKA 1XMOT 3SH1A 1KNPA 2XNUA 2XQ7A 4GIWA 3B13A 1YW0A 2CWYA 3M65A 3N5LA 4ZJSA 1XNRT 1U5PA 2J1DG 2BJ0A 5AFMB 1UV6A 5H6RB 4DR2T 3TLUA 4IE5A 2DNXA 2BKOA 2ODUA 2OLTA 3PV0F 4H9NC 3AE5A 1QUUA 4M1PA 5ABFB 2NWBA 1D1CA 5HXRA 3F57A 5LHHB 5ADXL 3VRAA 4UV9B 4LF9T 2K3WA 2BS2A 4NZBA 4PNIA 4I4TE 4IHJE 5LCYA 1LVKA 2LOPA 3JAFA 3NZQA 4TZ4C 5LA6E 4KUMB 5ETWA 4XK9A 3C4WA 4AKRB 2CPTA 2CM0A 1WLXA 2H7VC 4IIJE 4LF5T 3RIUC 2JMKA 1Y01A 4UXUA 4KHZF 4UM3S 3LFMA 4H9RC 3OVUA 3C4ZA 3RH3A 3N2OA 3AA6B 5L3DB 3C4XA 3PUZF 2PGZA 4D01A 4ZRUA 5F8PA 1B7TA 3N9PA 1L0VA 4LF7T 2IC6A 2LM9A 2PJQA 1N36T 2X9HA 3PU3A 4EOZB 2A2FX 4LMKA 3N2GE 5CA1E 1Z0PA 2SPCA 5JDLA 5LXBA 2XNVA 4EXTA 4AKGA 4QX7B 3CPZA 3SFEA 3ZDHA 3RPUA 3RKOA 2WMOA 1UUSA 4G2AA 4YXDA 2YU1A 2WN9A 5AQTB 4O4IE 2YINA 4DNDA 4X1IE 4OFZA 1YQ4A 2VKJA 3D0TA 2VKDA 2IC9A 3RI5A 1UX4A 3V5SA 2LE8A 4KP3C 4U7YA 3FHNA 3ZMTB 3HKBE 2W2UA 2VVSA 4UVBB 2E8IA 2DWKA 2W66A 1FJGT 3SRZA 1V9DA 5FXZA 4HWFA 4U2ZA 5HCJA 4O4LE 3RIUA 4MLKA 2BZBA 4QABA 3H3AA 1FEWA 2FJAA 1XMQT 4AI6A 2XZ6A 4ZI3D 5IHYA 3P7IA 4JLEA 5KZUA 3FZKB 2JQ9A 4CI3B 1YKEB 5TVCA 4TWDA 3AEDA 5AQFB 5JRCA 3ETUA 5C2TA 2NW8A 4PJJA 3I9WA 3RQWA 5AQHB 1Y64B 5LMNT 4HFIA 4X5TA 5JR9C 2KXPB 5CB4E 2UZ6A 4EB6E 4O4HE 2Y57A 4DV4T 4ZHQE 5HXCA 4AFTA 3AA1B 3NWIA 2M6IA 2LSKA 1WRDA 2LSIA 3N9QA 2XSAA 3WTJA 2Q9QB 3HKDE 2VQFT 4YJ2E 1YD8G 4IE4A 4H63H 4DR5T 2BVLA 3PTRB 4OYKA 4DVDA 2Y48B 3AVRA 4XBFB 3ZPOA 4ZS2A 2BS3A 4UF0A 2P9BA 4ASKA 2LSGA 3SIOA 3IA3A 4DV7T 4PJLA 4UVAB 2XAQB 4O2BE 4ZZBA 2C5KT 2MBGA 1X9BA 3R84B 5HWYA 4H9QC 4QXCB 2LRLA 2BBHA 3UU4A 4ALXA 3AE7A 4PFPA 5KE4A 2WZHA 5AQGB 2DLRA 2NP9A 2C5IT 5KX5E 4C91A 4GKJT 3ZMVB 4O8SA 2W0GA 1ZOYA 4YY3T 5M4YA 4FI5A 5JR9A 1WCRA 3LK3B 5HEHA 1XDOA 4COFA 5FJVA 3KBTA 2WY2A 4IREA 2HPLA 4A5XA 4PFOA 2VASA 4UV8B 4IDPA 4IE6A 2WDQA 3AA7B 5DQWA 2BR8A 3BQKA 2W63A 2KSRA 1N33T 3K3QC 3WTOA 3C50A 5LGTB 4KI0F 3TKLB 3MACA 4C90A 4DV2T 4KBMB 5KDMC 4HQPA 1ZHCA 2BS4A 5AQRB 3RYCE 4YLHA 2LJLA 4FRRA 2XAGB 3P4SA 3H3MA 4CI2B 4YTNA 2Y58A 3U8LA 4YTPA 4AQGA 3TLWA 2Y54A 3QB5A 1MIYA 2LKHA 5BW2A 5SYOA 3SQ6A 5J0ZA 1JNZA 2A72A 3HKCE 5J5HA 2E9XC 2XQ8A 3RKGA 2XM1A 4K0KT 4CXXA 3U3IA 1W0BA 2J47A 1IBMT 3PURA 4DMWA 1UGOA 2CLYC 4WBOA 2CBIA 4UR9A 5FKYA 3MJXA 4TX5A 2WQYA 5L4EA 1SA0E 3LBXA 3E08A 4QAAA 4HFEA 2XASB 4BFQA 4PK4A 1DU2A 2RPAA 1LVFA 4QH5A 3U8JA 5AINA 2WAUA 3P50A 2QRXA 4L0RA 2K24A 2X51A 4X66T 3ZN1B 2XM2A 4X65T 1G8XA 5HEUA 3RC3A 2UUAT 5CJ5A 3ZYLA 3Q5DA 2UUBT 3OJAA 1ZV4X 3U8KA 2UXXB 3F31A 5ABHA 3ONJA 2NTXA 1WYBA 1U4QA 2Z6EA 4LMJA 4X1YE 3FXDB 3SOLA 1WYCA 4EIWA 3JC6C 3GMIA 3AE1A 2MAWA 3Q5WA 4CN1A 5JDNA 4EYYR 5LHGB 4IT4A 2B1EA 2DCFA 2DL1A 2X00D 4HFBA 1IJ6A 3RYFE 2E9XA 4H9OC 2IUBA 2N2NA 4JI5T 1FMVA 3PEOA 1R8IA 5TAOA 1KNRA 3PMZA 5JDMA 2JPFA 3AAIA 2WBLA 3VRBA 3UUNA 4Z90A 2WDVA 3PUYF 2X9XA 3ZKRA 4UELA 3ZMSB 4PW8A 1M62A 2H88A 3RIFA 3B57A 2X66A 5JH7E 4QACA 3EHZA 5HEJA 2VL0A 5AQLB 1AJ3A 2BKPA 4QKNA 3MA9A 2H3RA 2X9YA 2PTFA 3VKHA 2X68A 4EGWA 4F6RC 2XNTA 4EEDA 2H89A 4DR7T 3MXZA 5HXSA 2EHOC 3CQXC 3O1JA 2BG9C 3FBZA 4UM3P 1I94T 1UX5A 2XAJB 2VURA 2WS3A 2E9XD 2ACXA 2IMLA 2VK9A 3ZSSA 3KV6A 2KNDA 2RA1A 2V5CA 2VVNA 4H63V 1MMGA 2E5VA 1J1JA 3PUVF 3N9OA 4B3MT 4U7IA 1NAFA 3UUBA 1T7SA 5CO5A 4QX8B 3K3OA 5LGNB 2UXNB 5EZYE 4BJMA 2UU9T 3OTOT 3KV5A 3RYIE 2ZJUA 3PU8A 3ZN0B 4ZI7E 3LK42 2H7OA 2YK0A 4UXNB 1BR2A 5JRCB 2V7LA 3PUQA 3U8NA 1IBLT 4YTMA 5BR8T 5FMNA 4DUZT 5F5WA 1OEDB 4ZJTA 2ODVA 3UTKA 2JJ9A 1HR0T 2ZM2A 3RX6A 2JQQA 