4ZZCA

The glic pentameric ligand-gated ion channel open form complexed to xenon
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural Basis for Xenon Inhibition in a Cationic Pentameric Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4zzcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zzcA01
3C79A 4ILAA 3T4MA 4LMJA 4QABA 5HCMA 2QC1B 5AFJA 2YMDA 2XNTA 2XZ6A 1UW6A 4AFHA 5J5IA 4HFDA 5J5FA 4A98A 2BR7A 2UZ6A 1UX2A 5HEOA 1OEDB 2YMEA 3SQ9A 3WIPA 4UXUA 5JMEA 4ZK4A 2W8FA 4UM1A 2Y58A 2XQ8A 4Z90A 2BG9A 2XNUA 3PMZA 4WV9A 3TLUA 4ZJTA 2WNLA 2ZJUA 4IL9A 2XQ5A 4AFGA 1OEDC 5AFMB 2WNCA 3RQWA 2XNVA 5HEGA 3EI0A 5AFLA 3ZDHA 3WTNA 3SIOA 2XYSA 5L47A 2M6IA 2XQ3A 4TWFA 4UM3A 5AFKA 4TWHA 4BQTA 3UU8A 3UU6A 5IUXA 2BYSA 2XQ7A 4ZZCA 4IREA 4AFTA 2Y7YA 3UQ7A 5HEHA 3U8LA 3WTOA 2Y54A 3ZDGA 3JADA 3UQ4A 3LSVA 4BFQA 2W8GA 3UU5A 5L4EA 3TLSA 2XQ9A 4HFBA 4NPPA 4ZJSA 4A97A 2BYQA 5BW2A 2WZYA 3WTKA 3U8KA 3IGQA 4QH5A 5CO5A 3UU3A 2LKHA 5LXBA 2LLYA 5FJVA 2PGZA 4HFEA 3EAMA 4QH1A 2C9TA 2X00A 3U8NA 3RIAA 3RQUA 3WTHA 3TLTA 4XK9A 2Y56A 4COFA 1UV6A 4HFIA 2XQAA 4Z91A 2KSRA 4ILCA 2XYTA 3U8MA 2Y57A 5AFHA 4B5DA 3TLVA 4F8HA 2YKSA 4HFHA 3EHZA 3U8JA 3JAEA 5LG3A 5J0ZA 2YOEA 2LM2A 4IL4A 3C84A 5AFMA 2XQ6A 3JAFA 4UY2A 1OEDE 4XHEA 3SQ6A 5KZUA 4FRRA 4HQPA 4ZK1A 2BG9B 3RIFA 4NZBA 5J5HA 4TNWA 3UUBA 4ZZBA 4LMKA 3RI5A 4ZRUA 5AFNA 2YN6A 4DBMA 4LMLA 2ZJVA 3UU4A 2BYPA 4ZR6A 4X5TA 2XZ5A 4PIRA 4ALXA 4TNVA 4QAAA 2BYNA 4EZ1A 4QACA 5J5GA 1OEDA 2WN9A 2BG9C 5TVCA 4D01A 3P50A 3RHWA 2XQ4A 3TLWA 2BR8A 3WTJA 5HCJA 5L4HA 5BP0A 5CFBA 2M6BA 4ILBA 3WTLA 2WNJA 4QH4A 3ZKRA 1I9BA 3SH1A 2LKGA 4HFCA 3GUAA 5HEJA 3PEOA 2PH9A 5HEUA 3P4WA 3WTMA 2VL0A 2BJ0A 4UM3S 5BRXA 3WTIA 4UM3P 5AINA 2BYRA 2X00D 2MAWA 5KE4A 5SYOA 4TWDA 2BG9E
chains in the Genus database with same CATH superfamily
4ILAA 2QA7A 2QC1B 1Z8UA 2CXLA 4UVBB 1KNPA 4H9NC 5F5WA 2UZ6A 3WIPA 2WZIA 3Q5DA 2KWHA 3AE7A 3ZSTA 5FXZA 5FXWA 3AB3B 3IA3A 4OX9T 3ZMVB 5LYJE 3FZMB 4KBMB 1N36T 5FVKA 4PJNA 3SWHA 1VOMA 5LNKA 5ABFB 4H9RC 2FJBA 2HH7A 2XYSA 1J5WA 2VB6A 2KZ7B 4UM3A 3P4SA 3UU8A 2CLYC 5LXTE 5HAXA 1S35A 1KF6A 2N1GA 1MMDA 3WTKA 3SRZA 5CA0E 4DMVA 4UIGA 3DJBA 2WWVA 1B7TA 2PG8A 3QNUA 2J47A 2Q9QB 4JEHB 3MJXA 4CI1B 1XMOT 3JC6D 5C3JA 2BBJA 2BYPA 2GK9A 2MTQA 1M62A 2XPKA 2BVMA 4CN6A 5J5GA 3ONJA 3M65A 2BG9C 3P50A 1Y01A 4DUZT 4YSZA 4HN9A 4TX5A 4TN7B 5HXRA 4K0KT 4AXPA 1FJGT 2X00D 4ERRA 3AE2A 4TWDA 1G73A 3D0TA 1US7B 3RF1A 4IIJE 2NTXA 4JI8T 3ZCIA 4YJ3E 2YU1A 1HTJF 4HEAA 1X79A 4HGAA 3FZKB 2WNCA 3P4PA 3CWZB 3ZC0A 3RYCE 3Q5EA 2FUPA 1IAPA 2M6IA 3UQ7A 3AXJB 2Y54A 3UQ4A 4X64T 3PUSA 2LT3A 2NW8A 2H3RA 3RQUA 3TLTA 5FKYA 2WSSV 3LDQB 2CCQA 2ZM8A 2VASA 3KV9A 4ISSA 4UY2A 4U2YA 2J4GA 4B3RT 1U5PA 5FVLA 5FP3A 1VCSA 4PK5A 5AQLB 4ZR6A 1NEKA 5AQMB 2EHOA 3RHWA 4E7SA 2BR8A 2LSGA 5JREA 2X67A 3NZQA 2XAGB 3O1IA 1IBMT 5FY0A 3J9X1 5A1LA 3OJAA 3I9YA 5DQWA 2H7VC 4AKHA 4UXNB 2XTLA 3A8YC 4QABA 2R6GF 3HR0A 2I6HA 2WP9A 2YDSA 3U78A 1UW6A 1VRBA 2W8FA 3FZLB 3P4QA 4H9OC 2BZBA 2LRKA 4KMCA 1FMWA 2VQFT 3OVUA 5L3EB 2AXDS 3AEDA 2LE8A 5HWXA 3N9LA 3SS1A 4G2AA 2MOZA 1UX4A 3CK6A 4BA9A 2CBIA 5L3DB 5JVDE 2BS3A 4TWFA 4HWCA 2XQ7A 1YW0A 4KHZF 3ZDGA 4X65T 3KINB 4NPPA 5LGNB 1CUNA 3PJAJ 3ETVA 2LLYA 1N33T 5LP6E 3PTRB 3ETUA 1Z0PA 3PU8A 3CX6B 2Y56A 3T8OA 3IF8B 4Z91A 3ZN0B 3E22E 3U8MA 2WY2A 2H89A 2PBIA 2UUBT 3JAEA 4LF5T 2WU2A 2XQ6A 4YSYA 5LCYA 3KBUA 4HQPA 3FXDB 3RIFA 3NZPA 3Q2MA 1CHUA 3AAAB 2CHOA 3N9NA 4DV4T 3G06A 5CA1E 3AEAA 5LHIB 2NP9A 1WLXA 4DV0T 4JLEA 4EAHA 1VCTA 4QH4A 1I9BA 3L8RA 4MALA 4UF0A 2PH9A 3WTMA 5L2LA 3ZYLA 4CXWA 2LOSA 3O1JA 3EABA 2H7OA 2JQKA 2UUAT 3O4XE 2YMEA 2Y58A 1HG5A 4AKRB 3CMLA 2D5UA 2MYSA 5AFMB 3QB5A 2CLYB 5AQHB 1WYBA 4YSXA 4PFOA 3C4ZA 2BKPA 2DCFA 1YQ3A 4GYSA 1XDOA 4IGUA 2VVNA 4A5XA 4BQTA 2BYSA 5JRCA 1G8XA 3OPCA 3AE9A 4IE4A 5H6QB 3EUHA 