4ZZCA

The glic pentameric ligand-gated ion channel open form complexed to xenon
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural Basis for Xenon Inhibition in a Cationic Pentameric Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4zzcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zzcA01
5BW2A 2Y57A 4ILBA 4Z90A 4B5DA 3WTIA 3JAEA 4ILAA 2BYSA 3IGQA 4IL9A 4LMKA 3WTKA 4LMLA 4TWFA 2XZ6A 2M6IA 4ILCA 3SH1A 2Y54A 2X00D 2XYTA 3C84A 3TLUA 4QACA 3UU4A 4NPPA 5L4HA 5JMEA 3UQ7A 5AFMA 2PGZA 1UW6A 4ZRUA 2BG9C 3U8LA 2BYRA 4UM1A 2YKSA 4AFGA 2C9TA 4HQPA 3EAMA 2XZ5A 4QAAA 5HEJA 4XHEA 4DBMA 5HEUA 4QH4A 5KZUA 3EI0A 4A97A 4UXUA 2KSRA 4HFDA 3TLTA 5FJVA 3WTNA 4ALXA 1OEDE 5AFMB 4HFBA 4UY2A 2BR8A 4QH1A 3SIOA 2BG9A 2YN6A 4LMJA 4ZR6A 3RIFA 2BYQA 4IREA 3LSVA 2BR7A 3P50A 5HCMA 4WV9A 2QC1B 4X5TA 3UU3A 3TLVA 2XYSA 5J5IA 2XQ6A 2W8GA 4TNVA 5BRXA 2XQ5A 2XNUA 2WNCA 5AINA 5KE4A 5HEGA 3U8JA 3RHWA 2ZJUA 2WZYA 4ZJTA 2Y7YA 4UM3P 5L47A 2XQ4A 2BYNA 3WIPA 2YOEA 4D01A 2M6BA 3RIAA 2BJ0A 2XNVA 2LM2A 3WTHA 2YMDA 5L4EA 1UX2A 5AFKA 1OEDC 2PH9A 2XNTA 2VL0A 3SQ6A 2W8FA 5J5HA 3EHZA 5HEOA 3UU8A 5SYOA 4ZZCA 1I9BA 4FRRA 3UQ4A 5LG3A 1UV6A 3ZKRA 3PMZA 3ZDGA 2LKGA 5AFJA 3UU6A 2Y56A 2XQ9A 4HFCA 4ZK4A 4UM3S 4ZK1A 1OEDA 3RQWA 4ZJSA 5CFBA 5HEHA 2YMEA 2XQ7A 4HFIA 3GUAA 2LLYA 4UM3A 5BP0A 4Z91A 5J0ZA 4IL4A 3UUBA 2BG9B 4TWDA 2MAWA 4AFHA 3JAFA 5LXBA 5CO5A 4TWHA 4QH5A 3SQ9A 2XQAA 3JADA 2WNJA 3C79A 2WNLA 5AFLA 1OEDB 2LKHA 3WTOA 3TLWA 3WTLA 4A98A 3RQUA 2X00A 4EZ1A 3PEOA 4COFA 3T4MA 2XQ3A 5HCJA 3WTJA 4BFQA 2XQ8A 5J5FA 2WN9A 3U8MA 4TNWA 4F8HA 4HFHA 2UZ6A 3U8NA 2ZJVA 4NZBA 4QABA 4HFEA 5AFNA 3TLSA 4ZZBA 2BG9E 5J5GA 3P4WA 3UU5A 2Y58A 4BQTA 5AFHA 3WTMA 5TVCA 3RI5A 4PIRA 4AFTA 2BYPA 3U8KA 4XK9A 3ZDHA 5IUXA
chains in the Genus database with same CATH superfamily
1KNRA 4ILBA 3C4XA 4ZHQE 1I94T 3ZMSB 1HG2A 1WR0A 4U72A 5JRCA 3CX6B 3MACA 4WNKA 4AXPA 1YW0A 3R84B 1ZOYA 2BG9C 2CMRA 2N1GA 1XMOT 4I0UA 4DUYT 3VRAA 3WI3A 4ZI2C 3TLTA 2BS3A 2VASA 3P4PA 4KHPT 4JBWF 3EDVA 4ZI2D 4DV0T 3OYZA 5J5IA 2X67A 1FIOA 2XSBA 2E9XA 2YOEA 4D01A 2Z6EA 2LM2A 2XNVA 2YMDA 1OEDC 1T8BA 5LBQB 1D1BA 4B3ST 1E2AA 5LJNA 4GKKT 2WWUA 1U5PA 1GQEA 3ZYLA 1KNZA 3PMZA 2LKGA 4PNIA 2BDEA 4HWIB 2BS4A 3OKQA 2LSKA 4U7IA 4UVCB 3CK6A 4QWNB 2V1DB 3SWHA 2LKHA 3CQGB 3N9MA 2W67A 2BKOA 3L39A 2HN1A 5AQOB 1YXRA 1N36T 4X1IE 2WCAA 4TNWA 4CI2B 4H9SE 2UZ6A 1HR0T 3T1YT 3P4WA 3K1SA 2D2SA 4H63H 5FP3A 5FKYA 3PJAJ 2X68A 2ZM2A 2CLYC 4LMKA 1KEYA 4X66T 4JUYA 1MIWA 5AFMA 2RP4A 4TV9E 4HE8A 3PURA 1VOMA 4HWHA 2PJQA 2Q9QB 2HPJA 4P1NA 3QNUA 2AE9A 3J7Yq 3HL6A 4BJMA 5EZYE 4MLKA 2V7IA 4ILUA 5AQNB 3AE2A 3N9QA 2DWKA 2JPFA 2UXBT 5HYAA 1KF6A 2J4GA 4QXHB 4YY3T 2WDQA 3ZKRA 3QB5A 2CM0A 1WFDA 3N9NA 4UM3S 4YT0A 2KT9A 2LLYA 1HX8A 2D9DA 2WZHA 4EIWA 3NWIA 4IL4A 2HH7A 2MAWA 3RC3A 2QGSA 1JNRA 3C98B 5JDHA 3P8CD 3L09A 2IMLA 2JJ9A 3H37A 3VHLA 5ABFB 4YFSA 5J2UE 2K9AA 4LFBT 3Q2MA 3K3QC 3WTMA 5LCYA 4DBRA 2B76A 2N2NA 2XJ7A 2W4XA 4YTNA 4O8SA 1X79A 5LOVE 4JI6T 3IGQA 2XAGB 3MK7C 1YD8G 3RKOA 2K5BB 2XYTA 3A7MA 5C2TA 2ZM8A 2XY8B 5FYMA 2ODUA 4HQPA 5HEJA 5HXHA 3ZEFB 4ERRA 2NR4A 4ZXLA 4L5GA 2CWYA 4EB6E 2QYWA 2H7VC 2VKDA 5CB4E 4ZJTA 3A5XA 1YQ4A 4L0RA 4TV8E 3ONJA 1E7PA 2VURA 2NTXA 1W0AA 3RRCA 3EHZA 2J47A 5FXZA 1FMWA 3UQ4A 4YJ3E 2L8KA 3RKGA 2XQ9A 2V7KA 4JLEA 2H7OA 5CFBA 4EZHA 2XQ7A 4OHFA 1NWMX 2XAFB 4TWDA 4AFHA 2QVAA 3WTOA 3PUSA 4PFPA 2W2UA 3K3NA 2CXLA 3FB2A 4O2AE 4DR3T 5HXSA 3PJAA 2OV9A 1J1JA 2IAKA 4B3RT 4HFEA 2DL1A 5KDMC 4DV7T 4PIRA 3N9PA 3ZDHA 1ZP0A 5IUXA 3LK2B 4B5DA 5LGNB 3WTKA 2IDOB 3PUGA 1CHUA 3V5UA 1XNQT 3TLUA 3GN5A 5JMEA 5LP6E 3U8LA 4BJNA 3I0QA 2X51A 5LMUT 3QB5K 1YKHB 2XZ5A 4QAAA 2CEAA 4LF7T 4QH4A 4EV6A 2BVMA 4HFDA 1UURA 2XAJB 4ZR6A 2XAHB 1LVKA 4BA9A 4JI8T 2IIUA 5AQVB 3KFWX 3F57A 4E7SA 2E2AA 2Y7YA 2BVLA 4EZ4A 5FL0A 