4NPPA

The glic-his10 wild-type structure in equilibrium between the open and locally-closed (lc) forms
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a pentameric ligand-gated ion channel provide a mechanism for activation.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4nppA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4nppA01
4QAAA 4ZZCA 5HCMA 3C79A 4COFA 2W8GA 5KE4A 2LLYA 2YOEA 4ILAA 2WZYA 4ZJSA 5L4HA 5L47A 2WN9A 5HEHA 4NPPA 5AFLA 4UM3A 2BR7A 5BP0A 5CO5A 4DBMA 5LXBA 4HFIA 3PMZA 4BQTA 4TWDA 1OEDA 2XQ9A 4LMJA 4AFHA 2BJ0A 2Y58A 3PEOA 2XQ6A 2BR8A 5J5HA 2KSRA 4QH1A 2XNVA 2VL0A 2XQ3A 3U8JA 4B5DA 5BRXA 1UW6A 2XNTA 3WTIA 4LMLA 3SQ9A 2LM2A 4QABA 4TWFA 2LKHA 3SH1A 5HEGA 3UQ4A 2YKSA 3ZKRA 3WTKA 2XZ5A 4ZZBA 4XK9A 3U8LA 2X00D 2XYTA 5HEJA 3UQ7A 3EI0A 2C9TA 2BYQA 3P50A 3UU8A 3ZDHA 2MAWA 3IGQA 4HFBA 3WTNA 1I9BA 4ZK4A 2XQ4A 4TNVA 5AFMB 2BG9A 5LG3A 2XQ7A 5HEUA 2BYPA 3C84A 4HFEA 4WV9A 5HCJA 2Y56A 5KZUA 4IL9A 3RHWA 2XQAA 3UU4A 2BG9B 4EZ1A 3TLSA 5HEOA 3JAEA 4A97A 2BYSA 2YMDA 3P4WA 4QACA 2XZ6A 5AFHA 4Z91A 3LSVA 1OEDB 1UV6A 2BG9C 5AFJA 5L4EA 4F8HA 4UM3S 3WTJA 4HFHA 2QC1B 4AFTA 2XQ8A 2M6BA 1OEDE 4UY2A 4PIRA 3RIAA 3ZDGA 2XYSA 4BFQA 3T4MA 5AFNA 1UX2A 4ZRUA 3UU3A 2BYNA 2Y54A 3SIOA 2XQ5A 4ZJTA 3WTHA 2BG9E 4NZBA 3UUBA 3U8NA 3WTMA 5AINA 4QH4A 4HFCA 4LMKA 2W8FA 2WNCA 5J0ZA 4TWHA 3WTOA 4D01A 2Y7YA 4Z90A 5JMEA 3SQ6A 5AFKA 5BW2A 2XNUA 5IUXA 5J5GA 2X00A 2YMEA 3TLVA 3WIPA 4ZK1A 3JAFA 4UXUA 4X5TA 4AFGA 3RIFA 2ZJUA 2LKGA 5J5IA 4UM1A 2YN6A 3EAMA 2WNLA 2WNJA 3TLWA 4ZR6A 4HQPA 5CFBA 5TVCA 4IREA 3U8KA 4TNWA 2Y57A 3TLTA 3UU6A 4UM3P 3RQWA 4XHEA 4ILBA 2PGZA 5SYOA 3GUAA 3EHZA 1OEDC 2M6IA 4A98A 2BYRA 4QH5A 2UZ6A 3U8MA 5AFMA 4ILCA 3WTLA 3RI5A 4HFDA 3RQUA 3TLUA 4IL4A 3JADA 2ZJVA 4FRRA 5FJVA 3UU5A 2PH9A 5J5FA 4ALXA
chains in the Genus database with same CATH superfamily
2MOZA 4B6XA 3A5XA 5KE4A 4P0BA 3N2OA 2W0GA 1JNZA 4X64T 3ONLC 5LGNB 3ZT7A 1B7TA 5AQPB 3HL6A 3PE0A 1ZP0A 4QH1A 2XQ3A 4UVBB 1MMGA 1H7CA 2JQ9A 1N33T 2X67A 3WTIA 4DNDA 4IDNA 4GK5E 4DR2T 4QKNA 3ZDHA 2H3RA 3IGQA 3AA1B 2XQ4A 3Q5DA 5KX5E 1SE7A 3CX6B 2B76A 3LJCA 4EZ1A 5FXXA 2C5IT 3T1HT 3H3MA 1I94T 2Q9QB 3HA4A 5JDNA 3RYHE 3AE3A 3WAKA 4L9IA 3AEDA 2D0UA 2XQ5A 5CJ5A 3VHLA 5GONE 5AINA 5JR9A 2PBIA 2K24A 5J0ZA 3H37A 5JMEA 4YLHA 4GOUA 3NZPA 3KV4A 2LEHA 1MMAA 2CE7A 2CCQA 3HI2A 2WWUA 4I4TE 3KVBA 5J5IA 2YN6A 4KBMB 3TLWA 2H7VC 4FJOA 4EZ4A 2EHOB 2YK0A 4AKLA 4I55E 2ACXA 5SYOA 2CXFA 4QH5A 5ADXL 1E2AA 3ZT5A 1WRDA 3JADA 4JI7T 5FJVA 3KV5A 4OK0A 5HCMA 4UIGA 1XNQT 4LF4T 4ASKA 2VVSA 4NPPA 5AQGB 4UM3A 5AFLA 4BQTA 3PMZA 4HEAA 4YTNA 3FBLA 4QWNB 3JC6C 3E0ZA 4ZZBA 4XK9A 1KNPA 2BYQA 1J5WA 2MAWA 4UV8B 3C64A 4TNVA 1W9RA 3P4SA 3AB3B 2OV9A 3EUHA 1N36T 2MTQA 4YSZA 5L3DB 1X79A 4A5XA 3EVYA 2HHHT 4HWDA 5AFHA 3BK9A 4LF5T 5LHGB 3FZHB 2ZM0A 5HXEA 4UVAB 5BMVE 1XNRT 4DR7T 2Y6XA 4HGAA 2KWIB 3ZMVB 5L3FB 4N78D 3WTMA 4IE7A 1UX4A 2JJ9A 2XAJB 1JNRA 1KK7A 4AI6A 2WU2A 4CN6A 5DQWA 4PJJA 3RIFA 5JTGA 1QSDA 1T72A 4YTMA 4ZR6A 4U7IA 1YD8G 3N9LA 4DV2T 2W62A 4MHCA 2W67A 4IE6A 4OYKA 5LG4A 1YW0A 4WYVA 2CHOA 4FRRA 2CXDA 2XQYA 