5FJVA 4A56A 2J1DG 4LF6T 2C9TA 5E0OA 1LRZA 2WU5A 4AQYT 1UV6A 5IWAT 3EHZA 4JBWF 1D1CA 1ZEEA 1OEDE 2BG9B 3DP7A 5J5HA 1WR0A 3OKQA 4LMLA 2UXXB 5HWYA 2Y8DA 4NXNT 1OWAA 3HKDE 4XBFB 2W0GA 2WQYA 4CQIA 5L3BB 3RYFE 3GUAA 4AQFA 5J1GA 5AQVB 4WZXA 2BJ0A 3J7Yq 5BRXA 5LOVE 2IAKA 4QKNA 2CMRA 3ZC1A 3ZJ1A 4MLKA 1LVFA 4BJMA 3DTOA 1MNEA 3MK7C 4JI7T 2LSKA 2VK9A 3TLUA 4PFPA 3ZMZB 3H3MA 4FI5A 1OEDC 5AQQB 5JDFA 3Q9DA 1NENA 3KFWX 3RYHE 1D0XA 2D2SA 4HWIB 5IUXA 4AFTA 4IT4A 3MZKB 4HKAA 4BFQA 3VHLA 1HS7A 5LXBA 3SFEA 4LFBT 2EHOC 5J2TE 1FIOA 3MXZA 3OTOT 5CJ5A 2CWYA 2VL8A 2LM9A 2JQHA 2CEAA 2XQAA 4DO0A 4QX7B 1X9BA 4IDQA 1IBKT 2Y57A 5JDQA 3U8JA 2SPCA 4YT0A 2YOEA 2XHEB 3K3QC 2A2FX 2BVLA 2KT9A 4LMKA 5EK4A 2MBGA 5AQRB 4JI2T 1ZKEA 3PU3A 4TNVA 2X68A 1JNRA 5L3GB 3ZCJA 2W67A 4YTNA 2J62A 3F31A 3AA7B 3SH1A 2ODVA 2Z6EA 4ISTA 2X0YA 5JQGE 1W0BA 1I94T 3AA6B 3AE3A 3PV0F 2KWIB 4MFRA 3O9XA 3SQ9A 4U33A 5FNVE 4KHPT 3C51A 4ZXLA 2F4VT 2CWOA 2K5BB 2V5CA 2UXBT 3RQWA 4TV8E 3SIOA 2XQ3A 3K1SA 2Y7YA 1D1BA 2E5VA 3NRXA 2BYQA 5BW2A 4PK6A 2LSJA 3LFMA 5CO5A 4YFSA 3SOLA 4UV8B 5IHYA 4U74A 1XZYA 4DBQA 2OLTA 1HNZT 4WBNE 4F6RC 4F8HA 2X9HA 2XUEA 1HNXT 4IL4A 3LK3B 3JAFA 5HXSA 2BDEA 4ZK1A 4ZS2A 5LB7B 2E2AA 2YK0A 5F8PA 3PURA 4AQGA 2XSAA 5AQNB 2V7JA 4JI4T 4DUYT 1S94A 3BK9A 3AE5A 3A5XA 2IDOB 4U2ZA 2ZLYA 3P4WA 3W15B 3WAKA 1BR1A 3PUZF 1Y64B 4HWFA 1KFYA 4UM3P 4DVDA 4ASKA 3AVRA 2V7MA 2ZM6T 2IC6A 1M7KA 3UTKA 3OBVE 3VRBA 3ZT5A 1ZHCA 5CGMA 4EV6A 3UFGA 2WDVA 4H9QC 5HXCA 2VKHA 2PTFA 2EHOD 5J2UE 2B76A 2UXCT 2ES0A 1UX5A 4OFZA 2IIUA 3ANWA 3CX8B 4V1Av 3LSVA 1WCRA 2LEHA 3U8KA 5LHHB 3UU3A 1W9RA 2E8IA 2D9DA 2N2NA 4UELA 3WTHA 3N9PA 4WYVA 3K8PC 4AQFC 3RIUA 3E08A 5DQVA 2L8KA 2CE7A 2LM2A 2DL1A 3AEFA 3UUBA 2IUBA 3C4XA 3PUAA 2KINB 5FY7A 2CM0A 5LGUB 4ZEYA 4O2BE 4QAAA 4B3TT 3I0OA 1OEDA 4PJLA 2WN9A 3QB5K 3HI2A 3VKGA 2X66A 4PK4A 4DR1T 3BQLA 2XQYA 3KBTA 4AKGA 2E9XA 2V6YA 4WNKA 2VL0A 1J5ET 1UK5A 2LOPA 2NOXA 3RRWA 5JDLA 3T4MA 4LMJA 3AEGA 2CPTA 3Q5WA 2XZ6A 2W00A 2XAQB 3P8CD 5J5IA 2W61A 5J5FA 3RKOA 2WMNA 1OEDB 5HEOA 3B13A 3CQCB 2YEVC 4GOUA 2VVSA 5ETWA 3ESLA 5HXHA 5KMGP 1WYCA 2C5KT 1ZP0A 4DR5T 1KEYA 4ZI3C 4CN1A 4EEBA 3IBPA 2HN1A 4JI3T 2XAFB 5L47A 3QC9A 2VURA 2EHOB 4X1IE 2V7IA 1NAFA 4J2CA 4ZJSA 2XSBA 3B57A 4DMWA 2LKHA 5L3FB 3ZPOA 3ZYMA 2XYTA 2M67A 3I9WA 3AE4A 2QVAA 2G0UA 3ZMTB 5KZUA 1J1JA 2L3LA 2QYWA 3M3ZB 4I43B 2C5JA 2YDQA 4IHJE 2X0HA 4PIRA 4CN4A 2XQ4A 2LHRA 4TZ4C 2ODUA 3WTLA 1E7PA 5HEJA 3AE8A 5TAOA 2NW9A 3MKDA 1IBLT 3RH3A 2D0TA 3C79A 4EIWA 3QK6A 2A3DA 3RGLA 4AKLA 2ZM2A 2ZMAA 3ZN1B 3H37A 4Z90A 4IDOA 4I4TE 4ZJTA 2WNLA 4PAGA 3H3AA 1MMGA 5JR9A 4DR6T 5KXJA 3RPUA 4K0UA 4UEMA 3U3IA 1T7SA 4DR2T 1E2AA 3T1YT 4OK0A 5L4EA 4HFBA 2BKOA 2UU9T 2WZYA 4UF0B 2HHHT 2DI4A 4Z8XA 4QXBB 3UUMA 2CXFA 4HFIA 2RPAA 4LF9T 4DNDA 3X1DA 2V8SV 4YY3T 2IC9A 3L39A 3TLVA 2YKSA 4HFHA 4I0UA 1KNRA 3C84A 2XAJB 4JUYA 1HNWT 2NR4A 5ADXL 3I0QA 2FBWA 5AFNA 3AAIA 4DBMA 2H88A 2VWAA 1QSDA 1IZNB 4MBQA 1QLBA 3GN5A 2JIWA 3WTJA 3GA8A 4H9PC 1O3XA 4TV9E 4EZHA 2LSIA 5AQJB 5JRCB 5EK3A 3AEEA 2VKJA 1E1HB 4QHOA 1WRDA 5LJNA 3UUXB 3PJAA 1HG2A 1UGOA 3HKCE 4AFGA 2JMKA 3AECA 4DV1T 4ZS3A 1ZOYA 3FZFB 3RIUC 3RC3A 5BR8T 4KUMB 3CQXC 4HWHA 1H7CA 3ABVA 2OA5A 3E0ZA 4EXTA 1R8IA 5HEHA 4WW0A 5DJQC 3PUWF 3RRCA 3K3OA 4C90A 1HCIA 4X1YE 1XWMA 4EYUA 3R84B 2OV9A 5LHGB 2E5LT 2V7KA 4KP3C 3NWIA 2E9XC 3R6NA 5JTGA 3RC8A 3QOFA 4YLHA 4B5DA 1YXRA 2W66A 1SE7A 4EYYR 4HTEA 3RLFF 2JJ9A 3PUQA 5ABGA 4ZRUA 2WAUA 1HR0T 2YN6A 4LFCT 3N2OA 5JDHA 2WDRA 5FY1A 2V7LA 2XASB 3FZHB 5HXEA 2HPJA 5HCJA 4O8SA 5LJMA 3UULA 4PW8A 4ILBA 4O4LE 5AQKB 4JV5T 4G63A 2BS2A 2WWUA 3C98B 3SFDA 2KMFA 1IJ5A 3VR8A 4JYAT 4NXMT 4LF8T 5JDGA 4JEUB 2QRXA 3RKGA 4DV2T 5JMEA 4P0BA 5FL1A 2XQ8A 2XNUA 4L9IA 1UCUA 4DV3T 2W2UA 4NIQA 2CXDA 4JI5T 4LFAT 3N9MA 5AFLA 5ABEA 3KVBA 4KI0F 4HE8A 5LMUT 2KLQA 