5TAOA 4ZZCA 1SUMB 5E0OA 3AAEB 5L3EB 2CHNA 5AFJA 3OJAA 3PTRB 5LHHB 3KDSE 2XASB 4BAYB 4MHCA 3AAIA 1HFAA 2V26A 1H7CA 4H63V 5J0ZA 2LHRA 2LJLA 3LG7A 4QH5A 4G63A 1SA0E 4O4LE 1YKEB 2WWVA 3WTLA 1MMAA 2JQ9A 2MPKA 1AJ3A 2FJDA 3AXJB 3U8NA 5BMVE 4U7YA 2BYPA 3M3ZB 3PU8A 3KV4A 2R6GF 4J2CA 4WW0A 3RF1A 2YDRA 5JQGE 1KK7A 2WMOA 2B1EA 4PW8A 5JRCB 1HTJF 5DJQC 5FY7A 2CE7A 4U31A 4LF5T 1FJGT 4UY2A 4KHZF 2A2FX 3FXDB 2VB6A 4WV9A 4B6XA 3ZT7A 3ZJ2A 2V8SV 1UX5A 4I4TE 2WU2A 2MOZA 1T7SA 2XQ4A 5IHYA 3ZN1B 4IE7A 2A3DA 1UCUA 4HKAA 1D0ZA 4JI5T 2XM1A 2CRBA 2E9XB 2FUPA 2YMEA 3O1JA 3ZN0B 2ZLYA 3KVAA 2A9UA 3AE6A 5CO5A 3SQ9A 2V5CA 2XQAA 5L3GB 4GYSA 4V1Av 1G8XA 2WMNA 3IBPA 3HA4A 4ASKA 1HS7A 4C91A 3RYIE 2V6YB 3FXEB 2KLQA 3GA8A 4K0UA 3CKDA 3NRXA 2I59A 3N2OA 3RI5A 2XTLA 2HHHT 5FXWA 2MYSA 1Z8UA 5JDGA 2Y6XA 3ETUA 5CA1E 4TWFA 3N5LA 2KWHA 2X00D 4IGUA 2DLRA 1I6ZA 5L4HA 3ZSSA 4HWCA 3AE4A 4PJNA 4TUYE 2PGZA 3MA9A 4IDQA 3VU7H 3E08A 3ZC1A 4IT4A 3RH3A 2V7LA 5AFMB 2X9XA 1J5WA 4QH1A 4P0BA 3AEFA 3FZHB 4DR6T 5FVLA 2X66A 2OA5A 4AISA 4WBOA 4YHJA 2W63A 3U3IA 2W8GA 5AINA 4WBNE 2W66A 2X9YA 2QRXA 2VL0A 2LSYA 3AE9A 1US7B 2MTQA 2A72A 2E5VA 3RQWA 3DP7A 4ZJSA 4JI1T 4UF0A 3GUAA 1FMVA 5AQQB 2LHNA 5BP0A 2DNXA 3RPUA 3PUQA 2VQET 2KWIB 2V7MA 4TWHA 5H6RB 2ZM0A 4PK6A 2LSGA 1G73A 2X00A 3I9WA 5ABEA 3QC9A 3WTJA 3DTOA 4IE6A 3ZYKA 4EEDA 4KUMB 4C90A 5F5WA 5FXXA 4NUVA 3WAJA 3Q5EA 4AQGA 2JQQA 3JCFA 3Q5XA 2ACXA 5C8YE 2WU5A 1U4QA 5L3DB 4DMVA 3BQLA 4IDNA 2D0UA 4JYAT 3C84A 4AQFC 3NZPA 4UM1A 3W15B 4DR1T 4X1YE 3EABA 3IF8B 2GK9A 3NRYA 4UXUA 1EZ3A 2BG9A 3ZMTB 4X1KE 4ZI7E 2UXCT 1NAFA 3E0ZA 4FJOA 4GKJT 5KE4A 3WIPA 4ANJA 2VVNA 2FBWA 2UXDT 5AQTB 4JI3T 2KXPB 5SYOA 5LHIB 1S35A 1N32T 4AQYT 1ZHCA 4GK0E 5CGMA 2IW5B 3VRBA 1OEDA 2XAQB 4GOUA 4U74A 3O9XA 1CUNA 2WB5A 4JI4T 4IE5A 3V5SA 5JVDE 3CX8B 5LG4A 4HWDA 2LOPA 4A98A 4NUUA 1UX4A 3LBXB 1WYCA 3AEGA 4UV9B 5DQWA 3T1HT 3PV0F 3CWZB 4KI0F 4HEAA 2Q9QC 2C5KT 2UUBT 4EGWA 4H9QC 4O4HE 3ZJ1A 4OK0A 4JI2T 5FNVE 3PU3A 3JAEA 3JC6C 2Q9QD 2XZEA 2XHEB 4PFOA 3OTOT 4LF4T 3P7IA 3JC6D 2BYRA 3SFDA 2YKSA 3NKZA 4I43B 1QUUA 2LSIA 2KMFA 5HEUA 5KZUA 4DV5T 4HFBA 3TKLB 3R6NA 1SE7A 5HCMA 4CN1A 4UXNB 3N2KE 2XYSA 1Z0PA 2NW9A 4P0AA 3G06A 5HXEA 3U8JA 5LNKA 2BJ0A 4QX7B 2PH9A 2H3RA 2IC6A 4F6RC 3UFEA 4HGAA 3UFGA 3UU8A 3SS1A 3FZLB 2ODVA 5HAXA 3M65A 2NTYA 2CBJA 4ZK1A 4U3CA 3U78A 2H89A 5HEHA 4HFIA 4NIQA 1R8IA 5LGUB 1WYBA 3C50A 3NZQA 3UT5E 5LXBA 4ZI3C 3H3MA 1MMGA 5AQSB 4QXBB 1IBKT 2X0LB 4H9OC 5DABA 4DV3T 4ZI3D 1HNXT 3BK9A 4CI3B 5LYJE 2KNDA 3GMIA 5M4YA 5JH7E 4PJMA 1MMNA 1MMDA 3ZMZB 2WBLA 3AA6B 4IL9A 4PAGA 2YU1A 2XZ6A 2Y54A 4NPPA 4DV2T 4ZRUA 1FEWA 4EXTA 1Y64B 4AFGA 1MIVA 3AB3B 5ADXL 3EAMA 2LT3A 2JMHA 2W62A 5HXRA 3PUVF 1HCIA 3WTNA 5A1LA 3SIOA 2VQFT 4IREA 3HKCE 3RIUC 5LGTB 3UU3A 2EHOB 1XDOA 2XQ5A 4EYYR 2WAUA 5JREA 2CXFA 1WRDA 3WTHA 5AFKA 2CA5A 2E5LT 3SQ6A 2SPCA 5JR9B 4GK5E 3ZT6A 3ZCIA 3ONXA 3ZT5A 3AVSA 3S4UA 2Y56A 4LFCT 2C5IT 2JMKA 1BR2A 3AA0B 4I50E 3HKBE 4Z91A 3CQXC 5C3JA 4CQIA 1ZKEA 4NXMT 5FMNA 1D0XA 3SOLA 4DR4T 4O4IE 1NEKA 2EHOC 3UTKA 5AQRB 3LFMA 3A8YC 2LE8A 2WN9A 1VCTA 4H9RC 2VKOA 4DMWA 2ZJVA 3N9OA 5J5GA 3KBTA 2EHOD 4YSXA 3I9YA 2VKJA 3CIRA 5LBMA 5JR9C 4OX9T 1JNZA 1HNWT 4ZS2A 4Z8XA 3LDQB 4ISTA 3AE3A 2CPTA 4EAHA 5JDQA 2UUAT 2WDVA 4QKNA 2LSJA 1WR6A 3ABVA 3HKDE 2C9TA 3T8OA 2NP9A 3RIUA 4MALA 3DJBA 5JTGA 5HWXA 5JDMA 5F3JA 4UEMA 2YN6A 3CMLA 3F2EA 2YDQA 3N2GE 3IEEA 3P4RA 5J2TE 5HXCA 5LMNT 2ZJUA 1DU2A 2WZYA 2M6BA 1HG5A 3ZPOA 3I0OA 1N33T 3MZKB 5EK3A 5LG3A 3AE8A 4P09A 4EEBA 3AE1A 4CN6A 3PDYA 4TX5A 2LOSA 2P9BA 2VKHA 4N78D 4MFRA 1UUSA 3JAFA 3CX7B 2FJBA 3ANWA 2FJEA 1ZEEA 4CXWA 3PUZF 3ETVA 3AAAB 4UF0B 3FZFB 2IC9A 5LXTE 2PFVA 4BFQA 2FJAA 4U33A 4HFHA 4NZBA 4H9NC 2J62A 5LA6E 4UIGA 3AVRA 5TVCA 2WZIA 3LK42 4XK9A 2Y57A 4Z90A 3WTIA 4LF6T 5AQFB 4QHOA 4KP3C 4ILCA 2CBIA 