4MALA 2V7LA 4U2YA 1UURA 3IF8B 3HKBE 3G06A 3UULA 4H9RC 5L47A 5BP0A 5LXBA 3KV6A 2BDEA 3ABVA 5L3GB 2BVLA 2VL0A 2XNTA 2LM9A 1W09A 2J62A 3VR9A 3WTKA 4CQIA 4OHFA 4JYAT 4QX8B 5AFMB 2CEAA 4ZS3A 2BKOA 4WV9A 2IIUA 5HCJA 1HNZT 3KBUA 2Z6EA 2V7JA 3RH3A 4GK0E 4H9OC 4JEHB 4EYYR 4ANJA 3BQIA 4MFRA 3LK42 3ZDGA 2HN1A 5JR9B 2E9XB 3CQGB 3ZMZB 5CGMA 1IJ5A 3WTHA 3V5UA 4ADZA 2JRKA 1WCRA 1SA0E 1BR1A 4YHHT 3ESLA 3P7IA 4YXDA 3CIRA 2WMOA 5HXCA 3QK6A 1R8IA 5HXRA 4IREA 2J4GA 4FI5A 5AQVB 4XHEA 2Q9QD 2UZ6A 4U3CA 3RI5A 1FJGT 1D1AA 1ZHCA 3NRXA 1Y01A 4O2AE 2D5UA 5ABHA 2ZMAA 5EK4A 3ZC1A 3LG7A 3AE1A 2BS4A 4TX5A 3AEFA 1D1BA 2DI4A 3LDQB 3UFGA 4U72A 2XUEA 4U2ZA 3ZMTB 1HG5A 1UCUA 3M65A 3P50A 4DV6T 4DBQA 4EXTA 3OPCA 5FY1A 2BKPA 2VVNA 1D0ZA 4JI4T 3RHWA 1ZV4X 3GN5B 2I59A 4ISSA 1E7PA 3F31A 1XDOA 2ODUA 2V6XA 3Q5XA 3PUYF 2YU2A 5EZYE 4JV5T 3OKQA 2CWYA 1BR4A 5L3CB 2ACZA 3SIOA 2V1DB 2ZM2A 4CZZB 5JQGE 3UUBA 2V5DA 3WTOA 2D0TA 1HNXT 1BR2A 4JLEA 3RX6A 2ZJUA 3ONXA 4UM1A 5AQLB 3EDVA 3DJBA 1IBMT 1FIOA 4IDQA 5C8YE 3CX7B 1HNWT 1MIVA 2XPKA 5JDGA 3E08A 5J5FA 3AE6A 3ZYKA 1CHUA 4B3MT 3PUVF 2WCAA 3L09A 2V7KA 4H9QC 3AE2A 3PJAJ 2BR7A 4PW8A 3S4UA 4WNKA 5F5WA 4GYSA 4IHJE 2N2NA 3WI3A 3AXJA 3U3IA 1O3XA 4PJMA 3ZCIA 1Z0PA 2XZ5A 4PK4A 5LJMA 2CM0A 4O4HE 3BQLA 3VR8A 1LRZA 5LHHB 1YQ4A 4CXYA 4JI1T 4HFEA 3SRZA 2NTXA 2N9DA 3RIUA 3HKCE 4L0RA 5HEOA 3H3AA 2QYWA 2LT3A 3RC8A 1VRBA 5TAOA 4TV9E 4EZHA 4A56A 4JI8T 4DV0T 2BBJA 2LHNA 4XBFB 3KDSE 3FZKB 4ZI2C 3EABA 5LMUT 1G73A 4HWFA 5LYJE 1HX1B 2WAUA 4B3TT 3WAJA 5J5GA 2X00A 5LNKA 3WIPA 2BZBA 4X5TA 3EAMA 2KWHA 2E5VA 5LHIB 3ONJA 3AEBA 2OA5A 3N9OA 5CB4E 2Y57A 1VOMA 4ILBA 4DUYT 1OEDC 2UUCT 4HFDA 5AQQB 1T7SA 3UU5A 2AE9A 3ZC0A 2W66A 4MLKA 5JDFA 4IGUA 5L4HA 5CO5A 2OLTA 3J9X1 3P4QA 3T8OA 1HS7A 2KSRA 2H88A 2A9UA 2G0UA 5HEGA 3NWIA 3N9QA 3ZN1B 1NENA 2BVMA 3ZYLA 3D0TA 4G63A 4JI5T 2QRXA 4IDOA 4HFVA 4IT4A 4UELA 3RF1A 5AQOB 1BR0A 1IBKT 2LSJA 2BYSA 3JAEA 3IEEA 2LE8A 4QACA 5FYMA 3CK6A 4Z91A 3AE5A 5HAXA 2CLYC 2UUAT 3LFMA 5FNVE 3AXJB 2PFVA 2DCFA 2YDQA 2VQFT 4IIJE 4ZJTA 2HN2A 3U8NA 3AAAB 2W8FA 2FBWA 2LSGA 4DUZT 3VU7H 3R84B 3ZJ1A 4UXUA 4AFGA 2Q9QC 4DMWA 2KMFA 2WQYA 3OTOT 4LFBT 5F3JA 1WR0A 4ZI3D 3OYZA 4ILCA 3WTLA 5H6RB 4DVDA 3N5LA 4IL4A 4JI0T 3N2GE 4HE8A 1WLXA 2ES0A 2W8GA 4OFZA 5HEHA 4UF0A 4X66T 5J1GA 4DR6T 4K0UA 1X9BA 5J2UE 3U8JA 2C0SA 3SH1A 3N2KE 4MBQA 2J1DG 5M4YA 1XDPA 2EHOA 2IW5B 4PK5A 3UU8A 1IJ6A 1I9BA 4PFOA 3K3OA 2XQ7A 5HEUA 2BYPA 4PK6A 4LF6T 3E22E 2YDRA 3R6NA 2Y56A 2X9XA 4YJ2E 3I0OA 2NW7A 1US7B 3SS1A 2XAFB 3CVRA 3W15B 2NW9A 3LSVA 1OEDB 3FHNA 3SFDA 2JQKA 2K48A 4Z8XA 4GKKT 3RIAA 2WS3A 4PJLA 5AFNA 2BYNA 4ZI2D 5H6QB 4X20E 4EAHA 4Z90A 1FMVA 3SQ6A 1XZYA 4AQFC 3DTOA 2YMEA 4O4IE 2WNLA 2WNJA 1G8XA 5HYAA 4OYJA 5TVCA 1XMOT 4XAXB 2X66A 1LVFA 2E8IA 2WP9A 3AAEB 3ZYMA 4DR4T 4KUMB 4P1NA 2PG8A 3PDYA 4YY3T 2MYSA 4HWCA 2BR8A 5JRCA 3PUZF 2F4VT 4B5DA 3RC3A 2V7IA 1U5PA 4LMLA 1HCIA 2LKHA 3ZT6A 1NWMX 2XAHB 4DBRA 2W63A 2VASA 3UQ7A 3P4RA 2C9TA 3ZMSB 5AFUL 2E5LT 2VL8A 5FY0A 2LRKA 2X9WA 3AECA 3LBXB 3T1YT 5FXWA 3TLSA 1QLBA 2NW8A 2JQQA 2BG9C 5AFJA 4F8HA 5FVKA 3B57A 4CXXA 3WTJA 4UY2A 