3UU6A 4GKKT 4BAYB 4YJ2E 1MIVA 5JDNA 1FMVA 1SUMB 2W8GA 3FXEB 3UU5A 3OYXA 3HKBE 2WDQA 1YKEB 4QH5A 2ACZA 4M1PA 4HFEA 1BR0A 4P09A 4XK9A 4ADZA 4X62T 2QGSA 4YHJA 5C2TA 4CI3B 3P7IA 5FL0A 4IE7A 3CPZA 5F3JA 4AI6A 4H63V 2XZEA 5ABFA 5EZYE 3KV5A 1YQ4A 4UV9B 2UXDT 4YHHT 1NWMX 3CIRA 5AQIB 5JR9C 2LHNA 4HWDA 4HFCA 3AA0B 3PEOA 1DU2A 5HEUA 5JDMA 5L3CB 5FMNA 3WAJA 2V1DB 2HPLA 4CXYA 3F2EA 2BG9E 1MMAA 2Q9QA 2ACXA 4B3MT 2IHR1 5KX5E 1N32T 4OYJA 2L9QA 4QXCB 2FJDA 5ABHA 4U7IA 4UXUA 4UM1A 5AQUB 2W4XA 2K24A 4EZ4A 4FJOA 3CQGB 4KX6A 3JCFA 3CX7B 2Y48B 2DHRA 2E9XD 4P1NA 3EDUA 3WTOA 4NUUA 5LBQB 3TLSA 1LKXA 2UUCT 1T8BA 5AQGB 4OYKA 2K9AA 3NBXX 2XAHB 4JI0T 4HFVA 2KXPB 4UVCB 5EK2A 1MMNA 1GQEA 2KSRA 1UUSA 5AQFB 5KDMC 4XHEA 4NZBA 2X0LB 4TNWA 4ZZBA 1JNZA 1YKHB 4UVAB 5AQSB 3GMIA 4IE5A 2WCAA 3ZJ2A 3ZT6A 1MIYA 2XZ5A 3EVYA 2KNDA 3AE1A 4EZ1A 4GKJT 3AXJA 3HKEE 2JQ9A 3PUGA 3Q5XA 2XM2A 4ZHQE 4P0AA 3ANWB 4UM3S 2DLRA 2MAWA 5AFUL 2WB5A 4DV7T 3O1HA 1ZV4X 5HCMA 2YMDA 1LVKA 2PJQA 4EOZB 2AE9A 3PUYF 4A98A 3ZMUB 2RP4A 4CI2B 3MACA 4UR9A 4IE6A 4EB6E 3I1AA 2ZJUA 2RA1A 2YU2A 5AQTB 1KK7A 1D0YA 4IDZA 1BR4A 5IYZE 2XNVA 5HEGA 4YXDA 1XNRT 4NUVA 4DR3T 3GWHA 4ZI2C 4L0RA 5LG4A 2I0MA 3FBZA 3VU7H 4GK0E 4XAXB 5AQPB 4U3CA 5DABA 2XQ9A 3KVAA 3UT5E 3S4UA 2E9XB 2V6YB 4O4HE 3NRYA 3C50A 1XNQT 1MIWA 2BBHA 4QH1A 2B1EA 2X00A 2XJ7A 4IDPA 3UFEA 1IJ6A 3OYZA 4ZOLE 3N9QA 4O4IE 2VKOA 5FXXA 2LSYA 3AAEB 4E7ZA 5J0ZA 2PFVA 2X9XA 2ZM0A 3BQIA 5BMVE 4FRRA 4TUYE 2K48A 3HA4A 3V5UA 3RI5A 1AJ3A 4DV5T 1BR2A 3PE0A 2DWGA 4X20E 4ALXA 3LBXA 4D01A 4QWNB 4CXXA 5CB4E 5L4HA 3ONLC 2CRBA 4H9SE 2WNJA 3L09A 1HX8A 3PUVF 2BYRA 3N2GE 3AVSA 2LRLA 4GYRA 1W0AA 4EEDA 2D0UA 4X66T 4AFHA 2BKNA 3CKDA 5FYMA 2YINA 3LBXB 3TKLB 4L5GA 1SA0E 1W09A 4N78D 3VR9A 3ZSSA 2BS4A 4WV9A 1WR6A 1MNDA 2JMHA 4EGWA 3ZT7A 4LF7T 4U31A 3AEBA 3F57A 3WTNA 2V5DA 4GIWA 2IMLA 5AFKA 4ZI7E 4TWHA 3IEEA 4ZZCA 2CA5A 3IHRA 3NKZA 3AA1B 2PGZA 2WM9A 3EAMA 5GONE 3RIAA 4ILUA 4QXHB 2XM1A 2V26A 5AFMA 2Q9QC 4PJMA 3EDVA 2A72A 3UU4A 5JR9B 4X5TA 4CZZB 4QACA 2DWKA 5BP0A 5CFBA 2P9BA 4DV6T 3FHNA 2WMOA 3P4RA 2LKGA 3VRAA 3QUJA 3WTIA 2W63A 5AQOB 5JH7E 3FB2A 5AFJA 1T72A 4ZI2D 1EZ3A 1UX2A 4ZK4A 2BG9A 2DNXA 3NVOA 2UXNB 5LGTB 5LMNT 3B5MA 2XQ5A 2JRKA 4C91A 4ANJA 2JQQA 3KDSE 1SHZC 4ZI3D 4MHCA 3LK2B 3BQKA 4IREA 2IW5B 3GN5B 1FEWA 3U8LA 3JADA 4QX8B 2W62A 2HN2A 1T98A 1V9DA 4O2AE 1XDPA 3HL6A 3IGQA 4U7YA 2X51A 4DIDB 1U4QA 2XY8B 3ZYKA 3LK42 3U8NA 3T1HT 5C8YE 2YDRA 4COFA 2N9DA 2I59A 4GK5E 3ZEFB 4DR7T 4JI1T 4I55E 4H63H 2VKDA 3KV6A 1L0VA 4DBRA 2ZJVA 1WFDA 3C4WA 1KNZA 2V6XA 1D0ZA 1OXZA 2X9YA 4LF4T 2A9UA 2M6BA 3ZKRA 2K3WA 1HX1B 4OHFA 4U72A 4WBOA 3JC6C 4IDNA 5SYOA 5AINA 2LJLA 3MA9A 4YTPA 5FXVA 2JPFA 2XNTA 4HFDA 2WS3A 2Y6XA 3PUXF 2BR7A 4O4JE 3ZMSB 3VKHA 4YTMA 3PMZA 4AIUA 4IL9A 3WI3A 3PDYA 3KV4A 4X1KE 3N2KE 4AISA 3EI0A 3ZDHA 5HYAA 3RX6A 2NTYA 3C64A 1I6ZA 3V5SA 2X9WA 3LG7A 1YD8G 2NWBA 4PJJA 2C5IT 3ZLIA 4B6XA 3LJCA 4XZCA 4A97A 4BJNA 3A7MA 2Q9QD 1N34T 1HFAA 1D1AA 3UUNA 4Q25A 4AKIA 1UURA 3N9OA 4B3ST 3RYIE 3N5LA 4ILCA 1HF8A 5AFHA 4JI6T 5LG3A 3K3NA 1XMQT 5LA6E 2FJAA 3SQ6A 3FBLA 5H6RB 1QUUA 3L3PA 3AE6A 2FJEA 2CHNA 2C0SA 2WZHA 5M4YA 2BYNA 4PNIA 5LBMA 5TVCA 3TLWA 3ONXA 3CVRA 2NW7A 4I50E 2VQET 4IE0A 2CBJA 2WBLA 5KE4A 4DR4T 2MPKA
chains in the Genus database with same CATH topology