2I6HA 4PK4A 3X1DA 3RRWA 5JDFA 4DNDA 5LB7B 5L3BB 5J1GA 1ZV4X 4A97A 3RIFA 3PUYF 2BZBA 2LM9A 2E9XC 3AEEA 5ETWA 3RGLA 2QC1B 2WP9A 1J5ET 2UUCT 3ZLIA 3SFEA 1D0YA 2IUBA 3ONLC 2BYNA 2E9XD 4MBQA 4K0KT 2WSSV 2BBJA 3AXJA 4AKGA 5HEOA 4LF9T 1UV6A 4HN9A 2K24A 5BR8T 2VL8A 3B13A 1BR1A 3KV5A 4OYJA 3C51A 2DWGA 1SHZC 3QUJA 1OEDB 3RX6A 3TLWA 3IA3A 4Q25A 2WY2A 4UVBB 4IE4A 5JDLA 2ACZA 4CZZB 1V9DA 3PUWF 3LK3B 4ZZBA 2HPLA 3TLSA 2BG9E 4BQTA 2RA1A 4WZXA 3RYFE 2BS2A 3OVUA 4DR5T 4LMLA 2PBIA 2CCQA 4AKIA 2XPKA 4DV6T 2UXXB 4O2BE 3P4QA 3K3OA 2Y8DA 1UW6A 3LJCA 4B3MT 3EDUA 3QK6A 1KNPA 2YK0A 4GYRA 3E22E 1D1AA 3EI0A 2C0SA 1OEDE 1LVFA 2CLYB 2X9HA 5L3FB 2BYQA 4CN4A 1W0BA 5KXJA 4KX6A 3EVYA 4X20E 3O4XE 4YJ2E 3RLFF 2WNCA 1S94A 2V6YA 3RIAA 5L4EA 2XNTA 2YINA 3BQKA 2UXNB 3HR0A 4FRRA 2KINB 1XNRT 2W0GA 3N9LA 3VR9A 2LEHA 4KBMB 3UU6A 3FBLA 4ZK4A 3KBUA 4PK5A 3AECA 2XUEA 5HWYA 4DO0A 3KVBA 1OXZA 3OPCA 2WNLA 2ZM6T 5L3CB 4LFAT 5KX5E 3RQUA 2WDRA 3PEOA 3Q9DA 2W00A 5FXVA 4DUZT 3VKHA 1M62A 5GONE 4ADZA 3IHRA 2OLTA 4EZ1A 3B57A 4DR2T 1IJ6A 1IBLT 2M6IA 4ZOLE 5FY0A 2KZ7B 3I1AA 4QACA 4H9PC 5LJMA 3ZC0A 5ABHA 4XHEA 2L9QA 4AQFA 4ALXA 2BR8A 2Y48B 3AE7A 2DCFA 3J9X1 1D1CA 3ESLA 3ZMUB 4A5XA 3PE0A 3TLVA 2XQ6A 1IZNB 2BKNA 2L3LA 2WM9A 5HEGA 2K3WA 5DQVA 3BQIA 3HI2A 4ZS3A 3ZMVB 4AKLA 5J5HA 3GN5B 3ZDGA 2I0MA 3H3AA 5F8PA 3OYXA 3AA1B 3C4ZA 4EYUA 4XBFB 5L2LA 2M67A 1HF8A 4IDPA 2WNJA 5AFLA 2F4VT 3Q5DA 5EK4A 5AQLB 2D5UA 4HFVA 4JI7T 5AQHB 3FHNA 4CXYA 2Y58A 3MXZA 4YTMA 1UGOA 4XAXB 3VKGA 4YSZA 4IIJE 4ILAA 4JI0T 4UV8B 3C64A 2Q9QA 1W09A 1X9BA 2NOXA 4WYVA 4G2AA 4HTEA 3QOFA 2NWBA 4QX8B 2HN2A 3ZSTA 4DV1T 2BKPA 5H6QB 1XZYA 4UVAB 2WS3A 2JQHA 3UUNA 3EUHA 3F31A 1XMQT 2PG8A 3B5MA 4JEHB 4TNVA 5EK2A 2XNUA 3AEAA 4E7ZA 2RPAA 3LBXA 2PTFA 3L3PA 3MKDA 2V7JA 1MNEA 1I9BA 5FVKA 4NXNT 1LRZA 4HFCA 3AE5A 4B3TT 5LHGB 2J1DG 4UM3A 2XQYA 4DIDB 2CXDA 4LF8T 1O3XA 2NW8A 4OFZA 5ABFA 4FI5A 2K48A 4TZ4C 5AQPB 2AXDS 2XM2A 3O1IA 1UK5A 2DI4A 5AQMB 4CXXA 3ZCJA 4L9IA 2XQ3A 5HCJA 2XQ8A 5J5FA 1XWMA 3ANWB 4F8HA 2UU9T 5AFNA 3KV9A 1HX1B 5AFHA 4I55E 2D0TA 4OYKA 2JQKA 4DV4T 3P4SA 4YXDA 5BW2A 4TN7B 4O4JE 4JV5T 3UULA 4QXCB 5FY1A 2JIWA 2CWOA 4UR9A 3SRZA 2VVSA 2IHR1 1OWAA 4DBMA 5AQJB 5FJVA 1YQ3A 2JRKA 3NVOA 2X0HA 4LMJA 3ZYMA 2BR7A 3P50A 2C5JA 2XSAA 3AA7B 4X5TA 1QSDA 1MIYA 2VWAA 1VRBA 4UM3P 5L47A 2X0YA 1IAPA 2X9WA 2WQYA 4YTPA 5KMGP 2H88A 5JDNA 4DBQA 4GIWA 1WLXA 3VR8A 4CI1B 1XDPA 3AEBA 1IBMT 2G0UA 1QLBA 2V6XA 3UUBA 4IDZA 2N9DA 3PUXF 3JADA 3C79A 4DVDA 3RC8A 4X62T 4COFA 3C4WA 3T4MA 3U8MA 2ZMAA 4QABA 3MJXA 3UU5A 4AFTA 2YU2A 3PUAA 2EHOA 3U8KA 5AQIB 4EOZB 3CVRA 1VCSA 3KV6A 2BYSA 2CHOA 4PJJA 4ZEYA 5FL1A 4UELA 3SH1A 3RYCE 4PJLA 3UU4A 2E8IA 4YHHT 1WCRA 3UQ7A 5JR9A 3KINB 3RYHE 1IJ5A 4AIUA 3L8RA 2KSRA 5IWAT 4AKRB 5CA0E 3GWHA 2LRKA 2MBGA 5AQGB 3WAKA 1Y01A 4X64T 3LSVA 2BBHA 3O1HA 4DR7T 1NENA 4AI6A 1T98A 2VK9A 4M1PA 1BR0A 5BRXA 1T72A 3Q5WA 3FZMB 3RHWA 4HWFA 5IYZE 5ABGA 1B7TA 2LRLA 1UX2A 4YLHA 4AKHA 4YSYA 2DHRA 2NW7A 2W8FA 2YEVC 3K8PC 1M7KA 4U2YA 1N34T 1L0VA 3UUXB 4KMCA 3CQCB 1MNDA 1KFYA 1BR4A 3UUMA 4A56A 2BG9B 1HNZT 5CJ5A 4U2ZA 3D0TA 3OBVE 4IDOA 3AEDA 3FZKB 1E1HB 1LKXA 3FBZA 3CPZA 3NBXX 2W61A 2QA7A 2ES0A 5AQUB 1W9RA 5AQKB 3HKEE 4IHJE 2YDSA 4XZCA 4ISSA 5AFUL 4IE0A 4X65T 4JEUB 2V5DA
chains in the Genus database with same CATH topology