2YU2A 2XZEA 3J9X1 4ZZCA 1S94A 3QOFA 3KBUA 3JC6D 1YXRA 4IDZA 2WM9A 5LBQB 2EHOA 2YKSA 2BG9E 2YDSA 3C51A 5AQKB 2BG9A 2D9DA 4DR4T 1N32T 3ANWA 4UY2A 5L3EB 4ILUA 4H9SE 4UF0B 3AE6A 5AFLA 3QNUA 3JCFA 4BAYB 4HWDA 2XHEB 2K48A 1VRBA 1N34T 3Q9DA 1H7CA 3UQ4A 4HTEA 4U31A 2LSYA 3CWZB 4HWHA 3UT5E 2QGSA 4QWNB 1WR0A 4HFDA 4IL9A 5FL1A 2VWAA 4EZ4A 5FVLA 2V7IA 3KVAA 2WU2A 4ILCA 2W8FA 4NUUA 5FXVA 1M7KA 3UFGA 4JI8T 2XPKA 3KV4A 1XWMA 1T72A 2CXLA 3OYXA 2LEHA 2IAKA 3HA4A 4DV1T 2PFVA 3L39A 4I43B 5JR9B 4CQIA 2YMDA 1HX1B 2UXCT 3SQ9A 2QVAA 3KV9A 3ZEFB 4U2YA 2D5UA 2J4GA 5LYJE 2XTLA 2LRKA 2N9DA 3EI0A 4A56A 3AEFA 4WZXA 4TNWA 5FXWA 4EZ1A 2V6XA 4E7ZA 4GK5E 1W09A 2LHRA 4ZS3A 5LJNA 1HNWT 3ZC0A 3VHLA 3ZMZB 3WIPA 4TWHA 1HCIA 4XZCA 3NBXX 2K9AA 1WR6A 4I55E 2CWOA 4GYRA 1LKXA 3EABA 2BVMA 4LF4T 4TV9E 1ZKEA 5JDGA 2XQ9A 4MALA 2M6BA 3EAMA 5DJQC 2PG8A 3G06A 4KX6A 4DIDB 3ONXA 2FJDA 2VKOA 5FXXA 3N9MA 2F4VT 4PJNA 4JBWF 2WDRA 2YOEA 4L5GA 4DUYT 1QLBA 1VOMA 2NW7A 1CHUA 3FZMB 3SWHA 2ZM0A 3AE8A 3AXJA 4PJMA 5HEOA 5FL0A 2HH7A 4IGUA 1MMDA 1IJ5A 4A97A 4ZK1A 1XZYA 5L3FB 4DO0A 4UM3A 2YN6A 4DR1T 2FBWA 3OBVE 2I0MA 3LBXB 2CBJA 3RRWA 4I50E 3IHRA 2LOSA 5BRXA 1OWAA 3RGLA 4TNVA 1WFDA 2W62A 4K0UA 2KINB 4MFRA 3ZDGA 3UULA 3WAJA 5JDHA 1KNZA 2W8GA 3WTMA 4DR3T 4P0AA 4JI4T 5HWXA 1OXZA 4U72A 3A7MA 2MYSA 5L4HA 2BYSA 4JV5T 2BR7A 1I6ZA 1G73A 4U3CA 3OYZA 4YHJA 4YFSA 2E9XB 1XNQT 1MNDA 5JVDE 1E7PA 2IDOB 3AEAA 4HGAA 4YHHT 2NR4A 4ZI2C 4P09A 2W00A 2CLYB 4DBMA 4WV9A 2ZMAA 2VKHA 2NW9A 5A1LA 1SHZC 3RF1A 4CI1B 1MMAA 1KF6A 5EK2A 3JADA 5EK4A 1NWMX 3LJCA 3AE9A 1IAPA 5J2UE 2XSBA 5FY0A 2WSSV 3EVYA 1W9RA 3X1DA 2X9WA 1HNXT 3QUJA 2R6GF 3GUAA 5AQSB 2X0HA 2HHHT 4LFBT 1D0XA 1UW6A 1JNRA 3T1HT 3LK2B 4X1KE 3TLVA 3WTKA 5F3JA 3AE3A 2NOXA 4GKKT 2IIUA 4TN7B 4Z91A 4KMCA 4DBRA 5LNKA 2CRBA 4NIQA 4UM1A 4DR6T 5BMVE 3LSVA 3O1IA 3UU5A 4LF6T 5AQIB 4B5DA 2GK9A 5FNVE 2CA5A 3DJBA 2WNJA 3E22E 4QXHB 5J5IA 3ONLC 4G63A 1LRZA 1MNEA 2WWVA 1HX8A 3HI2A 4J2CA 3NRXA 2ZM6T 2ZJVA 3UQ7A 3TLTA 3IF8B 3ZC1A 2I59A 2M67A 2BYQA 4YT0A 3VU7H 2XQAA 2XY8B 1QSDA 3KINB 3O9XA 3AE4A 3NRYA 4UVCB 2KWIB 3B5MA 5AQPB 3SS1A 3V5UA 3P4QA 2W4XA 5GONE 2V6YA 3IBPA 3PUSA 4X20E 3AA0B 1HG2A 2LHNA 4IE7A 5AFJA 3VR8A 2X67A 2EHOB 2QC1B 3M3ZB 3O1HA 4EZHA 2XQ4A 3CQGB 2BG9B 3PJAJ 5LG3A 1MIWA 2JQHA 3O4XE 3ZJ2A 2AE9A 3FBLA 4JI6T 2E5LT 1YKHB 5HEGA 5AQJB 2X0LB 3UUXB 4JI0T 1SE7A 2HPJA 3N9NA 3ESLA 5HXEA 3T8OA 3K3NA 3AAEB 2Y6XA 5ABGA 4EEBA 5AQOB 3C84A 4HFHA 3CX8B 3HR0A 5AQNB 4XAXB 5LJMA 3AE2A 2RP4A 4FJOA 1IBKT 1VCSA 4Z8XA 4CXYA 3F2EA 1T98A 2UXBT 5CFBA 3CX6B 2CEAA 2A3DA 1HTJF 4LF8T 3HL6A 5L3CB 2XZ5A 4JI7T 2ACZA 3C79A 4IE0A 3CX7B 2J62A 2XQ3A 3WTNA 1UX2A 2WNCA 5AQVB 4DV3T 3MKDA 5HXHA 5JQGE 1CUNA 3OPCA 1KFYA 3QB5K 2LM2A 4JI3T 4AIUA 3DP7A 2CHNA 3N9LA 5LOVE 3AAAB 4AQYT 3PJAA 3GWHA 2DWGA 2VB6A 4PIRA 3S4UA 3FZFB 1IZNB 2XQ6A 4H9PC 4ZI3C 4NUVA 4X62T 5J1GA 3TLSA 2UUCT 5AFHA 1KEYA 1EZ3A 5BP0A 1VCTA 3ZYMA 2CE7A 4CN4A 5HYAA 1HFAA 5LG4A 4AKLA 2WNLA 2JQKA 5AQUB 3FXEB 4QHOA 1D1BA 1GQEA 3GN5A 4AQFC 5L2LA 4AKHA 3AXJB 4HEAA 5ABEA 4B6XA 3MZKB 4TWFA 5AQMB 2ZM8A 3UU6A 1YQ3A 3NVOA 2CXFA 2DHRA 3C98B 4WYVA 3AVSA 3UU3A 4P0BA 2KMFA 3PUGA 2L3LA 2A9UA 4ILBA 3RLFF 2WB5A 4CZZB 3BK9A 4GYSA 3RHWA 5IUXA 2I6HA 2V1DB 3J7Yq 4O2AE 2W61A 2D2SA 4QH1A 2QYWA 4EYUA 3BQLA 4ZXLA 2WCAA 4BQTA 4WNKA 3PUWF 5JDQA 2WWUA 1BR1A 4L9IA 4OX9T 1D1AA 2VQET 3AB3B 2G0UA 4LFAT 3P4PA 4MHCA 4A98A 4WW0A 2ZLYA 5AFNA 1NENA 2MTQA 4B3RT 4DBQA 4AFGA 1OEDC 