3C79A 4ILAA 3T4MA 4LMJA 4QABA 5HCMA 2QC1B 5AFJA 2YMDA 2XNTA 2XZ6A 1UW6A 4AFHA 5J5IA 4HFDA 5J5FA 4A98A 2BR7A 2UZ6A 1UX2A 5HEOA 1OEDB 2YMEA 3SQ9A 3WIPA 4UXUA 5JMEA 4ZK4A 2W8FA 4UM1A 2Y58A 2XQ8A 4Z90A 2BG9A 2XNUA 3PMZA 4WV9A 3TLUA 4ZJTA 2WNLA 2ZJUA 4IL9A 2XQ5A 4AFGA 1OEDC 5AFMB 2WNCA 3RQWA 2XNVA 5HEGA 3EI0A 5AFLA 3ZDHA 3WTNA 3SIOA 2XYSA 5L47A 2M6IA 2XQ3A 4TWFA 4UM3A 5AFKA 4TWHA 4BQTA 3UU8A 3UU6A 5IUXA 2BYSA 2XQ7A 4ZZCA 4IREA 4AFTA 2Y7YA 3UQ7A 5HEHA 3U8LA 3WTOA 2Y54A 3ZDGA 3JADA 3UQ4A 3LSVA 4BFQA 2W8GA 3UU5A 5L4EA 3TLSA 2XQ9A 4HFBA 4NPPA 4ZJSA 4A97A 2BYQA 5BW2A 2WZYA 3WTKA 3U8KA 3IGQA 4QH5A 5CO5A 3UU3A 2LKHA 5LXBA 2LLYA 5FJVA 2PGZA 4HFEA 3EAMA 4QH1A 2C9TA 2X00A 3U8NA 3RIAA 3RQUA 3WTHA 3TLTA 4XK9A 2Y56A 4COFA 1UV6A 4HFIA 2XQAA 4Z91A 2KSRA 4ILCA 2XYTA 3U8MA 2Y57A 5AFHA 4B5DA 3TLVA 4F8HA 2YKSA 4HFHA 3EHZA 3U8JA 3JAEA 5LG3A 5J0ZA 2YOEA 2LM2A 4IL4A 3C84A 5AFMA 2XQ6A 3JAFA 4UY2A 1OEDE 4XHEA 3SQ6A 5KZUA 4FRRA 4HQPA 4ZK1A 2BG9B 3RIFA 4NZBA 5J5HA 4TNWA 3UUBA 4ZZBA 4LMKA 3RI5A 4ZRUA 5AFNA 2YN6A 4DBMA 4LMLA 2ZJVA 3UU4A 2BYPA 4ZR6A 4X5TA 2XZ5A 4PIRA 4ALXA 4TNVA 4QAAA 2BYNA 4EZ1A 4QACA 5J5GA 1OEDA 2WN9A 2BG9C 5TVCA 4D01A 3P50A 3RHWA 2XQ4A 3TLWA 2BR8A 3WTJA 5HCJA 5L4HA 5BP0A 5CFBA 2M6BA 4ILBA 3WTLA 2WNJA 4QH4A 3ZKRA 1I9BA 3SH1A 2LKGA 4HFCA 3GUAA 5HEJA 3PEOA 2PH9A 5HEUA 3P4WA 3WTMA 2VL0A 2BJ0A 4UM3S 5BRXA 3WTIA 4UM3P 5AINA 2BYRA 2X00D 2MAWA 5KE4A 5SYOA 4TWDA 2BG9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C79 A;  4ILA A;  3T4M A;  4LMJ A;  4QAB A;  5HCM A;  2QC1 B;  5AFJ A;  2YMD A;  2XNT A;  2XZ6 A;  1UW6 A;  4AFH A;  5J5I A;  4HFD A;  5J5F A;  4A98 A;  2BR7 A;  2UZ6 A;  1UX2 A;  5HEO A;  1OED B;  2YME A;  3SQ9 A;  3WIP A;  4UXU A;  5JME A;  4ZK4 A;  2W8F A;  4UM1 A;  2Y58 A;  2XQ8 A;  4Z90 A;  2BG9 A;  2XNU A;  3PMZ A;  4WV9 A;  3TLU A;  4ZJT A;  2WNL A;  2ZJU A;  4IL9 A;  2XQ5 A;  4AFG A;  1OED C;  5AFM B;  2WNC A;  3RQW A;  2XNV A;  5HEG A;  3EI0 A;  5AFL A;  3ZDH A;  3WTN A;  3SIO A;  2XYS A;  5L47 A;  2M6I A;  2XQ3 A;  4TWF A;  4UM3 A;  5AFK A;  4TWH A;  4BQT A;  3UU8 A;  3UU6 A;  5IUX A;  2BYS A;  2XQ7 A;  4ZZC A;  4IRE A;  4AFT A;  2Y7Y A;  3UQ7 A;  5HEH A;  3U8L A;  3WTO A;  2Y54 A;  3ZDG A;  3JAD A;  3UQ4 A;  3LSV A;  4BFQ A;  2W8G A;  3UU5 A;  5L4E A;  3TLS A;  2XQ9 A;  4HFB A;  4NPP A;  4ZJS A;  4A97 A;  2BYQ A;  5BW2 A;  2WZY A;  3WTK A;  3U8K A;  3IGQ A;  4QH5 A;  5CO5 A;  3UU3 A;  2LKH A;  5LXB A;  2LLY A;  5FJV A;  2PGZ A;  4HFE A;  3EAM A;  4QH1 A;  2C9T A;  2X00 A;  3U8N A;  3RIA A;  3RQU A;  3WTH A;  3TLT A;  4XK9 A;  2Y56 A;  4COF A;  1UV6 A;  4HFI A;  2XQA A;  4Z91 A;  2KSR A;  4ILC A;  2XYT A;  3U8M A;  2Y57 A;  5AFH A;  4B5D A;  3TLV A;  4F8H A;  2YKS A;  4HFH A;  3EHZ A;  3U8J A;  3JAE A;  5LG3 A;  5J0Z A;  2YOE A;  2LM2 A;  4IL4 A;  3C84 A;  5AFM A;  2XQ6 A;  3JAF A;  4UY2 A;  1OED E;  4XHE A;  3SQ6 A;  5KZU A;  4FRR A;  4HQP A;  4ZK1 A;  2BG9 B;  3RIF A;  4NZB A;  5J5H A;  4TNW A;  3UUB A;  4ZZB A;  4LMK A;  3RI5 A;  4ZRU A;  5AFN A;  2YN6 A;  4DBM A;  4LML A;  2ZJV A;  3UU4 A;  2BYP A;  4ZR6 A;  4X5T A;  2XZ5 A;  4PIR A;  4ALX A;  4TNV A;  4QAA A;  2BYN A;  4EZ1 A;  4QAC A;  5J5G A;  1OED A;  2WN9 A;  2BG9 C;  5TVC A;  4D01 A;  3P50 A;  3RHW A;  2XQ4 A;  3TLW A;  2BR8 A;  3WTJ A;  5HCJ A;  5L4H A;  5BP0 A;  5CFB A;  2M6B A;  4ILB A;  3WTL A;  2WNJ A;  4QH4 A;  3ZKR A;  1I9B A;  3SH1 A;  2LKG A;  4HFC A;  3GUA A;  5HEJ A;  3PEO A;  2PH9 A;  5HEU A;  3P4W A;  3WTM A;  2VL0 A;  2BJ0 A;  4UM3 S;  5BRX A;  3WTI A;  4UM3 P;  5AIN A;  2BYR A;  2X00 D;  2MAW A;  5KE4 A;  5SYO A;  4TWD A;  2BG9 E; 
#chains in the Genus database with same CATH topology
 4ILA A;  2QA7 A;  2QC1 B;  1Z8U A;  2CXL A;  4UVB B;  1KNP A;  4H9N C;  5F5W A;  2UZ6 A;  3WIP A;  2WZI A;  3Q5D A;  2KWH A;  3AE7 A;  3ZST A;  5FXZ A;  5FXW A;  3AB3 B;  3IA3 A;  4OX9 T;  3ZMV B;  5LYJ E;  3FZM B;  4KBM B;  1N36 T;  5FVK A;  4PJN A;  3SWH A;  1VOM A;  5LNK A;  5ABF B;  4H9R C;  2FJB A;  2HH7 A;  2XYS A;  1J5W A;  2VB6 A;  2KZ7 B;  4UM3 A;  3P4S A;  3UU8 A;  2CLY C;  5LXT E;  5HAX A;  1S35 A;  1KF6 A;  2N1G A;  1MMD A;  3WTK A;  3SRZ A;  5CA0 E;  4DMV A;  4UIG A;  3DJB A;  2WWV A;  1B7T A;  2PG8 A;  3QNU A;  2J47 A;  2Q9Q B;  4JEH B;  3MJX A;  4CI1 