2FJAA 3X1DA 2V7MA 4NXMT 5AQUB 3U78A 2X9HA 5KMGP 2K5BB 4X1IE 2Y7YA 3OVUA 4AKRB 4JBWF 3AE4A 2FJBA 2W61A 3AEGA 1Y64B 1MIWA 3AEEA 2VWAA 5FL1A 3J7Yq 3QC9A 4HWIB 1KEYA 3NKZA 3RPUA 3AA6B 4UM3P 2K9AA 2LRLA 3PJAA 3FZFB 5EK3A 2VKOA 4QAAA 4UV9B 3PV0F 4OX9T 2P9BA 5LJNA 2WBLA 4DV5T 5DJQC 3C50A 1OEDA 2XQ9A 2Y58A 3PEOA 1UUSA 3FZMB 4BAYB 4IE0A 4GYRA 4AQGA 2MPKA 1FEWA 1J1JA 2WWVA 3SFEA 1SHZC 2QGSA 3L3PA 3CWZB 3ZMUB 1ZEEA 2VK9A 1CUNA 5A1LA 4E7ZA 1MMDA 3C84A 1VCTA 5KZUA 5AQFB 2EHOD 4DR1T 3QB5K 3VRBA 2YMDA 3RRCA 5LOVE 2UXNB 3ZSTA 5DQVA 2D9DA 3OBVE 2CRBA 4HWHA 4TN7B 2WDVA 1UX2A 3UUMA 3UU3A 5ETWA 3ZSSA 4QH4A 2JMHA 4YT0A 4JI6T 5AQTB 3UTKA 4AISA 2XNUA 4H63H 2DHRA 5JDQA 2C5KT 2UXXB 5CFBA 1UX5A 1LVKA 3MACA 2N1GA 1L0VA 2CBIA 4AKGA 5LMNT 3RQWA 3AVRA 4PNIA 3QUJA 3O1HA 3DP7A 4O2BE 4EB6E 4ALXA 4COFA 4YTPA 4AQYT 1YKEB 4UVCB 2EHOC 4P0AA 4CN1A 1MNDA 1IAPA 2QA7A 3CPZA 5FXVA 5LBMA 2WM9A 3OYXA 5J5HA 5BRXA 3UQ4A 4LF8T 2XYTA 1GQEA 3QNUA 4EIWA 2LSYA 1V9DA 5FL0A 4L5GA 3RLFF 3IHRA 4IE5A 5AQSB 3MXZA 3VKGA 4F6RC 2ZM6T 4QXHB 5L3BB 5EK2A 2DNXA 2LOSA 1ZOYA 3K1SA 3RKGA 2BKNA 1YQ3A 4ZEYA 4DV3T 4ZRUA 3C51A 2Y54A 3Q9DA 2BS3A 2BG9E 5JVDE 4AIUA 3PTRB 3F2EA 4KHZF 4D01A 4AXPA 5C3JA 2PJQA 4NUVA 3HR0A 5IUXA 2W2UA 4EV6A 3UUNA 1VCSA 3RRWA 2IAKA 5IYZE 3RYIE 5FMNA 2VKDA 4H9SE 3EDUA 2VB6A 2V6YA 3MJXA 4HTEA 2C5JA 4NIQA 2SPCA 1NEKA 3Q5EA 3NBXX 4X62T 4AKIA 3HKEE 2XHEB 5KDMC 3QB5A 3ETVA 3C79A 2WN9A 3IBPA 3GWHA 4H9NC 5CA0E 2V8SV 4H63V 2XQ6A 3SWHA 4U7YA 2CPTA 2UXCT 2X9YA 2LHRA 4JEUB 4HN9A 4I43B 4B3ST 5HEJA 4NXNT 1OWAA 4QHOA 2X0LB 2AXDS 5AQNB 4IL9A 1MMNA 3UU4A 4YSYA 3RYFE 4EEBA 4BA9A 3P4WA 4DMVA 5ABFB 1KNZA 5LGUB 5HWYA 5L4EA 4O8SA 2H89A 1OXZA 4KP3C 2QC1B 3HKDE 3NRYA 1J5ET 5HXSA 1HFAA 3C4XA 2CWOA 2LKGA 1XWMA 3C98B 1D0YA 4DV4T 2UU9T 1W0BA 4LFAT 3I1AA 2XTLA 2WZIA 3GUAA 2BYRA 2XSAA 4ZI3C 3FBZA 2IUBA 3RQUA 2L9QA 2HPLA 2KZ7B 1HX8A 2KLQA 3JCFA 1LKXA 4M1PA 4CI2B 2JPFA 3NZQA 2WZYA 4X1KE 4ZJSA 3LBXA 4V1Av 2L8KA 4Q25A 3PUWF 3FB2A 2RP4A 3CKDA 2WDRA 1UW6A 2YEVC 3AE7A 2WU5A 4QABA 5HWXA 3ZKRA 4LF7T 4LF9T 2X00D 1D1CA 2WSSV 4HFBA 3VKHA 5L2LA 2BG9A 4ZI7E 1UK5A 5LP6E 2IHR1 4DV7T 1UV6A 2CMRA 3MZKB 3AAIA 3BQKA 2HPJA 1WYBA 2V26A 4EEDA 4HFCA 4X65T 1WR6A 2FJDA 4CI1B 4YFSA 3L39A 4EGWA 4TUYE 3RKOA 4IDZA 3RYCE 2X0HA 3GMIA 2VKHA 4WBOA 5IWAT 3P8CD 4O4LE 2PGZA 2Y48B 3CQCB 3Q5WA 1MNEA 2WMNA 4UF0B 2MBGA 1KNRA 2LLYA 2YOEA 2YDSA 2ODVA 4DBMA 3A7MA 5AQKB 5LGTB 5CA1E 3O9XA 4QX7B 1M7KA 2NOXA 2ZM8A 3MA9A 2V5CA 3N9NA 3AE8A 2J47A 4YHJA 1FMWA 3AE9A 2A3DA 3P4PA 4KX6A 1DU2A 4DR5T 5AQIB 4JUYA 4PAGA 5HXHA 3SOLA 4BJNA 2XM2A 4ZK4A 3WTNA 4IE4A 3NVOA 2IC6A 4I0UA 4UXNB 2Q9QA 2KNDA 2BG9B 3LK2B 4TV8E 2K3WA 4KI0F 3C4ZA 1HTJF 3RGLA 1MIYA 3N9PA 5LBQB 1YXRA 3ETUA 3UFEA 4HFHA 1OEDE 4BFQA 3CQXC 2RPAA 2XJ7A 2D2SA 1S35A 3A8YC 2DWGA 4PFPA 3PUAA 3K3QC 2BBHA 2WNCA 3PUQA 4GKJT 2WDQA 4I50E 5BW2A 3ANWA 4TZ4C 5FP3A 2XM1A 4XZCA 3ZJ2A 1IBLT 3KFWX 5FKYA 4U74A 3ZCJA 5ABFA 2RA1A 3EHZA 2M6IA 5AFMA 1KFYA 5L3EB 1UGOA 1I6ZA 2DL1A 2NTYA 1HR0T 2BS2A 2XAGB 4EYUA 4ZS2A 5AQMB 2IDOB 4U31A 4HFIA 4TWDA 4GIWA 3PURA 4AFHA 2BJ0A 2I6HA 3I9YA 3N9MA 