2ES0A 4XHEA 3L3PA 4OYJA 2XJ7A 2EHOD 2PH9A 1FMWA 5LHIB 2IW5B 4GOUA 2B76A 4V1Av 4AQFA 2HN1A 4DV0T 3HKEE 5FYMA 2WU5A 4PAGA 2PBIA 2FJEA 3L09A 3UUMA 2LKGA 4ADZA 5FY7A 2MPKA 3QC9A 5L47A 4ZOLE 1E2AA 2Y8DA 2CXDA 4ZR6A 1HNZT 2L8KA 2XAHB 1UURA 3ZT7A 3ZCJA 5AFKA 2XYTA 5HAXA 5AFMA 4AXPA 3FB2A 2D0TA 4ISTA 4JI1T 3ZCIA 3PDYA 5ABFA 3VR9A 5IWAT 3I9YA 2E2AA 2CCQA 3C64A 1BR0A 3ZYKA 4I0UA 2V7MA 3RC8A 5H6QB 2D0UA 2OA5A 4PK6A 3RIAA 4LMLA 4HN9A 1OEDE 4JEUB 5JTGA 4CN6A 1OEDA 2AXDS 5EK3A 3A5XA 3ZT6A 2JRKA 5L3GB 3IEEA 2CMRA 4X64T 3BQIA 3AEBA 5C8YE 3H37A 2BYNA 4TUYE 2V7KA 1UK5A 2BYRA 2Y7YA 3QK6A 3JAEA 1J5WA 4IDNA 5LP6E 3Q2MA 2WZYA 4BJNA 5LXTE 2XQYA 2YDRA 3U8MA 2KLQA 3CIRA 2NTYA 3GA8A 2WP9A 2XUEA 4ERRA 3NZPA 4B3ST 3IGQA 4JUYA 1HS7A 4LFCT 2V6YB 3OKQA 1X79A 4AFHA 3N2KE 3PUXF 5JMEA 3RRCA 2LT3A 1T8BA 3SFDA 5L3BB 3A8YC 3AEEA 1ZP0A 2WZIA 4TV8E 4IDOA 4EAHA 4HWCA 3ZLIA 4UEMA 2YEVC 4GK0E 3AECA 5JREA 4NPPA 3Q5XA 1US7B 5KMGP 1HF8A 2L9QA 3NKZA 3R6NA 4JYAT 2Q9QC 4N78D 3U78A 1D0YA 4Q25A 5LBMA 5AFUL 3ZMUB 3I0QA 5E0OA 3K8PC 2BKNA 5C3JA 3FZLB 4IL4A 4ZEYA 3CQCB
chains in the Genus database with same CATH topology
4QACA 3EHZA 5HEJA 2Y56A 2VL0A 3TLSA 3TLVA 4TWHA 3WIPA 3WTIA 4AFGA 1OEDC 5HEHA 5AFHA 3WTKA 4ILAA 2C9TA 4QAAA 4XHEA 3SH1A 4COFA 5BP0A 4ZK4A 4HFEA 5FJVA 3ZDGA 3WTLA 3RQWA 2XNUA 2XQ7A 4LMKA 2BYNA 4ZZCA 4BFQA 2BYRA 4HFIA 4X5TA 4Z91A 4IREA 5HEGA 2UZ6A 4QH5A 2PH9A 2Y7YA 5HCMA 4ZJSA 2W8GA 2YKSA 3JAEA 2WNLA 2XNTA 2BG9E 2Y57A 3WTMA 2XNVA 4UM1A 5J5FA 5LXBA 3U8JA 5AINA 3P50A 3WTHA 2BG9A 3LSVA 2XQ9A 2BJ0A 3UU5A 4UY2A 2WZYA 2M6BA 5AFMB 3EAMA 3U8MA 1UV6A 4AFTA 3ZDHA 5AFLA 3TLUA 1I9BA 4B5DA 2BR8A 2WNJA 2BG9C 4UM3P 2M6IA 5L4HA 4TWFA 3C84A 2KSRA 4HFHA 5HEUA 2BYSA 2LKGA 2WN9A 2XYSA 3T4MA 3UU6A 2BR7A 3WTOA 2BYPA 4QH4A 2LLYA 3UQ4A 3WTJA 5J5IA 3IGQA 5L47A 3U8KA 2XQ5A 3UU3A 3RI5A 4AFHA 4HFDA 4IL9A 4ZR6A 5JMEA 4HQPA 2YOEA 2ZJVA 3UQ7A 4ILBA 4LMJA 3TLTA 4DBMA 5AFKA 2XYTA 5AFMA 4ILCA 3UUBA 2W8FA 4FRRA 4WV9A 4F8HA 5CFBA 3RQUA 4NZBA 2BYQA 2XQAA 3RHWA 2MAWA 5IUXA 5CO5A 3JAFA 3P4WA 5HEOA 3JADA 3SIOA 2Y58A 3U8LA 3TLWA 4QH1A 2XZ5A 2Y54A 2ZJUA 4ZZBA 4A97A 5HCJA 3C79A 4NPPA 2LKHA 2X00D 4XK9A 4HFBA 4ZK1A 5BW2A 5SYOA 3UU8A 3SQ6A 5J0ZA 4UM3A 2XQ3A 2YN6A 3WTNA 1UX2A 2WNCA 4QABA 4BQTA 2X00A 2YMDA 3SQ9A 3U8NA 5J5HA 3PEOA 2LM2A 3UU4A 3PMZA 2XZ6A 4UXUA 4ALXA 4HFCA 4UM3S 3EI0A 5KE4A 5AFJA 2XQ8A 5J5GA 4TNWA 4Z90A 2QC1B 3RIAA 4LMLA 3GUAA 2XQ4A 5KZUA 4EZ1A 3ZKRA 2PGZA 4D01A 2BG9B 1OEDE 1OEDB 5LG3A 4ZRUA 4ZJTA 5BRXA 3RIFA 4PIRA 4A98A 1OEDA 1UW6A 4IL4A 5AFNA 2XQ6A 5TVCA 4TNVA 4TWDA 5L4EA 2YMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAC A;  3EHZ A;  5HEJ A;  2Y56 A;  2VL0 A;  3TLS A;  3TLV A;  4TWH A;  3WIP A;  3WTI A;  4AFG A;  1OED C;  5HEH A;  5AFH A;  3WTK A;  4ILA A;  2C9T A;  4QAA A;  4XHE A;  3SH1 A;  4COF A;  5BP0 A;  4ZK4 A;  4HFE A;  5FJV A;  3ZDG A;  3WTL A;  3RQW A;  2XNU A;  2XQ7 A;  4LMK A;  2BYN A;  4ZZC A;  4BFQ A;  2BYR A;  4HFI A;  4X5T A;  4Z91 A;  4IRE A;  5HEG A;  2UZ6 A;  4QH5 A;  2PH9 A;  2Y7Y A;  5HCM A;  4ZJS A;  2W8G A;  2YKS A;  3JAE A;  2WNL A;  2XNT A;  2BG9 E;  2Y57 A;  3WTM A;  2XNV A;  4UM1 A;  5J5F A;  5LXB A;  3U8J A;  5AIN A;  3P50 A;  3WTH A;  2BG9 A;  3LSV A;  2XQ9 A;  2BJ0 A;  3UU5 A;  4UY2 A;  2WZY A;  2M6B A;  5AFM B;  3EAM A;  3U8M A;  1UV6 A;  4AFT A;  3ZDH A;  5AFL A;  3TLU A;  1I9B A;  4B5D A;  2BR8 A;  2WNJ A;  2BG9 C;  4UM3 P;  2M6I A;  5L4H A;  