5BW2A 2Y57A 4ILBA 4Z90A 4B5DA 3WTIA 3JAEA 4ILAA 2BYSA 3IGQA 4IL9A 4LMKA 3WTKA 4LMLA 4TWFA 2XZ6A 2M6IA 4ILCA 3SH1A 2Y54A 2X00D 2XYTA 3C84A 3TLUA 4QACA 3UU4A 4NPPA 5L4HA 5JMEA 3UQ7A 5AFMA 2PGZA 1UW6A 4ZRUA 2BG9C 3U8LA 2BYRA 4UM1A 2YKSA 4AFGA 2C9TA 4HQPA 3EAMA 2XZ5A 4QAAA 5HEJA 4XHEA 4DBMA 5HEUA 4QH4A 5KZUA 3EI0A 4A97A 4UXUA 2KSRA 4HFDA 3TLTA 5FJVA 3WTNA 4ALXA 1OEDE 5AFMB 4HFBA 4UY2A 2BR8A 4QH1A 3SIOA 2BG9A 2YN6A 4LMJA 4ZR6A 3RIFA 2BYQA 4IREA 3LSVA 2BR7A 3P50A 5HCMA 4WV9A 2QC1B 4X5TA 3UU3A 3TLVA 2XYSA 5J5IA 2XQ6A 2W8GA 4TNVA 5BRXA 2XQ5A 2XNUA 2WNCA 5AINA 5KE4A 5HEGA 3U8JA 3RHWA 2ZJUA 2WZYA 4ZJTA 2Y7YA 4UM3P 5L47A 2XQ4A 2BYNA 3WIPA 2YOEA 4D01A 2M6BA 3RIAA 2BJ0A 2XNVA 2LM2A 3WTHA 2YMDA 5L4EA 1UX2A 5AFKA 1OEDC 2PH9A 2XNTA 2VL0A 3SQ6A 2W8FA 5J5HA 3EHZA 5HEOA 3UU8A 5SYOA 4ZZCA 1I9BA 4FRRA 3UQ4A 5LG3A 1UV6A 3ZKRA 3PMZA 3ZDGA 2LKGA 5AFJA 3UU6A 2Y56A 2XQ9A 4HFCA 4ZK4A 4UM3S 4ZK1A 1OEDA 3RQWA 4ZJSA 5CFBA 5HEHA 2YMEA 2XQ7A 4HFIA 3GUAA 2LLYA 4UM3A 5BP0A 4Z91A 5J0ZA 4IL4A 3UUBA 2BG9B 4TWDA 2MAWA 4AFHA 3JAFA 5LXBA 5CO5A 4TWHA 4QH5A 3SQ9A 2XQAA 3JADA 2WNJA 3C79A 2WNLA 5AFLA 1OEDB 2LKHA 3WTOA 3TLWA 3WTLA 4A98A 3RQUA 2X00A 4EZ1A 3PEOA 4COFA 3T4MA 2XQ3A 5HCJA 3WTJA 4BFQA 2XQ8A 5J5FA 2WN9A 3U8MA 4TNWA 4F8HA 4HFHA 2UZ6A 3U8NA 2ZJVA 4NZBA 4QABA 4HFEA 5AFNA 3TLSA 4ZZBA 2BG9E 5J5GA 3P4WA 3UU5A 2Y58A 4BQTA 5AFHA 3WTMA 5TVCA 3RI5A 4PIRA 4AFTA 2BYPA 3U8KA 4XK9A 3ZDHA 5IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BW2 A;  2Y57 A;  4ILB A;  4Z90 A;  4B5D A;  3WTI A;  3JAE A;  4ILA A;  2BYS A;  3IGQ A;  4IL9 A;  4LMK A;  3WTK A;  4LML A;  4TWF A;  2XZ6 A;  2M6I A;  4ILC A;  3SH1 A;  2Y54 A;  2X00 D;  2XYT A;  3C84 A;  3TLU A;  4QAC A;  3UU4 A;  4NPP A;  5L4H A;  5JME A;  3UQ7 A;  5AFM A;  2PGZ A;  1UW6 A;  4ZRU A;  2BG9 C;  3U8L A;  2BYR A;  4UM1 A;  2YKS A;  4AFG A;  2C9T A;  4HQP A;  3EAM A;  2XZ5 A;  4QAA A;  5HEJ A;  4XHE A;  4DBM A;  5HEU A;  4QH4 A;  5KZU A;  3EI0 A;  4A97 A;  4UXU A;  2KSR A;  4HFD A;  3TLT A;  5FJV A;  3WTN A;  4ALX A;  1OED E;  5AFM B;  4HFB A;  4UY2 A;  2BR8 A;  4QH1 A;  3SIO A;  2BG9 A;  2YN6 A;  4LMJ A;  4ZR6 A;  3RIF A;  2BYQ A;  4IRE A;  3LSV A;  2BR7 A;  3P50 A;  5HCM A;  4WV9 A;  2QC1 B;  4X5T A;  3UU3 A;  3TLV A;  2XYS A;  5J5I A;  2XQ6 A;  2W8G A;  4TNV A;  5BRX A;  2XQ5 A;  2XNU A;  2WNC A;  5AIN A;  5KE4 A;  5HEG A;  3U8J A;  3RHW A;  2ZJU A;  2WZY A;  4ZJT A;  2Y7Y A;  4UM3 P;  5L47 A;  2XQ4 A;  2BYN A;  3WIP A;  2YOE A;  4D01 A;  2M6B A;  3RIA A;  2BJ0 A;  2XNV A;  2LM2 A;  3WTH A;  2YMD A;  5L4E A;  1UX2 A;  5AFK A;  1OED C;  2PH9 A;  2XNT A;  2VL0 A;  3SQ6 A;  2W8F A;  5J5H A;  3EHZ A;  5HEO A;  3UU8 A;  5SYO A;  4ZZC A;  1I9B A;  4FRR A;  3UQ4 A;  5LG3 A;  1UV6 A;  3ZKR A;  3PMZ A;  3ZDG A;  2LKG A;  5AFJ A;  3UU6 A;  2Y56 A;  2XQ9 A;  4HFC A;  4ZK4 A;  4UM3 S;  4ZK1 A;  1OED A;  3RQW A;  4ZJS A;  5CFB A;  5HEH A;  2YME A;  2XQ7 A;  4HFI A;  3GUA A;  2LLY A;  4UM3 A;  5BP0 A;  4Z91 A;  5J0Z A;  4IL4 A;  3UUB A;  2BG9 B;  4TWD A;  2MAW A;  4AFH A;  3JAF A;  5LXB A;  5CO5 A;  4TWH A;  4QH5 A;  3SQ9 A;  2XQA A;  3JAD A;  2WNJ A;  3C79 A;  2WNL A;  5AFL A;  1OED B;  2LKH A;  3WTO A;  3TLW A;  3WTL A;  4A98 A;  3RQU A;  2X00 A;  4EZ1 A;  3PEO A;  4COF A;  3T4M A;  2XQ3 A;  5HCJ A;  3WTJ A;  4BFQ A;  2XQ8 A;  5J5F A;  2WN9 A;  3U8M A;  4TNW A;  4F8H A;  4HFH A;  2UZ6 A;  3U8N A;  2ZJV A;  4NZB A;  4QAB A;  4HFE A;  5AFN A;  3TLS A;  4ZZB A;  2BG9 E;  5J5G A;  3P4W A;  3UU5 A;  2Y58 A;  4BQT A;  5AFH A;  3WTM A;  5TVC A;  3RI5 A;  4PIR A;  4AFT A;  2BYP A;  3U8K A;  4XK9 A;  3ZDH A;  5IUX A; 
#chains in the Genus database with same CATH topology
 1KNR A;  4ILB A;  3C4X A;  4ZHQ E;  1I94 T;  3ZMS B;  1HG2 A;  1WR0 A;  4U72 A;  5JRC A;  3CX6 B;  3MAC A;  4WNK A;  4AXP A;  1YW0 A;  3R84 B;  1ZOY A;  2BG9 C;  2CMR A;  2N1G A;  1XMO T;  4I0U A;  4DUY T;  3VRA A;  3WI3 A;  4ZI2 C;  3TLT A;  2BS3 A;  2VAS A;  3P4P A;  4KHP T;  4JBW F;  3EDV A;  4ZI2 D;  4DV0 T;  3OYZ A;  5J5I A;  2X67 A;  1FIO A;  2XSB A;  2E9X A;  2YOE A;  4D01 A;  2Z6E A;  2LM2 A;  2XNV A;  2YMD A;  1OED C;  1T8B A;  5LBQ B;  1D1B A;  4B3S T;  1E2A A;  5LJN A;  4GKK T;  2WWU A;  1U5P A;  1GQE A;  3ZYL A;  1KNZ A;  3PMZ A;  2LKG A;  4PNI A;  2BDE