B;  1XMO T;  3JC6 D;  5C3J A;  2BBJ A;  2BYP A;  2GK9 A;  2MTQ A;  1M62 A;  2XPK A;  2BVM A;  4CN6 A;  5J5G A;  3ONJ A;  3M65 A;  2BG9 C;  3P50 A;  1Y01 A;  4DUZ T;  4YSZ A;  4HN9 A;  4TX5 A;  4TN7 B;  5HXR A;  4K0K T;  4AXP A;  1FJG T;  2X00 D;  4ERR A;  3AE2 A;  4TWD A;  1G73 A;  3D0T A;  1US7 B;  3RF1 A;  4IIJ E;  2NTX A;  4JI8 T;  3ZCI A;  4YJ3 E;  2YU1 A;  1HTJ F;  4HEA A;  1X79 A;  4HGA A;  3FZK B;  2WNC A;  3P4P A;  3CWZ B;  3ZC0 A;  3RYC E;  3Q5E A;  2FUP A;  1IAP A;  2M6I A;  3UQ7 A;  3AXJ B;  2Y54 A;  3UQ4 A;  4X64 T;  3PUS A;  2LT3 A;  2NW8 A;  2H3R A;  3RQU A;  3TLT A;  5FKY A;  2WSS V;  3LDQ B;  2CCQ A;  2ZM8 A;  2VAS A;  3KV9 A;  4ISS A;  4UY2 A;  4U2Y A;  2J4G A;  4B3R T;  1U5P A;  5FVL A;  5FP3 A;  1VCS A;  4PK5 A;  5AQL B;  4ZR6 A;  1NEK A;  5AQM B;  2EHO A;  3RHW A;  4E7S A;  2BR8 A;  2LSG A;  5JRE A;  2X67 A;  3NZQ A;  2XAG B;  3O1I A;  1IBM T;  5FY0 A;  3J9X 1;  5A1L A;  3OJA A;  3I9Y A;  5DQW A;  2H7V C;  4AKH A;  4UXN B;  2XTL A;  3A8Y C;  4QAB A;  2R6G F;  3HR0 A;  2I6H A;  2WP9 A;  2YDS A;  3U78 A;  1UW6 A;  1VRB A;  2W8F A;  3FZL B;  3P4Q A;  4H9O C;  2BZB A;  2LRK A;  4KMC A;  1FMW A;  2VQF T;  3OVU A;  5L3E B;  2AXD S;  3AED A;  2LE8 A;  5HWX A;  3N9L A;  3SS1 A;  4G2A A;  2MOZ A;  1UX4 A;  3CK6 A;  4BA9 A;  2CBI A;  5L3D B;  5JVD E;  2BS3 A;  4TWF A;  4HWC A;  2XQ7 A;  1YW0 A;  4KHZ F;  3ZDG A;  4X65 T;  3KIN B;  4NPP A;  5LGN B;  1CUN A;  3PJA J;  3ETV A;  2LLY A;  1N33 T;  5LP6 E;  3PTR B;  3ETU A;  1Z0P A;  3PU8 A;  3CX6 B;  2Y56 A;  3T8O A;  3IF8 B;  4Z91 A;  3ZN0 B;  3E22 E;  3U8M A;  2WY2 A;  2H89 A;  2PBI A;  2UUB T;  3JAE A;  4LF5 T;  2WU2 A;  2XQ6 A;  4YSY A;  5LCY A;  3KBU A;  4HQP A;  3FXD B;  3RIF A;  3NZP A;  3Q2M A;  1CHU A;  3AAA B;  2CHO A;  3N9N A;  4DV4 T;  3G06 A;  5CA1 E;  3AEA A;  5LHI B;  2NP9 A;  1WLX A;  4DV0 T;  4JLE A;  4EAH A;  1VCT A;  4QH4 A;  1I9B A;  3L8R A;  4MAL A;  4UF0 A;  2PH9 A;  3WTM A;  5L2L A;  3ZYL A;  4CXW A;  2LOS A;  3O1J A;  3EAB A;  2H7O A;  2JQK A;  2UUA T;  3O4X E;  2YME A;  2Y58 A;  1HG5 A;  4AKR B;  3CML A;  2D5U A;  2MYS A;  5AFM B;  3QB5 A;  2CLY B;  5AQH B;  1WYB A;  4YSX A;  4PFO A;  3C4Z A;  2BKP A;  2DCF A;  1YQ3 A;  4GYS A;  1XDO A;  4IGU A;  2VVN A;  4A5X A;  4BQT A;  2BYS A;  5JRC A;  1G8X A;  3OPC A;  3AE9 A;  4IE4 A;  5H6Q B;  3EUH A;  5FJV A;  4A56 A;  2J1D G;  4LF6 T;  2C9T A;  5E0O A;  1LRZ A;  2WU5 A;  4AQY T;  1UV6 A;  5IWA T;  3EHZ A;  4JBW F;  1D1C A;  1ZEE A;  1OED E;  2BG9 B;  3DP7 A;  5J5H A;  1WR0 A;  3OKQ A;  4LML A;  2UXX B;  5HWY A;  2Y8D A;  4NXN T;  1OWA A;  3HKD E;  4XBF B;  2W0G A;  2WQY A;  4CQI A;  5L3B B;  3RYF E;  3GUA A;  4AQF A;  5J1G A;  5AQV B;  4WZX A;  2BJ0 A;  3J7Y q;  5BRX A;  5LOV E;  2IAK A;  4QKN A;  2CMR A;  3ZC1 A;  3ZJ1 A;  4MLK A;  1LVF A;  4BJM A;  3DTO A;  1MNE A;  3MK7 C;  4JI7 T;  2LSK A;  2VK9 A;  3TLU A;  4PFP A;  3ZMZ B;  3H3M A;  4FI5 A;  1OED C;  5AQQ B;  5JDF A;  3Q9D A;  1NEN A;  3KFW X;  3RYH E;  1D0X A;  2D2S A;  4HWI B;  5IUX A;  4AFT A;  4IT4 A;  3MZK B;  4HKA A;  4BFQ A;  3VHL A;  1HS7 A;  5LXB A;  3SFE A;  4LFB T;  2EHO C;  5J2T E;  1FIO A;  3MXZ A;  3OTO T;  5CJ5 A;  2CWY A;  2VL8 A;  2LM9 A;  2JQH A;  2CEA A;  2XQA A;  4DO0 A;  4QX7 B;  1X9B A;  4IDQ A;  1IBK T;  2Y57 A;  5JDQ A;  3U8J A;  2SPC A;  4YT0 A;  2YOE A;  2XHE B;  3K3Q C;  2A2F X;  2BVL A;  2KT9 A;  4LMK A;  5EK4 A;  2MBG A;  5AQR B;  4JI2 T;  1ZKE A;  3PU3 A;  4TNV A;  2X68 A;  1JNR A;  5L3G B;  3ZCJ A;  2W67 A;  4YTN A;  2J62 A;  3F31 A;  3AA7 B;  3SH1 A;  2ODV A;  2Z6E A;  4IST A;  2X0Y A;  5JQG E;  1W0B A;  1I94 T;  3AA6 B;  3AE3 A;  3PV0 F;  2KWI B;  4MFR A;  3O9X A;  3SQ9 A;  4U33 A;  5FNV E;  4KHP T;  3C51 A;  4ZXL A;  2F4V T;  2CWO A;  2K5B