4TWF A;  3C84 A;  2KSR A;  4HFH A;  5HEU A;  2BYS A;  2LKG A;  2WN9 A;  2XYS A;  3T4M A;  3UU6 A;  2BR7 A;  3WTO A;  2BYP A;  4QH4 A;  2LLY A;  3UQ4 A;  3WTJ A;  5J5I A;  3IGQ A;  5L47 A;  3U8K A;  2XQ5 A;  3UU3 A;  3RI5 A;  4AFH A;  4HFD A;  4IL9 A;  4ZR6 A;  5JME A;  4HQP A;  2YOE A;  2ZJV A;  3UQ7 A;  4ILB A;  4LMJ A;  3TLT A;  4DBM A;  5AFK A;  2XYT A;  5AFM A;  4ILC A;  3UUB A;  2W8F A;  4FRR A;  4WV9 A;  4F8H A;  5CFB A;  3RQU A;  4NZB A;  2BYQ A;  2XQA A;  3RHW A;  2MAW A;  5IUX A;  5CO5 A;  3JAF A;  3P4W A;  5HEO A;  3JAD A;  3SIO A;  2Y58 A;  3U8L A;  3TLW A;  4QH1 A;  2XZ5 A;  2Y54 A;  2ZJU A;  4ZZB A;  4A97 A;  5HCJ A;  3C79 A;  4NPP A;  2LKH A;  2X00 D;  4XK9 A;  4HFB A;  4ZK1 A;  5BW2 A;  5SYO A;  3UU8 A;  3SQ6 A;  5J0Z A;  4UM3 A;  2XQ3 A;  2YN6 A;  3WTN A;  1UX2 A;  2WNC A;  4QAB A;  4BQT A;  2X00 A;  2YMD A;  3SQ9 A;  3U8N A;  5J5H A;  3PEO A;  2LM2 A;  3UU4 A;  3PMZ A;  2XZ6 A;  4UXU A;  4ALX A;  4HFC A;  4UM3 S;  3EI0 A;  5KE4 A;  5AFJ A;  2XQ8 A;  5J5G A;  4TNW A;  4Z90 A;  2QC1 B;  3RIA A;  4LML A;  3GUA A;  2XQ4 A;  5KZU A;  4EZ1 A;  3ZKR A;  2PGZ A;  4D01 A;  2BG9 B;  1OED E;  1OED B;  5LG3 A;  4ZRU A;  4ZJT A;  5BRX A;  3RIF A;  4PIR A;  4A98 A;  1OED A;  1UW6 A;  4IL4 A;  5AFN A;  2XQ6 A;  5TVC A;  4TNV A;  4TWD A;  5L4E A;  2YME A; 
#chains in the Genus database with same CATH topology
 2BDE A;  1MMN A;  5J5F A;  3EDU A;  2YDQ A;  4ILA A;  3ABV A;  3RYH E;  1Z8U A;  3WTL A;  3VKG A;  1SUM B;  5LMU T;  5HCM A;  2C5J A;  1KK7 A;  3E0Z A;  4YSZ A;  3K1S A;  2V8S V;  4NXN T;  2KWH A;  5FP3 A;  4QXB B;  4HWI B;  3PUA A;  3W15 B;  3KVB A;  4KHP T;  2W67 A;  4HFV A;  3T4M A;  2BYP A;  1ZEE A;  4IDQ A;  3ETV A;  2KT9 A;  2XQ5 A;  3I0O A;  2BBJ A;  1D0Z A;  2DI4 A;  2OV9 A;  5KXJ A;  4F8H A;  3RQU A;  4EV6 A;  3LG7 A;  2IHR 1;  3P4W A;  1O3X A;  4DV6 T;  3EUH A;  2N1G A;  4PK5 A;  2Q9Q A;  2V26 A;  4AKI A;  3UU8 A;  4YSY A;  4YJ3 E;  5DAB A;  2X00 A;  1E1H B;  2CHO A;  2XAF B;  3P8C D;  5DQV A;  2MOZ A;  1BR4 A;  5LB7 B;  5CA0 E;  4P1N A;  2VL8 A;  4YSX A;  4WBN E;  3PE0 A;  4ISS A;  3GN5 B;  4O4J E;  2UXD T;  5FY1 A;  2WMN A;  3WTI A;  2C9T A;  4OHF A;  4ZK4 A;  1UCU A;  3P4R A;  5FVK A;  4E7S A;  2X0Y A;  2C0S A;  2JMH A;  3L8R A;  4U33 A;  3ANW B;  5IYZ E;  4UIG A;  3WTH A;  3CKD A;  3Q5E A;  4B3T T;  1I9B A;  1HG5 A;  2FJB A;  4ZI2 D;  3LDQ B;  3CK6 A;  1W0A A;  2XYS A;  2Q9Q D;  4QH4 A;  2LLY A;  3DTO A;  4MBQ A;  3ZST A;  1FIO A;  2FUP A;  3FZH B;  5J2T E;  2V7J A;  1J5E T;  2HN2 A;  3ZT5 A;  2K5B B;  3KDS E;  3T1Y T;  4OK0 A;  3WI3 A;  2V5D A;  3WAK A;  4AIS A;  4CXW A;  3KFW X;  4DMV A;  2LSJ A;  2KZ7 B;  5AQQ B;  3AEG A;  4ANJ A;  4HFC A;  3CVR A;  3CML A;  4NXM T;  5J5G A;  4BA9 A;  4HKA A;  4HE8 A;  3I1A A;  3UFE A;  4JI2 T;  4JEH B;  4DV5 T;  3MK7 C;  1XDP A;  2JIW A;  1MIV A;  3ZJ1 A;  5CGM A;  4U74 A;  2QA7 A;  5LGU B;  2YME A;  5JDF A;  2Y56 A;  1S35 A;  3EDV A;  1NEK A;  1XMO T;  3SH1 A;  1KNP A;  2XNU A;  2XQ7 A;  4GIW A;  3B13 A;  1YW0 A;  2CWY A;  3M65 A;  3N5L A;  4ZJS A;  1XNR T;  1U5P A;  2J1D G;  2BJ0 A;  5AFM B;  1UV6 A;  5H6R B;  4DR2 T;  3TLU A;  4IE5 A;  2DNX A;  2BKO A;  2ODU A;  2OLT A;  3PV0 F;  4H9N C;  3AE5 A;  1QUU A;  4M1P A;  5ABF B;  2NWB A;  1D1C A;  5HXR A;  3F57 A;  5LHH B;  5ADX L;  3VRA A;  4UV9 B;  4LF9 T;  2K3W A;  2BS2 A;  4NZB A;  4PNI A;  4I4T E;  4IHJ E;  