A;  4HWI B;  2BS4 A;  3OKQ A;  2LSK A;  4U7I A;  4UVC B;  3CK6 A;  4QWN B;  2V1D B;  3SWH A;  2LKH A;  3CQG B;  3N9M A;  2W67 A;  2BKO A;  3L39 A;  2HN1 A;  5AQO B;  1YXR A;  1N36 T;  4X1I E;  2WCA A;  4TNW A;  4CI2 B;  4H9S E;  2UZ6 A;  1HR0 T;  3T1Y T;  3P4W A;  3K1S A;  2D2S A;  4H63 H;  5FP3 A;  5FKY A;  3PJA J;  2X68 A;  2ZM2 A;  2CLY C;  4LMK A;  1KEY A;  4X66 T;  4JUY A;  1MIW A;  5AFM A;  2RP4 A;  4TV9 E;  4HE8 A;  3PUR A;  1VOM A;  4HWH A;  2PJQ A;  2Q9Q B;  2HPJ A;  4P1N A;  3QNU A;  2AE9 A;  3J7Y q;  3HL6 A;  4BJM A;  5EZY E;  4MLK A;  2V7I A;  4ILU A;  5AQN B;  3AE2 A;  3N9Q A;  2DWK A;  2JPF A;  2UXB T;  5HYA A;  1KF6 A;  2J4G A;  4QXH B;  4YY3 T;  2WDQ A;  3ZKR A;  3QB5 A;  2CM0 A;  1WFD A;  3N9N A;  4UM3 S;  4YT0 A;  2KT9 A;  2LLY A;  1HX8 A;  2D9D A;  2WZH A;  4EIW A;  3NWI A;  4IL4 A;  2HH7 A;  2MAW A;  3RC3 A;  2QGS A;  1JNR A;  3C98 B;  5JDH A;  3P8C D;  3L09 A;  2IML A;  2JJ9 A;  3H37 A;  3VHL A;  5ABF B;  4YFS A;  5J2U E;  2K9A A;  4LFB T;  3Q2M A;  3K3Q C;  3WTM A;  5LCY A;  4DBR A;  2B76 A;  2N2N A;  2XJ7 A;  2W4X A;  4YTN A;  4O8S A;  1X79 A;  5LOV E;  4JI6 T;  3IGQ A;  2XAG B;  3MK7 C;  1YD8 G;  3RKO A;  2K5B B;  2XYT A;  3A7M A;  5C2T A;  2ZM8 A;  2XY8 B;  5FYM A;  2ODU A;  4HQP A;  5HEJ A;  5HXH A;  3ZEF B;  4ERR A;  2NR4 A;  4ZXL A;  4L5G A;  2CWY A;  4EB6 E;  2QYW A;  2H7V C;  2VKD A;  5CB4 E;  4ZJT A;  3A5X A;  1YQ4 A;  4L0R A;  4TV8 E;  3ONJ A;  1E7P A;  2VUR A;  2NTX A;  1W0A A;  3RRC A;  3EHZ A;  2J47 A;  5FXZ A;  1FMW A;  3UQ4 A;  4YJ3 E;  2L8K A;  3RKG A;  2XQ9 A;  2V7K A;  4JLE A;  2H7O A;  5CFB A;  4EZH A;  2XQ7 A;  4OHF A;  1NWM X;  2XAF B;  4TWD A;  4AFH A;  2QVA A;  3WTO A;  3PUS A;  4PFP A;  2W2U A;  3K3N A;  2CXL A;  3FB2 A;  4O2A E;  4DR3 T;  5HXS A;  3PJA A;  2OV9 A;  1J1J A;  2IAK A;  4B3R T;  4HFE A;  2DL1 A;  5KDM C;  4DV7 T;  4PIR A;  3N9P A;  3ZDH A;  1ZP0 A;  5IUX A;  3LK2 B;  4B5D A;  5LGN B;  3WTK A;  2IDO B;  3PUG A;  1CHU A;  3V5U A;  1XNQ T;  3TLU A;  3GN5 A;  5JME A;  5LP6 E;  3U8L A;  4BJN A;  3I0Q A;  2X51 A;  5LMU T;  3QB5 K;  1YKH B;  2XZ5 A;  4QAA A;  2CEA A;  4LF7 T;  4QH4 A;  4EV6 A;  2BVM A;  4HFD A;  1UUR A;  2XAJ B;  4ZR6 A;  2XAH B;  1LVK A;  4BA9 A;  4JI8 T;  2IIU A;  5AQV B;  3KFW X;  3F57 A;  4E7S A;  2E2A A;  2Y7Y A;  2BVL A;  4EZ4 A;  5FL0 A;  5TAO A;  4ZZC A;  1SUM B;  5E0O A;  3AAE B;  5L3E B;  2CHN A;  5AFJ A;  3OJA A;  3PTR B;  5LHH B;  3KDS E;  2XAS B;  4BAY B;  4MHC A;  3AAI A;  1HFA A;  2V26 A;  1H7C A;  4H63 V;  5J0Z A;  2LHR A;  2LJL A;  3LG7 A;  4QH5 A;  4G63 A;  1SA0 E;  4O4L E;  1YKE B;  2WWV A;  3WTL A;  1MMA A;  2JQ9 A;  2MPK A;  1AJ3 A;  2FJD A;  3AXJ B;  3U8N A;  5BMV E;  4U7Y A;  2BYP A;  3M3Z B;  3PU8 A;  3KV4 A;  2R6G F;  4J2C A;  4WW0 A;  3RF1 A;  2YDR A;  5JQG E;  1KK7 A;  2WMO A;  2B1E A;  4PW8 A;  5JRC B;  1HTJ F;  5DJQ C;  5FY7 A;  2CE7 A;  4U31 A;  4LF5 T;  1FJG T;  4UY2 A;  4KHZ F;  2A2F X;  3FXD B;  2VB6 A;  4WV9 A;  4B6X A;  3ZT7 A;  3ZJ2 A;  2V8S V;  1UX5 A;  4I4T E;  2WU2 A;  2MOZ A;  1T7S A;  2XQ4 A;  5IHY A;  3ZN1 B;  4IE7 A;  2A3D A;  1UCU A;  4HKA A;  1D0Z A;  4JI5 T;  2XM1 A;  2CRB A;  2E9X B;  2FUP A;  2YME A;  3O1J A;  3ZN0 B;  2ZLY A;  3KVA A;  2A9U A;  3AE6 A;  5CO5 A;  3SQ9 A;  2V5C A;  2XQA A;  5L3G B;  4GYS A;  4V1A v;  1G8X A;  2WMN A;  3IBP A;  3HA4 A;  4ASK A;  1HS7 A;  4C91 A;  3RYI E;  2V6Y B;  3FXE B;  2KLQ A;  3GA8 A;  4K0U A;  3CKD A;  3NRX A;  2I59 A;  3N2O A;  3RI5 A;  2XTL A;  2HHH T;  5FXW A;  2MYS A;  1Z8U A;  5JDG A;  2Y6X A;  3ETU A;  5CA1 E;  4TWF A;  3N5L A;  2KWH A;  2X00 D;  4IGU A;  2DLR A;  1I6Z A;  5L4H A;  3ZSS A;  4HWC A;  3AE4 A;  4PJN A;  4TUY E;  2PGZ A;  3MA9 A;  4IDQ A;  3VU7 H;  3E08 A;  3ZC1 A;  4IT4 A;  3RH3 