2X51A 2IMLA 4QXBB 2HH7A 2YKSA 5FVLA 2VQET 2V6YB 1E1HB 2QVAA 5J2TE 4DR3T 5ABGA 5ABEA 4AQFA 2IC9A 2CA5A 2X68A 1SUMB 5F8PA 4JI3T 4ZOLE 3VRAA 5JH7E 2YU1A 3K3NA 4P09A 3AVSA 2CHNA 4A97A 3LK3B 4HKAA 3FXDB 4EOZB 3C4WA 2XYSA 3F57A 2LJLA 2VKJA 3B13A 3MK7C 3CMLA 3GA8A 5IHYA 4NZBA 4ISTA 4LMKA 4TWHA 2XZEA 5AFKA 1D0XA 2B1EA 2JQHA 2KXPB 2E9XD 5LCYA 4CXWA 4KMCA 4C91A 2X0YA 3ANWB 3M3ZB 3ZLIA 3Q2MA 1Z8UA 4G2AA 2A72A 3TLUA 3K8PC 1NAFA 3IA3A 5BR8T 4ZZCA 4ILAA 4O4JE 2WY2A 3CX8B 3B5MA 4BJMA 4LMJA 2DWKA 2XNVA 1N32T 4U33A 4CN4A 3SQ9A 2LM2A 2E9XA 2L3LA 4TWFA 3KV9A 5JRCB 3U8LA 3EI0A 5JREA 4ZHQE 1IZNB 2YINA 4WBNE 4DV1T 1W0AA 3JC6D 2PTFA 4ERRA 5LB7B 5JDLA 3PU3A 2H7OA 2CLYB 4DIDB 1T8BA 2Y8DA 2XAQB 3PUXF 3UUXB 2VURA 2NP9A 2LOPA 5AQJB 3KBTA 4AFTA 1WYCA 2M6BA 4UR9A 4WZXA 4IDPA 1XMQT 3TKLB 5FY7A 3AA0B 2NR4A 1S94A 3PUSA 4YSXA 2CXLA 3JAFA 1HG2A 2W4XA 4ZXLA 2E9XC 4HQPA 5JR9C 3GN5A 3ZPOA 2DLRA 3U8KA 4TNWA 4B3RT 3AA7B 4X1YE 3UU6A 2KINB 2XY8B 4YJ3E 2M67A 3U8MA 4A98A 4QXCB 2ZJVA 3RIUC 3KVAA 4DO0A 3OJAA 4AKHA 2FUPA 3PUGA 2E2AA 2LSKA 5FXZA 3UT5E 2JMKA 3PU8A 3FXEB 4C90A 1YKHB 4JI2T 4PJNA 4ILUA 2LSIA 2JIWA 5DABA 4E7SA 5LG3A 4KHPT 3V5SA 4WW0A 1AJ3A 3ZN0B 2W00A 2CBJA 4J2CA 2UUBT 5KXJA 1WFDA 2XQAA 1T98A 3QOFA 4UEMA 3AEAA 3MKDA 1ZKEA 2XZ6A 5AQHB 5AQRB 3FZLB 1U4QA 3O1IA 2FJEA 4UM3S 2XSBA 2NWBA 1M62A 5JDHA 2XQ8A 3KINB 4PIRA 3T4MA 5LXTE 2A2FX 5LA6E 2UXBT 5C2TA 3O4XE 1HF8A 2UXDT 4H9PC 2R6GF 2GK9A 5JDMA 2XASB 3I9WA 3ZEFB 4CI3B 2ZLYA 4ZK1A 3TLVA 4NUUA 1QUUA 3L8RA 1KF6A 4K0KT 1N34T 3TLTA 3I0QA 4LFCT 5E0OA 1EZ3A 3O1JA 2WB5A 2WZHA 2KT9A 2I0MA 2PH9A
chains in the Genus database with same CATH topology
4QAAA 4ZZCA 5HCMA 3C79A 4COFA 2W8GA 5KE4A 2LLYA 2YOEA 4ILAA 2WZYA 4ZJSA 5L4HA 5L47A 2WN9A 5HEHA 4NPPA 5AFLA 4UM3A 2BR7A 5BP0A 5CO5A 4DBMA 5LXBA 4HFIA 3PMZA 4BQTA 4TWDA 1OEDA 2XQ9A 4LMJA 4AFHA 2BJ0A 2Y58A 3PEOA 2XQ6A 2BR8A 5J5HA 2KSRA 4QH1A 2XNVA 2VL0A 2XQ3A 3U8JA 4B5DA 5BRXA 1UW6A 2XNTA 3WTIA 4LMLA 3SQ9A 2LM2A 4QABA 4TWFA 2LKHA 3SH1A 5HEGA 3UQ4A 2YKSA 3ZKRA 3WTKA 2XZ5A 4ZZBA 4XK9A 3U8LA 2X00D 2XYTA 5HEJA 3UQ7A 3EI0A 2C9TA 2BYQA 3P50A 3UU8A 3ZDHA 2MAWA 3IGQA 4HFBA 3WTNA 1I9BA 4ZK4A 2XQ4A 4TNVA 5AFMB 2BG9A 5LG3A 2XQ7A 5HEUA 2BYPA 3C84A 4HFEA 4WV9A 5HCJA 2Y56A 5KZUA 4IL9A 3RHWA 2XQAA 3UU4A 2BG9B 4EZ1A 3TLSA 5HEOA 3JAEA 4A97A 2BYSA 2YMDA 3P4WA 4QACA 2XZ6A 5AFHA 4Z91A 3LSVA 1OEDB 1UV6A 2BG9C 5AFJA 5L4EA 4F8HA 4UM3S 3WTJA 4HFHA 2QC1B 4AFTA 2XQ8A 2M6BA 1OEDE 4UY2A 4PIRA 3RIAA 3ZDGA 2XYSA 4BFQA 3T4MA 5AFNA 1UX2A 4ZRUA 3UU3A 2BYNA 2Y54A 3SIOA 2XQ5A 4ZJTA 3WTHA 2BG9E 4NZBA 3UUBA 3U8NA 3WTMA 5AINA 4QH4A 4HFCA 4LMKA 2W8FA 2WNCA 5J0ZA 4TWHA 3WTOA 4D01A 2Y7YA 4Z90A 5JMEA 3SQ6A 5AFKA 5BW2A 2XNUA 5IUXA 5J5GA 2X00A 2YMEA 3TLVA 3WIPA 4ZK1A 3JAFA 4UXUA 4X5TA 4AFGA 3RIFA 2ZJUA 2LKGA 5J5IA 4UM1A 2YN6A 3EAMA 2WNLA 2WNJA 3TLWA 4ZR6A 4HQPA 5CFBA 5TVCA 4IREA 3U8KA 4TNWA 2Y57A 3TLTA 3UU6A 4UM3P 3RQWA 4XHEA 4ILBA 2PGZA 5SYOA 3GUAA 3EHZA 1OEDC 2M6IA 4A98A 2BYRA 4QH5A 2UZ6A 3U8MA 5AFMA 4ILCA 3WTLA 3RI5A 4HFDA 3RQUA 3TLUA 4IL4A 3JADA 2ZJVA 4FRRA 5FJVA 3UU5A 2PH9A 5J5FA 4ALXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAA A;  4ZZC A;  5HCM A;  3C79 A;  4COF A;  2W8G A;  5KE4 A;  2LLY A;  2YOE A;  4ILA A;  2WZY A;  4ZJS A;  5L4H A;  5L47 A;  2WN9 A;  5HEH A;  4NPP A;  5AFL A;  4UM3 A;  2BR7 A;  5BP0 A;  5CO5 A;  4DBM A;  5LXB A;  4HFI A;  3PMZ A;  4BQT A;  4TWD A;  1OED A;  2XQ9 A;  4LMJ A;  4AFH A;  2BJ0 A;  2Y58 A;  3PEO A;  2XQ6 A;  2BR8 A;  5J5H A;  2KSR A;  4QH1 A;  2XNV A;  2VL0 A;  2XQ3 A;  3U8J A;  4B5D A;  5BRX A;  1UW6 A;  2XNT A;  3WTI A;  4LML A;  3SQ9 A;  2LM2 A;  4QAB A;  4TWF A;  2LKH A;  3SH1 A;  5HEG A;  3UQ4 A;  2YKS A;  3ZKR A;  3WTK A;  2XZ5 A;  4ZZB A;  4XK9 A;  3U8L A;  2X00 D;  2XYT A;  5HEJ A;  3UQ7 A;  3EI0 A;  2C9T A;  2BYQ A;  3P50 A;  3UU8 A;  3ZDH A;  2MAW A;  3IGQ A;  4HFB A;  3WTN A;  1I9B A;  4ZK4 A;  2XQ4 A;  4TNV A;  5AFM B;  2BG9 A;  5LG3 A;  2XQ7 A;  5HEU A;  2BYP A;  3C84 A;  4HFE A;  4WV9 A;  5HCJ A;  2Y56 A;  5KZU A;  4IL9 A;  3RHW A;  2XQA A;  3UU4 A;  2BG9 B;  4EZ1 A;  3TLS A;  5HEO A;  3JAE A;  4A97 A;  2BYS A;  2YMD A;  3P4W A;  4QAC A;  2XZ6 A;  5AFH A;  4Z91 A;  3LSV A;  1OED B;  1UV6 A;  2BG9 C;  5AFJ A;  5L4E A;  4F8H A;  4UM3 S;  3WTJ A;  4HFH A;  2QC1 B;  4AFT A;  2XQ8 A;  2M6B A;  1OED E;  4UY2 A;  4PIR A;  3RIA A;  3ZDG A;  2XYS A;  4BFQ A;  3T4M A;  5AFN A;  1UX2 A;  4ZRU A;  3UU3 A;  2BYN A;  2Y54 A;  3SIO A;  2XQ5 A;  4ZJT A;  3WTH A;  2BG9 E;  4NZB A;  3UUB A;  3U8N A;  3WTM A;  5AIN A;  4QH4 A;  4HFC A;  4LMK A;  2W8F A;  2WNC A;  5J0Z A;  4TWH A;  3WTO A;  4D01 A;  2Y7Y A;  4Z90 A;  5JME A;  3SQ6 A;  5AFK A;  5BW2 A;  2XNU A;  5IUX A;  5J5G A;  2X00 A;  2YME A;  3TLV A;  3WIP A;  4ZK1 A;  3JAF A;  4UXU A;  4X5T A;  4AFG A;  3RIF A;  2ZJU A;  2LKG A;  5J5I A;  4UM1 A;  2YN6 A;  3EAM A;  2WNL A;  2WNJ A;  3TLW A;  4ZR6 A;  4HQP A;  5CFB A;  5TVC A;  4IRE A;  3U8K A;  4TNW A;  2Y57 A;  3TLT A;  3UU6 A;  4UM3 P;  3RQW A;  4XHE A;  4ILB A;  2PGZ A;  5SYO A;  3GUA A;  3EHZ A;  1OED C;  2M6I A;  4A98 A;  2BYR A;  4QH5 A;  2UZ6 A;  3U8M A;  5AFM A;  4ILC A;  3WTL A;  3RI5 A;  4HFD A;  3RQU A;  3TLU A;  4IL4 A;  3JAD A;  2ZJV A;  4FRR A;  5FJV A;  3UU5 A;  2PH9 A;  5J5F A;  4ALX A; 
#chains in the Genus database with same CATH topology
 2MOZ A;  4B6X A;  3A5X A;  5KE4 A;  4P0B A;  3N2O A;  2W0G A;  1JNZ A;  4X64 T;  3ONL C;  5LGN B;  3ZT7 A;  1B7T A;  5AQP B;  3HL6 A;  3PE0 A;  1ZP0 A;  4QH1 A;  2XQ3 A;  4UVB B;  1MMG A;  1H7C A;  2JQ9 A;  1N33 T;  2X67 A;  3WTI A;  4DND A;  4IDN A;  4GK5 E;  4DR2 T;  4QKN A;  3ZDH A;  2H3R A;  3IGQ A;  3AA1 B;  2XQ4 A;  3Q5D A;  5KX5 E;  1SE7 A;  3CX6 B;  2B76 A;  3LJC A;  4EZ1 A;  5FXX A;  2C5I T;  3T1H T;  3H3M A;  1I94 T;  2Q9Q B;  3HA4 A;  5JDN A;  3RYH E;  3AE3 A;  3WAK A;  4L9I A;  3AED A;  2D0U A;  2XQ5 A;  5CJ5 A;  3VHL A;  5GON E;  5AIN A;  5JR9 A;  2PBI A;  2K24 A;  5J0Z A;  3H37 A;  5JME A;  4YLH A;  4GOU A;  3NZP A;  3KV4 A;  2LEH A;  1MMA A;  2CE7 A;  2CCQ A;  3HI2 A;  2WWU A;  4I4T E;  3KVB A;  5J5I A;  2YN6 A;  4KBM B;  3TLW A;  2H7V C;  4FJO A;  4EZ4 A;  2EHO B;  2YK0 A;  4AKL