B;  2V5C A;  2UXB T;  3RQW A;  4TV8 E;  3SIO A;  2XQ3 A;  3K1S A;  2Y7Y A;  1D1B A;  2E5V A;  3NRX A;  2BYQ A;  5BW2 A;  4PK6 A;  2LSJ A;  3LFM A;  5CO5 A;  4YFS A;  3SOL A;  4UV8 B;  5IHY A;  4U74 A;  1XZY A;  4DBQ A;  2OLT A;  1HNZ T;  4WBN E;  4F6R C;  4F8H A;  2X9H A;  2XUE A;  1HNX T;  4IL4 A;  3LK3 B;  3JAF A;  5HXS A;  2BDE A;  4ZK1 A;  4ZS2 A;  5LB7 B;  2E2A A;  2YK0 A;  5F8P A;  3PUR A;  4AQG A;  2XSA A;  5AQN B;  2V7J A;  4JI4 T;  4DUY T;  1S94 A;  3BK9 A;  3AE5 A;  3A5X A;  2IDO B;  4U2Z A;  2ZLY A;  3P4W A;  3W15 B;  3WAK A;  1BR1 A;  3PUZ F;  1Y64 B;  4HWF A;  1KFY A;  4UM3 P;  4DVD A;  4ASK A;  3AVR A;  2V7M A;  2ZM6 T;  2IC6 A;  1M7K A;  3UTK A;  3OBV E;  3VRB A;  3ZT5 A;  1ZHC A;  5CGM A;  4EV6 A;  3UFG A;  2WDV A;  4H9Q C;  5HXC A;  2VKH A;  2PTF A;  2EHO D;  5J2U E;  2B76 A;  2UXC T;  2ES0 A;  1UX5 A;  4OFZ A;  2IIU A;  3ANW A;  3CX8 B;  4V1A v;  3LSV A;  1WCR A;  2LEH A;  3U8K A;  5LHH B;  3UU3 A;  1W9R A;  2E8I A;  2D9D A;  2N2N A;  4UEL A;  3WTH A;  3N9P A;  4WYV A;  3K8P C;  4AQF C;  3RIU A;  3E08 A;  5DQV A;  2L8K A;  2CE7 A;  2LM2 A;  2DL1 A;  3AEF A;  3UUB A;  2IUB A;  3C4X A;  3PUA A;  2KIN B;  5FY7 A;  2CM0 A;  5LGU B;  4ZEY A;  4O2B E;  4QAA A;  4B3T T;  3I0O A;  1OED A;  4PJL A;  2WN9 A;  3QB5 K;  3HI2 A;  3VKG A;  2X66 A;  4PK4 A;  4DR1 T;  3BQL A;  2XQY A;  3KBT A;  4AKG A;  2E9X A;  2V6Y A;  4WNK A;  2VL0 A;  1J5E T;  1UK5 A;  2LOP A;  2NOX A;  3RRW A;  5JDL A;  3T4M A;  4LMJ A;  3AEG A;  2CPT A;  3Q5W A;  2XZ6 A;  2W00 A;  2XAQ B;  3P8C D;  5J5I A;  2W61 A;  5J5F A;  3RKO A;  2WMN A;  1OED B;  5HEO A;  3B13 A;  3CQC B;  2YEV C;  4GOU A;  2VVS A;  5ETW A;  3ESL A;  5HXH A;  5KMG P;  1WYC A;  2C5K T;  1ZP0 A;  4DR5 T;  1KEY A;  4ZI3 C;  4CN1 A;  4EEB A;  3IBP A;  2HN1 A;  4JI3 T;  2XAF B;  5L47 A;  3QC9 A;  2VUR A;  2EHO B;  4X1I E;  2V7I A;  1NAF A;  4J2C A;  4ZJS A;  2XSB A;  3B57 A;  4DMW A;  2LKH A;  5L3F B;  3ZPO A;  3ZYM A;  2XYT A;  2M67 A;  3I9W A;  3AE4 A;  2QVA A;  2G0U A;  3ZMT B;  5KZU A;  1J1J A;  2L3L A;  2QYW A;  3M3Z B;  4I43 B;  2C5J A;  2YDQ A;  4IHJ E;  2X0H A;  4PIR A;  4CN4 A;  2XQ4 A;  2LHR A;  4TZ4 C;  2ODU A;  3WTL A;  1E7P A;  5HEJ A;  3AE8 A;  5TAO A;  2NW9 A;  3MKD A;  1IBL T;  3RH3 A;  2D0T A;  3C79 A;  4EIW A;  3QK6 A;  2A3D A;  3RGL A;  4AKL A;  2ZM2 A;  2ZMA A;  3ZN1 B;  3H37 A;  4Z90 A;  4IDO A;  4I4T E;  4ZJT A;  2WNL A;  4PAG A;  3H3A A;  1MMG A;  5JR9 A;  4DR6 T;  5KXJ A;  3RPU A;  4K0U A;  4UEM A;  3U3I A;  1T7S A;  4DR2 T;  1E2A A;  3T1Y T;  4OK0 A;  5L4E A;  4HFB A;  2BKO A;  2UU9 T;  2WZY A;  4UF0 B;  2HHH T;  2DI4 A;  4Z8X A;  4QXB B;  3UUM A;  2CXF A;  4HFI A;  2RPA A;  4LF9 T;  4DND A;  3X1D A;  2V8S V;  4YY3 T;  2IC9 A;  3L39 A;  3TLV A;  2YKS A;  4HFH A;  4I0U A;  1KNR A;  3C84 A;  2XAJ B;  4JUY A;  1HNW T;  2NR4 A;  5ADX L;  3I0Q A;  2FBW A;  5AFN A;  3AAI A;  4DBM A;  2H88 A;  2VWA A;  1QSD A;  1IZN B;  4MBQ A;  1QLB A;  3GN5 A;  2JIW A;  3WTJ A;  3GA8 A;  4H9P C;  1O3X A;  4TV9 E;  4EZH A;  2LSI A;  5AQJ B;  5JRC B;  5EK3 A;  3AEE A;  2VKJ A;  1E1H B;  4QHO A;  1WRD A;  5LJN A;  3UUX B;  3PJA A;  1HG2 A;  1UGO A;  3HKC E;  4AFG A;  2JMK A;  3AEC A;  4DV1 T;  4ZS3 A;  1ZOY A;  3FZF B;  3RIU C;  3RC3 A;  5BR8 T;  4KUM B;  3CQX C;  4HWH A;  1H7C A;  3ABV A;  2OA5 A;  3E0Z A;  4EXT A;  1R8I A;  5HEH A;  4WW0 A;  5DJQ C;  3PUW F;  3RRC A;  3K3O A;  4C90 A;  1HCI A;  4X1Y E;  1XWM A;  4EYU A;  3R84 B;  2OV9 A;  5LHG B;  2E5L T;  2V7K A;  4KP3 C;  3NWI A;  2E9X C;  3R6N A;  5JTG A;  3RC8 A;  3QOF A;  4YLH A;  4B5D A;  1YXR A;  2W66 A;  1SE7 A;  4EYY R;  4HTE A;  3RLF F;  2JJ9 A;  3PUQ A;  5ABG A;  4ZRU A;  2WAU A;  1HR0 T;  2YN6 A;  4LFC T;  3N2O A;  5JDH A;  2WDR A;  5FY1 A;  2V7L