A;  2V7L A;  5AFM B;  2X9X A;  1J5W A;  4QH1 A;  4P0B A;  3AEF A;  3FZH B;  4DR6 T;  5FVL A;  2X66 A;  2OA5 A;  4AIS A;  4WBO A;  4YHJ A;  2W63 A;  3U3I A;  2W8G A;  5AIN A;  4WBN E;  2W66 A;  2X9Y A;  2QRX A;  2VL0 A;  2LSY A;  3AE9 A;  1US7 B;  2MTQ A;  2A72 A;  2E5V A;  3RQW A;  3DP7 A;  4ZJS A;  4JI1 T;  4UF0 A;  3GUA A;  1FMV A;  5AQQ B;  2LHN A;  5BP0 A;  2DNX A;  3RPU A;  3PUQ A;  2VQE T;  2KWI B;  2V7M A;  4TWH A;  5H6R B;  2ZM0 A;  4PK6 A;  2LSG A;  1G73 A;  2X00 A;  3I9W A;  5ABE A;  3QC9 A;  3WTJ A;  3DTO A;  4IE6 A;  3ZYK A;  4EED A;  4KUM B;  4C90 A;  5F5W A;  5FXX A;  4NUV A;  3WAJ A;  3Q5E A;  4AQG A;  2JQQ A;  3JCF A;  3Q5X A;  2ACX A;  5C8Y E;  2WU5 A;  1U4Q A;  5L3D B;  4DMV A;  3BQL A;  4IDN A;  2D0U A;  4JYA T;  3C84 A;  4AQF C;  3NZP A;  4UM1 A;  3W15 B;  4DR1 T;  4X1Y E;  3EAB A;  3IF8 B;  2GK9 A;  3NRY A;  4UXU A;  1EZ3 A;  2BG9 A;  3ZMT B;  4X1K E;  4ZI7 E;  2UXC T;  1NAF A;  3E0Z A;  4FJO A;  4GKJ T;  5KE4 A;  3WIP A;  4ANJ A;  2VVN A;  2FBW A;  2UXD T;  5AQT B;  4JI3 T;  2KXP B;  5SYO A;  5LHI B;  1S35 A;  1N32 T;  4AQY T;  1ZHC A;  4GK0 E;  5CGM A;  2IW5 B;  3VRB A;  1OED A;  2XAQ B;  4GOU A;  4U74 A;  3O9X A;  1CUN A;  2WB5 A;  4JI4 T;  4IE5 A;  3V5S A;  5JVD E;  3CX8 B;  5LG4 A;  4HWD A;  2LOP A;  4A98 A;  4NUU A;  1UX4 A;  3LBX B;  1WYC A;  3AEG A;  4UV9 B;  5DQW A;  3T1H T;  3PV0 F;  3CWZ B;  4KI0 F;  4HEA A;  2Q9Q C;  2C5K T;  2UUB T;  4EGW A;  4H9Q C;  4O4H E;  3ZJ1 A;  4OK0 A;  4JI2 T;  5FNV E;  3PU3 A;  3JAE A;  3JC6 C;  2Q9Q D;  2XZE A;  2XHE B;  4PFO A;  3OTO T;  4LF4 T;  3P7I A;  3JC6 D;  2BYR A;  3SFD A;  2YKS A;  3NKZ A;  4I43 B;  1QUU A;  2LSI A;  2KMF A;  5HEU A;  5KZU A;  4DV5 T;  4HFB A;  3TKL B;  3R6N A;  1SE7 A;  5HCM A;  4CN1 A;  4UXN B;  3N2K E;  2XYS A;  1Z0P A;  2NW9 A;  4P0A A;  3G06 A;  5HXE A;  3U8J A;  5LNK A;  2BJ0 A;  4QX7 B;  2PH9 A;  2H3R A;  2IC6 A;  4F6R C;  3UFE A;  4HGA A;  3UFG A;  3UU8 A;  3SS1 A;  3FZL B;  2ODV A;  5HAX A;  3M65 A;  2NTY A;  2CBJ A;  4ZK1 A;  4U3C A;  3U78 A;  2H89 A;  5HEH A;  4HFI A;  4NIQ A;  1R8I A;  5LGU B;  1WYB A;  3C50 A;  3NZQ A;  3UT5 E;  5LXB A;  4ZI3 C;  3H3M A;  1MMG A;  5AQS B;  4QXB B;  1IBK T;  2X0L B;  4H9O C;  5DAB A;  4DV3 T;  4ZI3 D;  1HNX T;  3BK9 A;  4CI3 B;  5LYJ E;  2KND A;  3GMI A;  5M4Y A;  5JH7 E;  4PJM A;  1MMN A;  1MMD A;  3ZMZ B;  2WBL A;  3AA6 B;  4IL9 A;  4PAG A;  2YU1 A;  2XZ6 A;  2Y54 A;  4NPP A;  4DV2 T;  4ZRU A;  1FEW A;  4EXT A;  1Y64 B;  4AFG A;  1MIV A;  3AB3 B;  5ADX L;  3EAM A;  2LT3 A;  2JMH A;  2W62 A;  5HXR A;  3PUV F;  1HCI A;  3WTN A;  5A1L A;  3SIO A;  2VQF T;  4IRE A;  3HKC E;  3RIU C;  5LGT B;  3UU3 A;  2EHO B;  1XDO A;  2XQ5 A;  4EYY R;  2WAU A;  5JRE A;  2CXF A;  1WRD A;  3WTH A;  5AFK A;  2CA5 A;  2E5L T;  3SQ6 A;  2SPC A;  5JR9 B;  4GK5 E;  3ZT6 A;  3ZCI A;  3ONX A;  3ZT5 A;  3AVS A;  3S4U A;  2Y56 A;  4LFC T;  2C5I T;  2JMK A;  1BR2 A;  3AA0 B;  4I50 E;  3HKB E;  4Z91 A;  3CQX C;  5C3J A;  4CQI A;  1ZKE A;  4NXM T;  5FMN A;  1D0X A;  3SOL A;  4DR4 T;  4O4I E;  1NEK A;  2EHO C;  3UTK A;  5AQR B;  3LFM A;  3A8Y C;  2LE8 A;  2WN9 A;  1VCT A;  4H9R C;  2VKO A;  4DMW A;  2ZJV A;  3N9O A;  5J5G A;  3KBT A;  2EHO D;  4YSX A;  3I9Y A;  2VKJ A;  3CIR A;  5LBM A;  5JR9 C;  4OX9 T;  1JNZ A;  1HNW T;  4ZS2 A;  4Z8X A;  3LDQ B;  4IST A;  3AE3 A;  2CPT A;  4EAH A;  5JDQ A;  2UUA T;  2WDV A;  4QKN A;  2LSJ A;  1WR6 A;  3ABV A;  3HKD E;  2C9T A;  3T8O A;  2NP9 A;  3RIU A;  4MAL A;  3DJB A;  5JTG A;  5HWX A;  5JDM A;  5F3J A;  4UEM A;  2YN6 A;  3CML A;  3F2E A;  2YDQ A;  3N2G E;  3IEE A;  3P4R A;  5J2T E;  5HXC A;  5LMN T;  2ZJU A;  1DU2 A;  2WZY A;  2M6B A;  1HG5 A;  3ZPO A;  3I0O A;  1N33 T;  3MZK B;  5EK3 A;  5LG3 A;  3AE8 A;  4P09 