A;  4I55 E;  2ACX A;  5SYO A;  2CXF A;  4QH5 A;  5ADX L;  1E2A A;  3ZT5 A;  1WRD A;  3JAD A;  4JI7 T;  5FJV A;  3KV5 A;  4OK0 A;  5HCM A;  4UIG A;  1XNQ T;  4LF4 T;  4ASK A;  2VVS A;  4NPP A;  5AQG B;  4UM3 A;  5AFL A;  4BQT A;  3PMZ A;  4HEA A;  4YTN A;  3FBL A;  4QWN B;  3JC6 C;  3E0Z A;  4ZZB A;  4XK9 A;  1KNP A;  2BYQ A;  1J5W A;  2MAW A;  4UV8 B;  3C64 A;  4TNV A;  1W9R A;  3P4S A;  3AB3 B;  2OV9 A;  3EUH A;  1N36 T;  2MTQ A;  4YSZ A;  5L3D B;  1X79 A;  4A5X A;  3EVY A;  2HHH T;  4HWD A;  5AFH A;  3BK9 A;  4LF5 T;  5LHG B;  3FZH B;  2ZM0 A;  5HXE A;  4UVA B;  5BMV E;  1XNR T;  4DR7 T;  2Y6X A;  4HGA A;  2KWI B;  3ZMV B;  5L3F B;  4N78 D;  3WTM A;  4IE7 A;  1UX4 A;  2JJ9 A;  2XAJ B;  1JNR A;  1KK7 A;  4AI6 A;  2WU2 A;  4CN6 A;  5DQW A;  4PJJ A;  3RIF A;  5JTG A;  1QSD A;  1T72 A;  4YTM A;  4ZR6 A;  4U7I A;  1YD8 G;  3N9L A;  4DV2 T;  2W62 A;  4MHC A;  2W67 A;  4IE6 A;  4OYK A;  5LG4 A;  1YW0 A;  4WYV A;  2CHO A;  4FRR A;  2CXD A;  2XQY A;  4MAL A;  2V7L A;  4U2Y A;  1UUR A;  3IF8 B;  3HKB E;  3G06 A;  3UUL A;  4H9R C;  5L47 A;  5BP0 A;  5LXB A;  3KV6 A;  2BDE A;  3ABV A;  5L3G B;  2BVL A;  2VL0 A;  2XNT A;  2LM9 A;  1W09 A;  2J62 A;  3VR9 A;  3WTK A;  4CQI A;  4OHF A;  4JYA T;  4QX8 B;  5AFM B;  2CEA A;  4ZS3 A;  2BKO A;  4WV9 A;  2IIU A;  5HCJ A;  1HNZ T;  3KBU A;  2Z6E A;  2V7J A;  3RH3 A;  4GK0 E;  4H9O C;  4JEH B;  4EYY R;  4ANJ A;  3BQI A;  4MFR A;  3LK4 2;  3ZDG A;  2HN1 A;  5JR9 B;  2E9X B;  3CQG B;  3ZMZ B;  5CGM A;  1IJ5 A;  3WTH A;  3V5U A;  4ADZ A;  2JRK A;  1WCR A;  1SA0 E;  1BR1 A;  4YHH T;  3ESL A;  3P7I A;  4YXD A;  3CIR A;  2WMO A;  5HXC A;  3QK6 A;  1R8I A;  5HXR A;  4IRE A;  2J4G A;  4FI5 A;  5AQV B;  4XHE A;  2Q9Q D;  2UZ6 A;  4U3C A;  3RI5 A;  1FJG T;  1D1A A;  1ZHC A;  3NRX A;  1Y01 A;  4O2A E;  2D5U A;  5ABH A;  2ZMA A;  5EK4 A;  3ZC1 A;  3LG7 A;  3AE1 A;  2BS4 A;  4TX5 A;  3AEF A;  1D1B A;  2DI4 A;  3LDQ B;  3UFG A;  4U72 A;  2XUE A;  4U2Z A;  3ZMT B;  1HG5 A;  1UCU A;  3M65 A;  3P50 A;  4DV6 T;  4DBQ A;  4EXT A;  3OPC A;  5FY1 A;  2BKP A;  2VVN A;  1D0Z A;  4JI4 T;  3RHW A;  1ZV4 X;  3GN5 B;  2I59 A;  4ISS A;  1E7P A;  3F31 A;  1XDO A;  2ODU A;  2V6X A;  3Q5X A;  3PUY F;  2YU2 A;  5EZY E;  4JV5 T;  3OKQ A;  2CWY A;  1BR4 A;  5L3C B;  2ACZ A;  3SIO A;  2V1D B;  2ZM2 A;  4CZZ B;  5JQG E;  3UUB A;  2V5D A;  3WTO A;  2D0T A;  1HNX T;  1BR2 A;  4JLE A;  3RX6 A;  2ZJU A;  3ONX A;  4UM1 A;  5AQL B;  3EDV A;  3DJB A;  1IBM T;  1FIO A;  4IDQ A;  5C8Y E;  3CX7 B;  1HNW T;  1MIV A;  2XPK A;  5JDG A;  3E08 A;  5J5F A;  3AE6 A;  3ZYK A;  1CHU A;  4B3M T;  3PUV F;  2WCA A;  3L09 A;  2V7K A;  4H9Q C;  3AE2 A;  3PJA J;  2BR7 A;  4PW8 A;  3S4U A;  4WNK A;  5F5W A;  4GYS A;  4IHJ E;  2N2N A;  3WI3 A;  3AXJ A;  3U3I A;  1O3X A;  4PJM A;  3ZCI A;  1Z0P A;  2XZ5 A;  4PK4 A;  5LJM A;  2CM0 A;  4O4H E;  3BQL A;  3VR8 A;  1LRZ A;  5LHH B;  1YQ4 A;  4CXY A;  4JI1 T;  4HFE A;  3SRZ A;  2NTX A;  2N9D A;  3RIU A;  3HKC E;  4L0R A;  5HEO A;  3H3A A;  2QYW A;  2LT3 A;  3RC8 A;  1VRB A;  5TAO A;  4TV9 