A;  2XAS B;  3FZH B;  5HXE A;  2HPJ A;  5HCJ A;  4O8S A;  5LJM A;  3UUL A;  4PW8 A;  4ILB A;  4O4L E;  5AQK B;  4JV5 T;  4G63 A;  2BS2 A;  2WWU A;  3C98 B;  3SFD A;  2KMF A;  1IJ5 A;  3VR8 A;  4JYA T;  4NXM T;  4LF8 T;  5JDG A;  4JEU B;  2QRX A;  3RKG A;  4DV2 T;  5JME A;  4P0B A;  5FL1 A;  2XQ8 A;  2XNU A;  4L9I A;  1UCU A;  4DV3 T;  2W2U A;  4NIQ A;  2CXD A;  4JI5 T;  4LFA T;  3N9M A;  5AFL A;  5ABE A;  3KVB A;  4KI0 F;  4HE8 A;  5LMU T;  2KLQ A;  3UU6 A;  4GKK T;  4BAY B;  4YJ2 E;  1MIV A;  5JDN A;  1FMV A;  1SUM B;  2W8G A;  3FXE B;  3UU5 A;  3OYX A;  3HKB E;  2WDQ A;  1YKE B;  4QH5 A;  2ACZ A;  4M1P A;  4HFE A;  1BR0 A;  4P09 A;  4XK9 A;  4ADZ A;  4X62 T;  2QGS A;  4YHJ A;  5C2T A;  4CI3 B;  3P7I A;  5FL0 A;  4IE7 A;  3CPZ A;  5F3J A;  4AI6 A;  4H63 V;  2XZE A;  5ABF A;  5EZY E;  3KV5 A;  1YQ4 A;  4UV9 B;  2UXD T;  4YHH T;  1NWM X;  3CIR A;  5AQI B;  5JR9 C;  2LHN A;  4HWD A;  4HFC A;  3AA0 B;  3PEO A;  1DU2 A;  5HEU A;  5JDM A;  5L3C B;  5FMN A;  3WAJ A;  2V1D B;  2HPL A;  4CXY A;  3F2E A;  2BG9 E;  1MMA A;  2Q9Q A;  2ACX A;  4B3M T;  2IHR 1;  5KX5 E;  1N32 T;  4OYJ A;  2L9Q A;  4QXC B;  2FJD A;  5ABH A;  4U7I A;  4UXU A;  4UM1 A;  5AQU B;  2W4X A;  2K24 A;  4EZ4 A;  4FJO A;  3CQG B;  4KX6 A;  3JCF A;  3CX7 B;  2Y48 B;  2DHR A;  2E9X D;  4P1N A;  3EDU A;  3WTO A;  4NUU A;  5LBQ B;  3TLS A;  1LKX A;  2UUC T;  1T8B A;  5AQG B;  4OYK A;  2K9A A;  3NBX X;  2XAH B;  4JI0 T;  4HFV A;  2KXP B;  4UVC B;  5EK2 A;  1MMN A;  1GQE A;  2KSR A;  1UUS A;  5AQF B;  5KDM C;  4XHE A;  4NZB A;  2X0L B;  4TNW A;  4ZZB A;  1JNZ A;  1YKH B;  4UVA B;  5AQS B;  3GMI A;  4IE5 A;  2WCA A;  3ZJ2 A;  3ZT6 A;  1MIY A;  2XZ5 A;  3EVY A;  2KND A;  3AE1 A;  4EZ1 A;  4GKJ T;  3AXJ A;  3HKE E;  2JQ9 A;  3PUG A;  3Q5X A;  2XM2 A;  4ZHQ E;  4P0A A;  3ANW B;  4UM3 S;  2DLR A;  2MAW A;  5AFU L;  2WB5 A;  4DV7 T;  3O1H A;  1ZV4 X;  5HCM A;  2YMD A;  1LVK A;  2PJQ A;  4EOZ B;  2AE9 A;  3PUY F;  4A98 A;  3ZMU B;  2RP4 A;  4CI2 B;  3MAC A;  4UR9 A;  4IE6 A;  4EB6 E;  3I1A A;  2ZJU A;  2RA1 A;  2YU2 A;  5AQT B;  1KK7 A;  1D0Y A;  4IDZ A;  1BR4 A;  5IYZ E;  2XNV A;  5HEG A;  4YXD A;  1XNR T;  4NUV A;  4DR3 T;  3GWH A;  4ZI2 C;  4L0R A;  5LG4 A;  2I0M A;  3FBZ A;  3VU7 H;  4GK0 E;  4XAX B;  5AQP B;  4U3C A;  5DAB A;  2XQ9 A;  3KVA A;  3UT5 E;  3S4U A;  2E9X B;  2V6Y B;  4O4H E;  3NRY A;  3C50 A;  1XNQ T;  1MIW A;  2BBH A;  4QH1 A;  2B1E A;  2X00 A;  2XJ7 A;  4IDP A;  3UFE A;  1IJ6 A;  3OYZ A;  4ZOL E;  3N9Q A;  4O4I E;  2VKO A;  5FXX A;  2LSY A;  3AAE B;  4E7Z A;  5J0Z A;  2PFV A;  2X9X A;  2ZM0 A;  3BQI A;  5BMV E;  4FRR A;  4TUY E;  2K48 A;  3HA4 A;  3V5U A;  3RI5 A;  1AJ3 A;  4DV5 T;  1BR2 A;  3PE0 A;  2DWG A;  4X20 E;  4ALX A;  3LBX A;  4D01 A;  4QWN B;  4CXX A;  5CB4 E;  5L4H A;  3ONL C;  2CRB A;  4H9S E;  2WNJ A;  3L09 A;  1HX8 A;  3PUV F;  2BYR A;  3N2G E;  3AVS A;  2LRL A;  4GYR A;  1W0A A;  4EED A;  2D0U A;  4X66 T;  4AFH A;  2BKN A;  3CKD A;  5FYM A;  2YIN A;  3LBX B;  3TKL B;  4L5G A;  1SA0 E;  1W09 A;  4N78 D;  3VR9 A;  3ZSS A;  2BS4 A;  4WV9 A;  1WR6 A;  1MND A;  2JMH A;  4EGW A;  3ZT7 A;  4LF7 T;  4U31 A;  3AEB A;  3F57 A;  3WTN A;  2V5D A;  4GIW A;  2IML A;  5AFK A;  4ZI7 E;  4TWH A;  3IEE A;  4ZZC A;  2CA5 A;  3IHR A;  3NKZ A;  3AA1 B;  2PGZ A;  2WM9 A;  3EAM A;  5GON E;  3RIA A;  4ILU A;  4QXH B;  2XM1 A;  2V26 A;  5AFM A;  2Q9Q C;  4PJM A;  3EDV A;  2A72 A;  3UU4 A;  5JR9 B;  4X5T A;  4CZZ B;  4QAC A;  2DWK A;  5BP0 A;  5CFB A;  2P9B A;  4DV6 T;  3FHN A;  2WMO A;  3P4R A;  2LKG A;  3VRA A;  3QUJ A;  3WTI A;  2W63 A;  5AQO B;  5JH7 E;  3FB2 A;  5AFJ A;  1T72 A;  4ZI2 D;  1EZ3 A;  1UX2 A;  4ZK4 A;  2BG9 A;  2DNX A;  3NVO A;  2UXN B;  5LGT B;  5LMN T;  3B5M A;  2XQ5 A;  2JRK