A;  4EEB A;  3AE1 A;  4CN6 A;  3PDY A;  4TX5 A;  2LOS A;  2P9B A;  2VKH A;  4N78 D;  4MFR A;  1UUS A;  3JAF A;  3CX7 B;  2FJB A;  3ANW A;  2FJE A;  1ZEE A;  4CXW A;  3PUZ F;  3ETV A;  3AAA B;  4UF0 B;  3FZF B;  2IC9 A;  5LXT E;  2PFV A;  4BFQ A;  2FJA A;  4U33 A;  4HFH A;  4NZB A;  4H9N C;  2J62 A;  5LA6 E;  4UIG A;  3AVR A;  5TVC A;  2WZI A;  3LK4 2;  4XK9 A;  2Y57 A;  4Z90 A;  3WTI A;  4LF6 T;  5AQF B;  4QHO A;  4KP3 C;  4ILC A;  2CBI A;  2I6H A;  4PK4 A;  3X1D A;  3RRW A;  5JDF A;  4DND A;  5LB7 B;  5L3B B;  5J1G A;  1ZV4 X;  4A97 A;  3RIF A;  3PUY F;  2BZB A;  2LM9 A;  2E9X C;  3AEE A;  5ETW A;  3RGL A;  2QC1 B;  2WP9 A;  1J5E T;  2UUC T;  3ZLI A;  3SFE A;  1D0Y A;  2IUB A;  3ONL C;  2BYN A;  2E9X D;  4MBQ A;  4K0K T;  2WSS V;  2BBJ A;  3AXJ A;  4AKG A;  5HEO A;  4LF9 T;  1UV6 A;  4HN9 A;  2K24 A;  5BR8 T;  2VL8 A;  3B13 A;  1BR1 A;  3KV5 A;  4OYJ A;  3C51 A;  2DWG A;  1SHZ C;  3QUJ A;  1OED B;  3RX6 A;  3TLW A;  3IA3 A;  4Q25 A;  2WY2 A;  4UVB B;  4IE4 A;  5JDL A;  2ACZ A;  4CZZ B;  1V9D A;  3PUW F;  3LK3 B;  4ZZB A;  2HPL A;  3TLS A;  2BG9 E;  4BQT A;  2RA1 A;  4WZX A;  3RYF E;  2BS2 A;  3OVU A;  4DR5 T;  4LML A;  2PBI A;  2CCQ A;  4AKI A;  2XPK A;  4DV6 T;  2UXX B;  4O2B E;  3P4Q A;  3K3O A;  2Y8D A;  1UW6 A;  3LJC A;  4B3M T;  3EDU A;  3QK6 A;  1KNP A;  2YK0 A;  4GYR A;  3E22 E;  1D1A A;  3EI0 A;  2C0S A;  1OED E;  1LVF A;  2CLY B;  2X9H A;  5L3F B;  2BYQ A;  4CN4 A;  1W0B A;  5KXJ A;  4KX6 A;  3EVY A;  4X20 E;  3O4X E;  4YJ2 E;  3RLF F;  2WNC A;  1S94 A;  2V6Y A;  3RIA A;  5L4E A;  2XNT A;  2YIN A;  3BQK A;  2UXN B;  3HR0 A;  4FRR A;  2KIN B;  1XNR T;  2W0G A;  3N9L A;  3VR9 A;  2LEH A;  4KBM B;  3UU6 A;  3FBL A;  4ZK4 A;  3KBU A;  4PK5 A;  3AEC A;  2XUE A;  5HWY A;  4DO0 A;  3KVB A;  1OXZ A;  3OPC A;  2WNL A;  2ZM6 T;  5L3C B;  4LFA T;  5KX5 E;  3RQU A;  2WDR A;  3PEO A;  3Q9D A;  2W00 A;  5FXV A;  4DUZ T;  3VKH A;  1M62 A;  5GON E;  4ADZ A;  3IHR A;  2OLT A;  4EZ1 A;  3B57 A;  4DR2 T;  1IJ6 A;  1IBL T;  2M6I A;  4ZOL E;  5FY0 A;  2KZ7 B;  3I1A A;  4QAC A;  4H9P C;  5LJM A;  3ZC0 A;  5ABH A;  4XHE A;  2L9Q A;  4AQF A;  4ALX A;  2BR8 A;  2Y48 B;  3AE7 A;  2DCF A;  3J9X 1;  1D1C A;  3ESL A;  3ZMU B;  4A5X A;  3PE0 A;  3TLV A;  2XQ6 A;  1IZN B;  2BKN A;  2L3L A;  2WM9 A;  5HEG A;  2K3W A;  5DQV A;  3BQI A;  3HI2 A;  4ZS3 A;  3ZMV B;  4AKL A;  5J5H A;  3GN5 B;  3ZDG A;  2I0M A;  3H3A A;  5F8P A;  3OYX A;  3AA1 B;  3C4Z A;  4EYU A;  4XBF B;  5L2L A;  2M67 A;  1HF8 A;  4IDP A;  2WNJ A;  5AFL A;  2F4V T;  3Q5D A;  5EK4 A;  5AQL B;  2D5U A;  4HFV A;  4JI7 T;  5AQH B;  3FHN A;  4CXY A;  2Y58 A;  3MXZ A;  4YTM A;  1UGO A;  4XAX B;  3VKG A;  4YSZ A;  4IIJ E;  4ILA A;  4JI0 T;  4UV8 B;  3C64 A;  2Q9Q A;  1W09 A;  1X9B A;  2NOX A;  4WYV A;  4G2A A;  4HTE A;  3QOF A;  2NWB A;  4QX8 B;  2HN2 A;  3ZST A;  4DV1 T;  2BKP A;  5H6Q B;  1XZY A;  4UVA B;  2WS3 A;  2JQH A;  3UUN A;  3EUH A;  3F31 A;  1XMQ T;  2PG8 A;  3B5M A;  4JEH B;  4TNV A;  5EK2 A;  2XNU A;  3AEA A;  4E7Z A;  2RPA A;  3LBX A;  2PTF A;  3L3P A;  3MKD A;  2V7J A;  1MNE A;  1I9B A;  5FVK A;  4NXN T;  1LRZ A;  4HFC A;  3AE5 A;  4B3T T;  5LHG B;  2J1D G;  4UM3 A;  2XQY A;  4DID B;  2CXD A;  4LF8 T;  1O3X A;  2NW8 A;  4OFZ A;  5ABF A;  4FI5 A;  2K48 A;  4TZ4 C;  5AQP B;  2AXD S;  2XM2 A;  3O1I A;  1UK5 A;  2DI4 A;  5AQM B;  4CXX A;  3ZCJ A;  4L9I A;  2XQ3 A;  5HCJ A;  2XQ8 A;  5J5F A;  1XWM A;  3ANW B;  4F8H A;  2UU9 T;  5AFN A;  3KV9 A;  1HX1 B;  5AFH A;  4I55 E;  2D0T A;  4OYK A;  2JQK A;  4DV4 T;  3P4S A;  4YXD A;  5BW2 A;  4TN7 B;  4O4J E;  4JV5 T;  3UUL A;  4QXC B;  5FY1 A;  2JIW A;  2CWO A;  4UR9 A;  3SRZ A;  2VVS A;  2IHR 1;  1OWA A;  4DBM A;  5AQJ B;  5FJV A;  1YQ3 A;  2JRK A;  3NVO A;  2X0H