5LCY A;  1LVK A;  2LOP A;  3JAF A;  3NZQ A;  4TZ4 C;  5LA6 E;  4KUM B;  5ETW A;  4XK9 A;  3C4W A;  4AKR B;  2CPT A;  2CM0 A;  1WLX A;  2H7V C;  4IIJ E;  4LF5 T;  3RIU C;  2JMK A;  1Y01 A;  4UXU A;  4KHZ F;  4UM3 S;  3LFM A;  4H9R C;  3OVU A;  3C4Z A;  3RH3 A;  3N2O A;  3AA6 B;  5L3D B;  3C4X A;  3PUZ F;  2PGZ A;  4D01 A;  4ZRU A;  5F8P A;  1B7T A;  3N9P A;  1L0V A;  4LF7 T;  2IC6 A;  2LM9 A;  2PJQ A;  1N36 T;  2X9H A;  3PU3 A;  4EOZ B;  2A2F X;  4LMK A;  3N2G E;  5CA1 E;  1Z0P A;  2SPC A;  5JDL A;  5LXB A;  2XNV A;  4EXT A;  4AKG A;  4QX7 B;  3CPZ A;  3SFE A;  3ZDH A;  3RPU A;  3RKO A;  2WMO A;  1UUS A;  4G2A A;  4YXD A;  2YU1 A;  2WN9 A;  5AQT B;  4O4I E;  2YIN A;  4DND A;  4X1I E;  4OFZ A;  1YQ4 A;  2VKJ A;  3D0T A;  2VKD A;  2IC9 A;  3RI5 A;  1UX4 A;  3V5S A;  2LE8 A;  4KP3 C;  4U7Y A;  3FHN A;  3ZMT B;  3HKB E;  2W2U A;  2VVS A;  4UVB B;  2E8I A;  2DWK A;  2W66 A;  1FJG T;  3SRZ A;  1V9D A;  5FXZ A;  4HWF A;  4U2Z A;  5HCJ A;  4O4L E;  3RIU A;  4MLK A;  2BZB A;  4QAB A;  3H3A A;  1FEW A;  2FJA A;  1XMQ T;  4AI6 A;  2XZ6 A;  4ZI3 D;  5IHY A;  3P7I A;  4JLE A;  5KZU A;  3FZK B;  2JQ9 A;  4CI3 B;  1YKE B;  5TVC A;  4TWD A;  3AED A;  5AQF B;  5JRC A;  3ETU A;  5C2T A;  2NW8 A;  4PJJ A;  3I9W A;  3RQW A;  5AQH B;  1Y64 B;  5LMN T;  4HFI A;  4X5T A;  5JR9 C;  2KXP B;  5CB4 E;  2UZ6 A;  4EB6 E;  4O4H E;  2Y57 A;  4DV4 T;  4ZHQ E;  5HXC A;  4AFT A;  3AA1 B;  3NWI A;  2M6I A;  2LSK A;  1WRD A;  2LSI A;  3N9Q A;  2XSA A;  3WTJ A;  2Q9Q B;  3HKD E;  2VQF T;  4YJ2 E;  1YD8 G;  4IE4 A;  4H63 H;  4DR5 T;  2BVL A;  3PTR B;  4OYK A;  4DVD A;  2Y48 B;  3AVR A;  4XBF B;  3ZPO A;  4ZS2 A;  2BS3 A;  4UF0 A;  2P9B A;  4ASK A;  2LSG A;  3SIO A;  3IA3 A;  4DV7 T;  4PJL A;  4UVA B;  2XAQ B;  4O2B E;  4ZZB A;  2C5K T;  2MBG A;  1X9B A;  3R84 B;  5HWY A;  4H9Q C;  4QXC B;  2LRL A;  2BBH A;  3UU4 A;  4ALX A;  3AE7 A;  4PFP A;  5KE4 A;  2WZH A;  5AQG B;  2DLR A;  2NP9 A;  2C5I T;  5KX5 E;  4C91 A;  4GKJ T;  3ZMV B;  4O8S A;  2W0G A;  1ZOY A;  4YY3 T;  5M4Y A;  4FI5 A;  5JR9 A;  1WCR A;  3LK3 B;  5HEH A;  1XDO A;  4COF A;  5FJV A;  3KBT A;  2WY2 A;  4IRE A;  2HPL A;  4A5X A;  4PFO A;  2VAS A;  4UV8 B;  4IDP A;  4IE6 A;  2WDQ A;  3AA7 B;  5DQW A;  2BR8 A;  3BQK A;  2W63 A;  2KSR A;  1N33 T;  3K3Q C;  3WTO A;  3C50 A;  5LGT B;  4KI0 F;  3TKL B;  3MAC A;  4C90 A;  4DV2 T;  4KBM B;  5KDM C;  4HQP A;  1ZHC A;  2BS4 A;  5AQR B;  3RYC E;  4YLH A;  2LJL A;  4FRR A;  2XAG B;  3P4S A;  3H3M A;  4CI2 B;  4YTN A;  2Y58 A;  3U8L A;  4YTP A;  4AQG A;  3TLW A;  2Y54 A;  3QB5 A;  1MIY A;  2LKH A;  5BW2 A;  5SYO A;  3SQ6 A;  5J0Z A;  1JNZ A;  2A72 A;  3HKC E;  5J5H A;  2E9X C;  2XQ8 A;  3RKG A;  2XM1 A;  4K0K T;  4CXX A;  3U3I A;  1W0B A;  2J47 A;  1IBM T;  3PUR A;  4DMW A;  1UGO A;  2CLY C;  4WBO A;  2CBI A;  4UR9 A;  5FKY A;  3MJX A;  4TX5 A;  2WQY A;  5L4E A;  1SA0 E;  3LBX A;  3E08 A;  4QAA A;  4HFE A;  2XAS B;  4BFQ A;  4PK4 A;  1DU2 A;  2RPA A;  1LVF A;  4QH5 A;  3U8J A;  5AIN A;  2WAU A;  3P50 A;  2QRX A;  4L0R A;  2K24 A;  2X51 A;  4X66 T;  3ZN1 B;  2XM2 A;  4X65 T;  1G8X A;  5HEU A;  3RC3 A;  2UUA T;  5CJ5 A;  3ZYL A;  3Q5D A;  2UUB T;  3OJA A;  1ZV4 X;  3U8K A;  2UXX B;  3F31 A;  5ABH A;  3ONJ A;  2NTX A;  1WYB A;  1U4Q A;  2Z6E A;  4LMJ A;  4X1Y E;  3FXD B;  3SOL A;  1WYC A;  4EIW A;  3JC6 C;  3GMI A;  3AE1 A;  2MAW A;  3Q5W A;  4CN1 A;  5JDN A;  