A;  4C91 A;  4ANJ A;  2JQQ A;  3KDS E;  1SHZ C;  4ZI3 D;  4MHC A;  3LK2 B;  3BQK A;  4IRE A;  2IW5 B;  3GN5 B;  1FEW A;  3U8L A;  3JAD A;  4QX8 B;  2W62 A;  2HN2 A;  1T98 A;  1V9D A;  4O2A E;  1XDP A;  3HL6 A;  3IGQ A;  4U7Y A;  2X51 A;  4DID B;  1U4Q A;  2XY8 B;  3ZYK A;  3LK4 2;  3U8N A;  3T1H T;  5C8Y E;  2YDR A;  4COF A;  2N9D A;  2I59 A;  4GK5 E;  3ZEF B;  4DR7 T;  4JI1 T;  4I55 E;  4H63 H;  2VKD A;  3KV6 A;  1L0V A;  4DBR A;  2ZJV A;  1WFD A;  3C4W A;  1KNZ A;  2V6X A;  1D0Z A;  1OXZ A;  2X9Y A;  4LF4 T;  2A9U A;  2M6B A;  3ZKR A;  2K3W A;  1HX1 B;  4OHF A;  4U72 A;  4WBO A;  3JC6 C;  4IDN A;  5SYO A;  5AIN A;  2LJL A;  3MA9 A;  4YTP A;  5FXV A;  2JPF A;  2XNT A;  4HFD A;  2WS3 A;  2Y6X A;  3PUX F;  2BR7 A;  4O4J E;  3ZMS B;  3VKH A;  4YTM A;  3PMZ A;  4AIU A;  4IL9 A;  3WI3 A;  3PDY A;  3KV4 A;  4X1K E;  3N2K E;  4AIS A;  3EI0 A;  3ZDH A;  5HYA A;  3RX6 A;  2NTY A;  3C64 A;  1I6Z A;  3V5S A;  2X9W A;  3LG7 A;  1YD8 G;  2NWB A;  4PJJ A;  2C5I T;  3ZLI A;  4B6X A;  3LJC A;  4XZC A;  4A97 A;  4BJN A;  3A7M A;  2Q9Q D;  1N34 T;  1HFA A;  1D1A A;  3UUN A;  4Q25 A;  4AKI A;  1UUR A;  3N9O A;  4B3S T;  3RYI E;  3N5L A;  4ILC A;  1HF8 A;  5AFH A;  4JI6 T;  5LG3 A;  3K3N A;  1XMQ T;  5LA6 E;  2FJA A;  3SQ6 A;  3FBL A;  5H6R B;  1QUU A;  3L3P A;  3AE6 A;  2FJE A;  2CHN A;  2C0S A;  2WZH A;  5M4Y A;  2BYN A;  4PNI A;  5LBM A;  5TVC A;  3TLW A;  3ONX A;  3CVR A;  2NW7 A;  4I50 E;  2VQE T;  4IE0 A;  2CBJ A;  2WBL A;  5KE4 A;  4DR4 T;  2MPK A; 
#chains in the Genus database with same CATH homology
 3C79 A;  4ILA A;  3T4M A;  4LMJ A;  4QAB A;  5HCM A;  2QC1 B;  5AFJ A;  2YMD A;  2XNT A;  2XZ6 A;  1UW6 A;  4AFH A;  5J5I A;  4HFD A;  5J5F A;  4A98 A;  2BR7 A;  2UZ6 A;  1UX2 A;  5HEO A;  1OED B;  2YME A;  3SQ9 A;  3WIP A;  4UXU A;  5JME A;  4ZK4 A;  2W8F A;  4UM1 A;  2Y58 A;  2XQ8 A;  4Z90 A;  2BG9 A;  2XNU A;  3PMZ A;  4WV9 A;  3TLU A;  4ZJT A;  2WNL A;  2ZJU A;  4IL9 A;  2XQ5 A;  4AFG A;  1OED C;  5AFM B;  2WNC A;  3RQW A;  2XNV A;  5HEG A;  3EI0 A;  5AFL A;  3ZDH A;  3WTN A;  3SIO A;  2XYS A;  5L47 A;  2M6I A;  2XQ3 A;  4TWF A;  4UM3 A;  5AFK A;  4TWH A;  4BQT A;  3UU8 A;  3UU6 A;  5IUX A;  2BYS A;  2XQ7 A;  4ZZC A;  4IRE A;  4AFT A;  2Y7Y A;  3UQ7 A;  5HEH A;  3U8L A;  3WTO A;  2Y54 A;  3ZDG A;  3JAD A;  3UQ4 A;  3LSV A;  4BFQ A;  2W8G A;  3UU5 A;  5L4E A;  3TLS A;  2XQ9 A;  4HFB A;  4NPP A;  4ZJS A;  4A97 A;  2BYQ A;  5BW2 A;  2WZY A;  3WTK A;  3U8K A;  3IGQ A;  4QH5 A;  5CO5 A;  3UU3 A;  2LKH A;  5LXB A;  2LLY A;  5FJV A;  2PGZ A;  4HFE A;  3EAM A;  4QH1 A;  2C9T A;  2X00 A;  3U8N A;  3RIA A;  3RQU A;  3WTH A;  3TLT A;  4XK9 A;  2Y56 A;  4COF A;  1UV6 A;  4HFI A;  2XQA A;  4Z91 A;  2KSR A;  4ILC A;  2XYT A;  3U8M A;  2Y57 A;  5AFH A;  4B5D A;  3TLV A;  4F8H A;  2YKS A;  4HFH A;  3EHZ A;  3U8J A;  3JAE A;  5LG3 A;  5J0Z A;  2YOE A;  2LM2 A;  4IL4 A;  3C84 A;  5AFM A;  2XQ6 A;  3JAF A;  4UY2 A;  1OED E;  4XHE A;  3SQ6 A;  5KZU A;  4FRR A;  4HQP A;  4ZK1 A;  2BG9 B;  3RIF A;  4NZB A;  5J5H A;  4TNW A;  3UUB A;  4ZZB A;  4LMK A;  3RI5 A;  4ZRU A;  5AFN A;  2YN6 A;  4DBM A;  4LML A;  2ZJV A;  3UU4 A;  2BYP A;  4ZR6 A;  4X5T A;  2XZ5 A;  4PIR A;  4ALX A;  4TNV A;  4QAA A;  2BYN A;  4EZ1 A;  4QAC A;  5J5G A;  1OED A;  2WN9 A;  2BG9 C;  5TVC A;  4D01 A;  3P50 A;  3RHW A;  2XQ4 A;  3TLW A;  2BR8 A;  3WTJ A;  5HCJ A;  5L4H A;  5BP0 A;  5CFB A;  2M6B A;  4ILB A;  3WTL A;  2WNJ A;  4QH4 A;  3ZKR A;  1I9B A;  3SH1 A;  2LKG A;  4HFC A;  3GUA A;  5HEJ A;  3PEO A;  2PH9 A;  5HEU A;  3P4W A;  3WTM A;  2VL0 A;  2BJ0 A;  4UM3 S;  5BRX A;  3WTI A;  4UM3 P;  5AIN A;  2BYR A;  2X00 D;  2MAW A;  5KE4 A;  5SYO A;  4TWD A;  2BG9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...