A;  4LMJ A;  3ZYM A;  2BR7 A;  3P50 A;  2C5J A;  2XSA A;  3AA7 B;  4X5T A;  1QSD A;  1MIY A;  2VWA A;  1VRB A;  4UM3 P;  5L47 A;  2X0Y A;  1IAP A;  2X9W A;  2WQY A;  4YTP A;  5KMG P;  2H88 A;  5JDN A;  4DBQ A;  4GIW A;  1WLX A;  3VR8 A;  4CI1 B;  1XDP A;  3AEB A;  1IBM T;  2G0U A;  1QLB A;  2V6X A;  3UUB A;  4IDZ A;  2N9D A;  3PUX F;  3JAD A;  3C79 A;  4DVD A;  3RC8 A;  4X62 T;  4COF A;  3C4W A;  3T4M A;  3U8M A;  2ZMA A;  4QAB A;  3MJX A;  3UU5 A;  4AFT A;  2YU2 A;  3PUA A;  2EHO A;  3U8K A;  5AQI B;  4EOZ B;  3CVR A;  1VCS A;  3KV6 A;  2BYS A;  2CHO A;  4PJJ A;  4ZEY A;  5FL1 A;  4UEL A;  3SH1 A;  3RYC E;  4PJL A;  3UU4 A;  2E8I A;  4YHH T;  1WCR A;  3UQ7 A;  5JR9 A;  3KIN B;  3RYH E;  1IJ5 A;  4AIU A;  3L8R A;  2KSR A;  5IWA T;  4AKR B;  5CA0 E;  3GWH A;  2LRK A;  2MBG A;  5AQG B;  3WAK A;  1Y01 A;  4X64 T;  3LSV A;  2BBH A;  3O1H A;  4DR7 T;  1NEN A;  4AI6 A;  1T98 A;  2VK9 A;  4M1P A;  1BR0 A;  5BRX A;  1T72 A;  3Q5W A;  3FZM B;  3RHW A;  4HWF A;  5IYZ E;  5ABG A;  1B7T A;  2LRL A;  1UX2 A;  4YLH A;  4AKH A;  4YSY A;  2DHR A;  2NW7 A;  2W8F A;  2YEV C;  3K8P C;  1M7K A;  4U2Y A;  1N34 T;  1L0V A;  3UUX B;  4KMC A;  3CQC B;  1MND A;  1KFY A;  1BR4 A;  3UUM A;  4A56 A;  2BG9 B;  1HNZ T;  5CJ5 A;  4U2Z A;  3D0T A;  3OBV E;  4IDO A;  3AED A;  3FZK B;  1E1H B;  1LKX A;  3FBZ A;  3CPZ A;  3NBX X;  2W61 A;  2QA7 A;  2ES0 A;  5AQU B;  1W9R A;  5AQK B;  3HKE E;  4IHJ E;  2YDS A;  4XZC A;  4ISS A;  5AFU L;  4IE0 A;  4X65 T;  4JEU B;  2V5D A; 
#chains in the Genus database with same CATH homology
 5BW2 A;  2Y57 A;  4ILB A;  4Z90 A;  4B5D A;  3WTI A;  3JAE A;  4ILA A;  2BYS A;  3IGQ A;  4IL9 A;  4LMK A;  3WTK A;  4LML A;  4TWF A;  2XZ6 A;  2M6I A;  4ILC A;  3SH1 A;  2Y54 A;  2X00 D;  2XYT A;  3C84 A;  3TLU A;  4QAC A;  3UU4 A;  4NPP A;  5L4H A;  5JME A;  3UQ7 A;  5AFM A;  2PGZ A;  1UW6 A;  4ZRU A;  2BG9 C;  3U8L A;  2BYR A;  4UM1 A;  2YKS A;  4AFG A;  2C9T A;  4HQP A;  3EAM A;  2XZ5 A;  4QAA A;  5HEJ A;  4XHE A;  4DBM A;  5HEU A;  4QH4 A;  5KZU A;  3EI0 A;  4A97 A;  4UXU A;  2KSR A;  4HFD A;  3TLT A;  5FJV A;  3WTN A;  4ALX A;  1OED E;  5AFM B;  4HFB A;  4UY2 A;  2BR8 A;  4QH1 A;  3SIO A;  2BG9 A;  2YN6 A;  4LMJ A;  4ZR6 A;  3RIF A;  2BYQ A;  4IRE A;  3LSV A;  2BR7 A;  3P50 A;  5HCM A;  4WV9 A;  2QC1 B;  4X5T A;  3UU3 A;  3TLV A;  2XYS A;  5J5I A;  2XQ6 A;  2W8G A;  4TNV A;  5BRX A;  2XQ5 A;  2XNU A;  2WNC A;  5AIN A;  5KE4 A;  5HEG A;  3U8J A;  3RHW A;  2ZJU A;  2WZY A;  4ZJT A;  2Y7Y A;  4UM3 P;  5L47 A;  2XQ4 A;  2BYN A;  3WIP A;  2YOE A;  4D01 A;  2M6B A;  3RIA A;  2BJ0 A;  2XNV A;  2LM2 A;  3WTH A;  2YMD A;  5L4E A;  1UX2 A;  5AFK A;  1OED C;  2PH9 A;  2XNT A;  2VL0 A;  3SQ6 A;  2W8F A;  5J5H A;  3EHZ A;  5HEO A;  3UU8 A;  5SYO A;  4ZZC A;  1I9B A;  4FRR A;  3UQ4 A;  5LG3 A;  1UV6 A;  3ZKR A;  3PMZ A;  3ZDG A;  2LKG A;  5AFJ A;  3UU6 A;  2Y56 A;  2XQ9 A;  4HFC A;  4ZK4 A;  4UM3 S;  4ZK1 A;  1OED A;  3RQW A;  4ZJS A;  5CFB A;  5HEH A;  2YME A;  2XQ7 A;  4HFI A;  3GUA A;  2LLY A;  4UM3 A;  5BP0 A;  4Z91 A;  5J0Z A;  4IL4 A;  3UUB A;  2BG9 B;  4TWD A;  2MAW A;  4AFH A;  3JAF A;  5LXB A;  5CO5 A;  4TWH A;  4QH5 A;  3SQ9 A;  2XQA A;  3JAD A;  2WNJ A;  3C79 A;  2WNL A;  5AFL A;  1OED B;  2LKH A;  3WTO A;  3TLW A;  3WTL A;  4A98 A;  3RQU A;  2X00 A;  4EZ1 A;  3PEO A;  4COF A;  3T4M A;  2XQ3 A;  5HCJ A;  3WTJ A;  4BFQ A;  2XQ8 A;  5J5F A;  2WN9 A;  3U8M A;  4TNW A;  4F8H A;  4HFH A;  2UZ6 A;  3U8N A;  2ZJV A;  4NZB A;  4QAB A;  4HFE A;  5AFN A;  3TLS A;  4ZZB A;  2BG9 E;  5J5G A;  3P4W A;  3UU5 A;  2Y58 A;  4BQT A;  5AFH A;  3WTM A;  5TVC A;  3RI5 A;  4PIR A;  4AFT A;  2BYP A;  3U8K A;  4XK9 A;  3ZDH A;  5IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...