E;  4EZH A;  4A56 A;  4JI8 T;  4DV0 T;  2BBJ A;  2LHN A;  4XBF B;  3KDS E;  3FZK B;  4ZI2 C;  3EAB A;  5LMU T;  1G73 A;  4HWF A;  5LYJ E;  1HX1 B;  2WAU A;  4B3T T;  3WAJ A;  5J5G A;  2X00 A;  5LNK A;  3WIP A;  2BZB A;  4X5T A;  3EAM A;  2KWH A;  2E5V A;  5LHI B;  3ONJ A;  3AEB A;  2OA5 A;  3N9O A;  5CB4 E;  2Y57 A;  1VOM A;  4ILB A;  4DUY T;  1OED C;  2UUC T;  4HFD A;  5AQQ B;  1T7S A;  3UU5 A;  2AE9 A;  3ZC0 A;  2W66 A;  4MLK A;  5JDF A;  4IGU A;  5L4H A;  5CO5 A;  2OLT A;  3J9X 1;  3P4Q A;  3T8O A;  1HS7 A;  2KSR A;  2H88 A;  2A9U A;  2G0U A;  5HEG A;  3NWI A;  3N9Q A;  3ZN1 B;  1NEN A;  2BVM A;  3ZYL A;  3D0T A;  4G63 A;  4JI5 T;  2QRX A;  4IDO A;  4HFV A;  4IT4 A;  4UEL A;  3RF1 A;  5AQO B;  1BR0 A;  1IBK T;  2LSJ A;  2BYS A;  3JAE A;  3IEE A;  2LE8 A;  4QAC A;  5FYM A;  3CK6 A;  4Z91 A;  3AE5 A;  5HAX A;  2CLY C;  2UUA T;  3LFM A;  5FNV E;  3AXJ B;  2PFV A;  2DCF A;  2YDQ A;  2VQF T;  4IIJ E;  4ZJT A;  2HN2 A;  3U8N A;  3AAA B;  2W8F A;  2FBW A;  2LSG A;  4DUZ T;  3VU7 H;  3R84 B;  3ZJ1 A;  4UXU A;  4AFG A;  2Q9Q C;  4DMW A;  2KMF A;  2WQY A;  3OTO T;  4LFB T;  5F3J A;  1WR0 A;  4ZI3 D;  3OYZ A;  4ILC A;  3WTL A;  5H6R B;  4DVD A;  3N5L A;  4IL4 A;  4JI0 T;  3N2G E;  4HE8 A;  1WLX A;  2ES0 A;  2W8G A;  4OFZ A;  5HEH A;  4UF0 A;  4X66 T;  5J1G A;  4DR6 T;  4K0U A;  1X9B A;  5J2U E;  3U8J A;  2C0S A;  3SH1 A;  3N2K E;  4MBQ A;  2J1D G;  5M4Y A;  1XDP A;  2EHO A;  2IW5 B;  4PK5 A;  3UU8 A;  1IJ6 A;  1I9B A;  4PFO A;  3K3O A;  2XQ7 A;  5HEU A;  2BYP A;  4PK6 A;  4LF6 T;  3E22 E;  2YDR A;  3R6N A;  2Y56 A;  2X9X A;  4YJ2 E;  3I0O A;  2NW7 A;  1US7 B;  3SS1 A;  2XAF B;  3CVR A;  3W15 B;  2NW9 A;  3LSV A;  1OED B;  3FHN A;  3SFD A;  2JQK A;  2K48 A;  4Z8X A;  4GKK T;  3RIA A;  2WS3 A;  4PJL A;  5AFN A;  2BYN A;  4ZI2 D;  5H6Q B;  4X20 E;  4EAH A;  4Z90 A;  1FMV A;  3SQ6 A;  1XZY A;  4AQF C;  3DTO A;  2YME A;  4O4I E;  2WNL A;  2WNJ A;  1G8X A;  5HYA A;  4OYJ A;  5TVC A;  1XMO T;  4XAX B;  2X66 A;  1LVF A;  2E8I A;  2WP9 A;  3AAE B;  3ZYM A;  4DR4 T;  4KUM B;  4P1N A;  2PG8 A;  3PDY A;  4YY3 T;  2MYS A;  4HWC A;  2BR8 A;  5JRC A;  3PUZ F;  2F4V T;  4B5D A;  3RC3 A;  2V7I A;  1U5P A;  4LML A;  1HCI A;  2LKH A;  3ZT6 A;  1NWM X;  2XAH B;  4DBR A;  2W63 A;  2VAS A;  3UQ7 A;  3P4R A;  2C9T A;  3ZMS B;  5AFU L;  2E5L T;  2VL8 A;  5FY0 A;  2LRK A;  2X9W A;  3AEC A;  3LBX B;  3T1Y T;  5FXW A;  3TLS A;  1QLB A;  2NW8 A;  2JQQ A;  2BG9 C;  5AFJ A;  4F8H A;  5FVK A;  3B57 A;  4CXX A;  3WTJ A;  4UY2 A;  2FJA A;  3X1D A;  2V7M A;  4NXM T;  5AQU B;  3U78 A;  2X9H A;  5KMG P;  2K5B B;  4X1I E;  2Y7Y A;  3OVU A;  4AKR B;  4JBW F;  3AE4 A;  2FJB A;  2W61 A;  3AEG A;  1Y64 B;  1MIW A;  3AEE A;  2VWA A;  5FL1 A;  3J7Y q;  3QC9 A;  4HWI B;  1KEY A;  3NKZ A;  3RPU A;  3AA6 B;  4UM3 P;  2K9A A;  2LRL A;  3PJA A;  3FZF B;  5EK3 A;  2VKO A;  4QAA A;  4UV9 B;  3PV0 F;  4OX9 T;  2P9B A;  5LJN A;  2WBL A;  4DV5 T;  5DJQ C;  3C50 A;  1OED A;  2XQ9 A;  2Y58 A;  3PEO A;  1UUS A;  3FZM B;  4BAY B;  4IE0 A;  4GYR A;  4AQG A;  