4EYY R;  5LHG B;  4IT4 A;  2B1E A;  2DCF A;  2DL1 A;  2X00 D;  4HFB A;  1IJ6 A;  3RYF E;  2E9X A;  4H9O C;  2IUB A;  2N2N A;  4JI5 T;  1FMV A;  3PEO A;  1R8I A;  5TAO A;  1KNR A;  3PMZ A;  5JDM A;  2JPF A;  3AAI A;  2WBL A;  3VRB A;  3UUN A;  4Z90 A;  2WDV A;  3PUY F;  2X9X A;  3ZKR A;  4UEL A;  3ZMS B;  4PW8 A;  1M62 A;  2H88 A;  3RIF A;  3B57 A;  2X66 A;  5JH7 E;  4QAC A;  3EHZ A;  5HEJ A;  2VL0 A;  5AQL B;  1AJ3 A;  2BKP A;  4QKN A;  3MA9 A;  2H3R A;  2X9Y A;  2PTF A;  3VKH A;  2X68 A;  4EGW A;  4F6R C;  2XNT A;  4EED A;  2H89 A;  4DR7 T;  3MXZ A;  5HXS A;  2EHO C;  3CQX C;  3O1J A;  2BG9 C;  3FBZ A;  4UM3 P;  1I94 T;  1UX5 A;  2XAJ B;  2VUR A;  2WS3 A;  2E9X D;  2ACX A;  2IML A;  2VK9 A;  3ZSS A;  3KV6 A;  2KND A;  2RA1 A;  2V5C A;  2VVN A;  4H63 V;  1MMG A;  2E5V A;  1J1J A;  3PUV F;  3N9O A;  4B3M T;  4U7I A;  1NAF A;  3UUB A;  1T7S A;  5CO5 A;  4QX8 B;  3K3O A;  5LGN B;  2UXN B;  5EZY E;  4BJM A;  2UU9 T;  3OTO T;  3KV5 A;  3RYI E;  2ZJU A;  3PU8 A;  3ZN0 B;  4ZI7 E;  3LK4 2;  2H7O A;  2YK0 A;  4UXN B;  1BR2 A;  5JRC B;  2V7L A;  3PUQ A;  3U8N A;  1IBL T;  4YTM A;  5BR8 T;  5FMN A;  4DUZ T;  5F5W A;  1OED B;  4ZJT A;  2ODV A;  3UTK A;  2JJ9 A;  1HR0 T;  2ZM2 A;  3RX6 A;  2JQQ A;  2YU2 A;  2XZE A;  3J9X 1;  4ZZC A;  1S94 A;  3QOF A;  3KBU A;  3JC6 D;  1YXR A;  4IDZ A;  2WM9 A;  5LBQ B;  2EHO A;  2YKS A;  2BG9 E;  2YDS A;  3C51 A;  5AQK B;  2BG9 A;  2D9D A;  4DR4 T;  1N32 T;  3ANW A;  4UY2 A;  5L3E B;  4ILU A;  4H9S E;  4UF0 B;  3AE6 A;  5AFL A;  3QNU A;  3JCF A;  4BAY B;  4HWD A;  2XHE B;  2K48 A;  1VRB A;  1N34 T;  3Q9D A;  1H7C A;  3UQ4 A;  4HTE A;  4U31 A;  2LSY A;  3CWZ B;  4HWH A;  3UT5 E;  2QGS A;  4QWN B;  1WR0 A;  4HFD A;  4IL9 A;  5FL1 A;  2VWA A;  4EZ4 A;  5FVL A;  2V7I A;  3KVA A;  2WU2 A;  4ILC A;  2W8F A;  4NUU A;  5FXV A;  1M7K A;  3UFG A;  4JI8 T;  2XPK A;  3KV4 A;  1XWM A;  1T72 A;  2CXL A;  3OYX A;  2LEH A;  2IAK A;  3HA4 A;  4DV1 T;  2PFV A;  3L39 A;  4I43 B;  5JR9 B;  4CQI A;  2YMD A;  1HX1 B;  2UXC T;  3SQ9 A;  2QVA A;  3KV9 A;  3ZEF B;  4U2Y A;  2D5U A;  2J4G A;  5LYJ E;  2XTL A;  2LRK A;  2N9D A;  3EI0 A;  4A56 A;  3AEF A;  4WZX A;  4TNW A;  5FXW A;  4EZ1 A;  2V6X A;  4E7Z A;  4GK5 E;  1W09 A;  2LHR A;  4ZS3 A;  5LJN A;  1HNW T;  3ZC0 A;  3VHL A;  3ZMZ B;  3WIP A;  4TWH A;  1HCI A;  4XZC A;  3NBX X;  2K9A A;  1WR6 A;  4I55 E;  2CWO A;  4GYR A;  1LKX A;  3EAB A;  2BVM A;  4LF4 T;  4TV9 E;  1ZKE A;  5JDG A;  2XQ9 A;  4MAL A;  2M6B A;  3EAM A;  5DJQ C;  2PG8 A;  3G06 A;  4KX6 A;  4DID B;  3ONX A;  2FJD A;  2VKO A;  5FXX A;  3N9M A;  2F4V T;  4PJN A;  4JBW F;  2WDR A;  2YOE A;  4L5G A;  4DUY T;  1QLB A;  1VOM A;  2NW7 A;  1CHU A;  3FZM B;  3SWH A;  2ZM0 A;  3AE8 A;  3AXJ A;  4PJM A;  5HEO A;  5FL0 A;  2HH7 A;  4IGU A;  1MMD A;  1IJ5 A;  4A97 A;  4ZK1 A;  1XZY A;  5L3F B;  4DO0 A;  4UM3 A;  2YN6 A;  4DR1 T;  2FBW A;  3OBV E;  2I0M A;  3LBX B;  2CBJ A;  3RRW A;  4I50 E;  3IHR A;  2LOS A;  5BRX A;  1OWA A;  3RGL A;  4TNV A;  1WFD A;  2W62 A;  4K0U A;  2KIN B;  4MFR A;  3ZDG A;  3UUL A;  3WAJ A;  5JDH A;  1KNZ A;  2W8G A;  3WTM A;  4DR3 T;  4P0A A;  4JI4 T;  5HWX A;  1OXZ A;  4U72 A;  3A7M A;  2MYS A;  5L4H A;  2BYS A;  4JV5 T;  2BR7 A;  1I6Z A;  1G73 A;  4U3C A;  3OYZ A;  4YHJ A;  4YFS A;  2E9X B;  1XNQ T;  1MND A;  5JVD E;  1E7P A;  2IDO B;  3AEA A;  4HGA A;  4YHH T;  2NR4 A;  4ZI2 C;  4P09 A;  2W00 A;  2CLY B;  4DBM A;  4WV9 A;  2ZMA A;  2VKH A;  2NW9 A;  5A1L A;  1SHZ C;  3RF1 A;  4CI1 B;  1MMA A;  1KF6 A;  5EK2 A;  3JAD A;  5EK4 A;  1NWM X;  3LJC A;  3AE9 A;  1IAP A;  5J2U E;  2XSB A;  5FY0 A;  2WSS V;  3EVY A;  1W9R A;  3X1D A;  2X9W A;  1HNX T;  3QUJ A;  2R6G F;  3GUA A;  5AQS B;  2X0H A;  2HHH T;  4LFB T;  1D0X A;  1UW6 A;  1JNR A;  3T1H T;  3LK2 B;  4X1K E;  3TLV A;  3WTK A;  5F3J A;  3AE3 A;  2NOX A;  4GKK T;  2IIU A;  4TN7 B;  4Z91 A;  4KMC A;  4DBR A;  5LNK A;  2CRB A;  4NIQ A;  4UM1 A;  4DR6 T;  5BMV E;  3LSV A;  3O1I A;  3UU5 A;  4LF6 T;  5AQI B;  4B5D A;  2GK9 A;  5FNV E;  2CA5 A;  3DJB A;  2WNJ A;  3E22 E;  4QXH B;  5J5I A;  3ONL C;  4G63 A;  1LRZ A;  1MNE A;  2WWV A;  1HX8 A;  3HI2 A;  4J2C A;  3NRX A;  2ZM6 T;  2ZJV A;  3UQ7 A;  3TLT A;  3IF8 B;  3ZC1 A;  2I59 A;  2M67 A;  2BYQ A;  4YT0 A;  3VU7 H;  2XQA A;  2XY8 B;  1QSD A;  3KIN B;  3O9X A;  3AE4 A;  3NRY A;  4UVC B;  2KWI B;  3B5M A;  5AQP B;  3SS1 A;  3V5U A;  3P4Q A;  2W4X A;  5GON E;  2V6Y A;  3IBP A;  3PUS A;  4X20 E;  3AA0 B;  1HG2 A;  2LHN A;  4IE7 A;  5AFJ A;  3VR8 A;  2X67 A;  2EHO B;  2QC1 B;  3M3Z B;  3O1H A;  4EZH A;  2XQ4 A;  3CQG B;  2BG9 B;  3PJA J;  5LG3 A;  1MIW A;  2JQH A;  3O4X E;  3ZJ2 A;  2AE9 A;  3FBL A;  4JI6 T;  2E5L T;  1YKH B;  5HEG A;  5AQJ B;  2X0L B;  3UUX B;  4JI0 T;  1SE7 A;  2HPJ A;  3N9N A;  3ESL A;  5HXE A;  3T8O A;  3K3N A;  3AAE B;  2Y6X A;  5ABG A;  4EEB A;  5AQO B;  3C84 A;  4HFH A;  3CX8 B;  3HR0 A;  5AQN B;  4XAX B;  5LJM A;  3AE2 A;  2RP4 A;  4FJO A;  1IBK T;  1VCS A;  4Z8X A;  4CXY A;  3F2E A;  1T98 A;  2UXB T;  5CFB A;  3CX6 B;  2CEA A;  2A3D A;  1HTJ F;  4LF8 T;  3HL6 A;  5L3C B;  2XZ5 A;  4JI7 T;  2ACZ A;  3C79 A;  4IE0 A;  3CX7 B;  2J62 A;  2XQ3 A;  3WTN A;  1UX2 A;  2WNC A;  5AQV B;  4DV3 T;  3MKD A;  5HXH A;  5JQG E;  1CUN A;  3OPC A;  1KFY A;  3QB5 K;  2LM2 A;  4JI3 T;  4AIU A;  3DP7 A;  2CHN A;  3N9L A;  5LOV E;  3AAA B;  4AQY T;  3PJA A;  3GWH A;  2DWG A;  2VB6 A;  4PIR A;  3S4U A;  3FZF B;  1IZN B;  2XQ6 A;  4H9P C;  4ZI3 C;  4NUV A;  4X62 T;  5J1G A;  3TLS A;  2UUC T;  5AFH A;  1KEY A;  1EZ3 A;  5BP0 A;  1VCT A;  3ZYM A;  2CE7 A;  4CN4 A;  5HYA A;  1HFA A;  5LG4 A;  4AKL A;  2WNL A;  2JQK A;  5AQU B;  3FXE B;  4QHO A;  1D1B A;  1GQE A;  3GN5 A;  4AQF C;  5L2L A;  4AKH A;  3AXJ B;  4HEA A;  5ABE A;  4B6X A;  3MZK B;  4TWF A;  5AQM B;  2ZM8 A;  3UU6 A;  1YQ3 A;  3NVO A;  2CXF A;  2DHR A;  3C98 B;  4WYV A;  3AVS A;  3UU3 A;  4P0B A;  2KMF A;  3PUG A;  2L3L A;  2A9U A;  4ILB A;  3RLF F;  2WB5 A;  4CZZ B;  3BK9 A;  4GYS A;  3RHW A;  5IUX A;  2I6H A;  2V1D B;  3J7Y q;  4O2A E;  2W61 A;  2D2S A;  4QH1 A;  2QYW A;  4EYU A;  3BQL A;  4ZXL A;  2WCA A;  4BQT A;  4WNK A;  3PUW F;  5JDQ A;  2WWU A;  1BR1 A;  4L9I A;  4OX9 T;  1D1A A;  2VQE T;  3AB3 B;  2G0U A;  4LFA T;  3P4P A;  4MHC A;  4A98 A;  4WW0 A;  2ZLY A;  5AFN A;  1NEN A;  2MTQ A;  4B3R T;  4DBQ A;  4AFG A;  1OED C;  2ES0 A;  4XHE A;  3L3P A;  4OYJ A;  2XJ7 A;  2EHO D;  2PH9 A;  1FMW A;  5LHI B;  2IW5 B;  4GOU A;  2B76 A;  4V1A v;  4AQF A;  2HN1 A;  4DV0 T;  3HKE E;  5FYM A;  2WU5 A;  4PAG A;  2PBI A;  2FJE A;  3L09 A;  3UUM A;  2LKG A;  4ADZ A;  5FY7 A;  2MPK A;  3QC9 A;  5L47 A;  4ZOL E;  1E2A A;  2Y8D A;  2CXD A;  4ZR6 A;  1HNZ T;  2L8K A;  2XAH B;  1UUR A;  3ZT7 A;  3ZCJ A;  5AFK A;  2XYT A;  5HAX A;  5AFM A;  4AXP A;  3FB2 A;  2D0T A;  4IST A;  4JI1 T;  3ZCI A;  3PDY A;  5ABF A;  3VR9 A;  5IWA T;  3I9Y A;  2E2A A;  2CCQ A;  3C64 A;  1BR0 A;  3ZYK A;  4I0U A;  2V7M A;  3RC8 A;  5H6Q B;  2D0U A;  2OA5 A;  4PK6 A;  3RIA A;  4LML A;  4HN9 A;  1OED E;  4JEU B;  5JTG A;  4CN6 A;  1OED A;  2AXD S;  5EK3 A;  3A5X A;  3ZT6 A;  2JRK A;  5L3G B;  3IEE A;  2CMR A;  4X64 T;  3BQI A;  3AEB A;  5C8Y E;  3H37 A;  2BYN A;  4TUY E;  2V7K A;  1UK5 A;  2BYR A;  2Y7Y A;  3QK6 A;  3JAE A;  1J5W A;  4IDN A;  5LP6 E;  3Q2M A;  2WZY A;  4BJN A;  5LXT E;  2XQY A;  2YDR A;  3U8M A;  2KLQ A;  3CIR A;  2NTY A;  3GA8 A;  2WP9 A;  2XUE A;  4ERR A;  3NZP A;  4B3S T;  3IGQ A;  4JUY A;  1HS7 A;  4LFC T;  2V6Y B;  3OKQ A;  1X79 A;  4AFH A;  3N2K E;  3PUX F;  5JME A;  3RRC A;  2LT3 A;  1T8B A;  3SFD A;  5L3B B;  3A8Y C;  3AEE A;  1ZP0 A;  2WZI A;  4TV8 E;  4IDO A;  4EAH A;  4HWC A;  3ZLI A;  4UEM A;  2YEV C;  4GK0 E;  3AEC A;  5JRE A;  4NPP A;  3Q5X A;  1US7 B;  5KMG P;  1HF8 A;  2L9Q A;  3NKZ A;  3R6N A;  4JYA T;  2Q9Q C;  4N78 D;  3U78 A;  1D0Y A;  4Q25 A;  5LBM A;  5AFU L;  3ZMU B;  3I0Q A;  5E0O A;  3K8P C;  2BKN A;  5C3J A;  3FZL B;  4IL4 A;  4ZEY A;  3CQC B; 
#chains in the Genus database with same CATH homology
 4QAC A;  3EHZ A;  5HEJ A;  2Y56 A;  2VL0 A;  3TLS A;  3TLV A;  4TWH A;  3WIP A;  3WTI A;  4AFG A;  1OED C;  5HEH A;  5AFH A;  3WTK A;  4ILA A;  2C9T A;  4QAA A;  4XHE A;  3SH1 A;  4COF A;  5BP0 A;  4ZK4 A;  4HFE A;  5FJV A;  3ZDG A;  3WTL A;  3RQW A;  2XNU A;  2XQ7 A;  4LMK A;  2BYN A;  4ZZC A;  4BFQ A;  2BYR A;  4HFI A;  4X5T A;  4Z91 A;  4IRE A;  5HEG A;  2UZ6 A;  4QH5 A;  2PH9 A;  2Y7Y A;  5HCM A;  4ZJS A;  2W8G A;  2YKS A;  3JAE A;  2WNL A;  2XNT A;  2BG9 E;  2Y57 A;  3WTM A;  2XNV A;  4UM1 A;  5J5F A;  5LXB A;  3U8J A;  5AIN A;  3P50 A;  3WTH A;  2BG9 A;  3LSV A;  2XQ9 A;  2BJ0 A;  3UU5 A;  4UY2 A;  2WZY A;  2M6B A;  5AFM B;  3EAM A;  3U8M A;  1UV6 A;  4AFT A;  3ZDH A;  5AFL A;  3TLU A;  1I9B A;  4B5D A;  2BR8 A;  2WNJ A;  2BG9 C;  4UM3 P;  2M6I A;  5L4H A;  4TWF A;  3C84 A;  2KSR A;  4HFH A;  5HEU A;  2BYS A;  2LKG A;  2WN9 A;  2XYS A;  3T4M A;  3UU6 A;  2BR7 A;  3WTO A;  2BYP A;  4QH4 A;  2LLY A;  3UQ4 A;  3WTJ A;  5J5I A;  3IGQ A;  5L47 A;  3U8K A;  2XQ5 A;  3UU3 A;  3RI5 A;  4AFH A;  4HFD A;  4IL9 A;  4ZR6 A;  5JME A;  4HQP A;  2YOE A;  2ZJV A;  3UQ7 A;  4ILB A;  4LMJ A;  3TLT A;  4DBM A;  5AFK A;  2XYT A;  5AFM A;  4ILC A;  3UUB A;  2W8F A;  4FRR A;  4WV9 A;  4F8H A;  5CFB A;  3RQU A;  4NZB A;  2BYQ A;  2XQA A;  3RHW A;  2MAW A;  5IUX A;  5CO5 A;  3JAF A;  3P4W A;  5HEO A;  3JAD A;  3SIO A;  2Y58 A;  3U8L A;  3TLW A;  4QH1 A;  2XZ5 A;  2Y54 A;  2ZJU A;  4ZZB A;  4A97 A;  5HCJ A;  3C79 A;  4NPP A;  2LKH A;  2X00 D;  4XK9 A;  4HFB A;  4ZK1 A;  5BW2 A;  5SYO A;  3UU8 A;  3SQ6 A;  5J0Z A;  4UM3 A;  2XQ3 A;  2YN6 A;  3WTN A;  1UX2 A;  2WNC A;  4QAB A;  4BQT A;  2X00 A;  2YMD A;  3SQ9 A;  3U8N A;  5J5H A;  3PEO A;  2LM2 A;  3UU4 A;  3PMZ A;  2XZ6 A;  4UXU A;  4ALX A;  4HFC A;  4UM3 S;  3EI0 A;  5KE4 A;  5AFJ A;  2XQ8 A;  5J5G A;  4TNW A;  4Z90 A;  2QC1 B;  3RIA A;  4LML A;  3GUA A;  2XQ4 A;  5KZU A;  4EZ1 A;  3ZKR A;  2PGZ A;  4D01 A;  2BG9 B;  1OED E;  1OED B;  5LG3 A;  4ZRU A;  4ZJT A;  5BRX A;  3RIF A;  4PIR A;  4A98 A;  1OED A;  1UW6 A;  4IL4 A;  5AFN A;  2XQ6 A;  5TVC A;  4TNV A;  4TWD A;  5L4E A;  2YME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...