2MPK A;  1FEW A;  1J1J A;  2WWV A;  3SFE A;  1SHZ C;  2QGS A;  3L3P A;  3CWZ B;  3ZMU B;  1ZEE A;  2VK9 A;  1CUN A;  5A1L A;  4E7Z A;  1MMD A;  3C84 A;  1VCT A;  5KZU A;  5AQF B;  2EHO D;  4DR1 T;  3QB5 K;  3VRB A;  2YMD A;  3RRC A;  5LOV E;  2UXN B;  3ZST A;  5DQV A;  2D9D A;  3OBV E;  2CRB A;  4HWH A;  4TN7 B;  2WDV A;  1UX2 A;  3UUM A;  3UU3 A;  5ETW A;  3ZSS A;  4QH4 A;  2JMH A;  4YT0 A;  4JI6 T;  5AQT B;  3UTK A;  4AIS A;  2XNU A;  4H63 H;  2DHR A;  5JDQ A;  2C5K T;  2UXX B;  5CFB A;  1UX5 A;  1LVK A;  3MAC A;  2N1G A;  1L0V A;  2CBI A;  4AKG A;  5LMN T;  3RQW A;  3AVR A;  4PNI A;  3QUJ A;  3O1H A;  3DP7 A;  4O2B E;  4EB6 E;  4ALX A;  4COF A;  4YTP A;  4AQY T;  1YKE B;  4UVC B;  2EHO C;  4P0A A;  4CN1 A;  1MND A;  1IAP A;  2QA7 A;  3CPZ A;  5FXV A;  5LBM A;  2WM9 A;  3OYX A;  5J5H A;  5BRX A;  3UQ4 A;  4LF8 T;  2XYT A;  1GQE A;  3QNU A;  4EIW A;  2LSY A;  1V9D A;  5FL0 A;  4L5G A;  3RLF F;  3IHR A;  4IE5 A;  5AQS B;  3MXZ A;  3VKG A;  4F6R C;  2ZM6 T;  4QXH B;  5L3B B;  5EK2 A;  2DNX A;  2LOS A;  1ZOY A;  3K1S A;  3RKG A;  2BKN A;  1YQ3 A;  4ZEY A;  4DV3 T;  4ZRU A;  3C51 A;  2Y54 A;  3Q9D A;  2BS3 A;  2BG9 E;  5JVD E;  4AIU A;  3PTR B;  3F2E A;  4KHZ F;  4D01 A;  4AXP A;  5C3J A;  2PJQ A;  4NUV A;  3HR0 A;  5IUX A;  2W2U A;  4EV6 A;  3UUN A;  1VCS A;  3RRW A;  2IAK A;  5IYZ E;  3RYI E;  5FMN A;  2VKD A;  4H9S E;  3EDU A;  2VB6 A;  2V6Y A;  3MJX A;  4HTE A;  2C5J A;  4NIQ A;  2SPC A;  1NEK A;  3Q5E A;  3NBX X;  4X62 T;  4AKI A;  3HKE E;  2XHE B;  5KDM C;  3QB5 A;  3ETV A;  3C79 A;  2WN9 A;  3IBP A;  3GWH A;  4H9N C;  5CA0 E;  2V8S V;  4H63 V;  2XQ6 A;  3SWH A;  4U7Y A;  2CPT A;  2UXC T;  2X9Y A;  2LHR A;  4JEU B;  4HN9 A;  4I43 B;  4B3S T;  5HEJ A;  4NXN T;  1OWA A;  4QHO A;  2X0L B;  2AXD S;  5AQN B;  4IL9 A;  1MMN A;  3UU4 A;  4YSY A;  3RYF E;  4EEB A;  4BA9 A;  3P4W A;  4DMV A;  5ABF B;  1KNZ A;  5LGU B;  5HWY A;  5L4E A;  4O8S A;  2H89 A;  1OXZ A;  4KP3 C;  2QC1 B;  3HKD E;  3NRY A;  1J5E T;  5HXS A;  1HFA A;  3C4X A;  2CWO A;  2LKG A;  1XWM A;  3C98 B;  1D0Y A;  4DV4 T;  2UU9 T;  1W0B A;  4LFA T;  3I1A A;  2XTL A;  2WZI A;  3GUA A;  2BYR A;  2XSA A;  4ZI3 C;  3FBZ A;  2IUB A;  3RQU A;  2L9Q A;  2HPL A;  2KZ7 B;  1HX8 A;  2KLQ A;  3JCF A;  1LKX A;  4M1P A;  4CI2 B;  2JPF A;  3NZQ A;  2WZY A;  4X1K E;  4ZJS A;  3LBX A;  4V1A v;  2L8K A;  4Q25 A;  3PUW F;  3FB2 A;  2RP4 A;  3CKD A;  2WDR A;  1UW6 A;  2YEV C;  3AE7 A;  2WU5 A;  4QAB A;  5HWX A;  3ZKR A;  4LF7 T;  4LF9 T;  2X00 D;  1D1C A;  2WSS V;  4HFB A;  3VKH A;  5L2L A;  2BG9 A;  4ZI7 E;  1UK5 A;  5LP6 E;  2IHR 1;  4DV7 T;  1UV6 A;  2CMR A;  3MZK B;  3AAI A;  3BQK A;  2HPJ A;  1WYB A;  2V26 A;  4EED A;  4HFC A;  4X65 T;  1WR6 A;  2FJD A;  4CI1 B;  4YFS A;  3L39 A;  4EGW A;  4TUY E;  3RKO A;  4IDZ A;  3RYC E;  2X0H A;  3GMI A;  2VKH A;  4WBO A;  5IWA T;  3P8C D;  4O4L E;  2PGZ A;  2Y48 B;  3CQC B;  3Q5W A;  1MNE A;  2WMN A;  4UF0 B;  2MBG A;  1KNR A;  2LLY A;  2YOE A;  2YDS A;  2ODV A;  4DBM A;  3A7M A;  5AQK B;  5LGT B;  5CA1 E;  3O9X A;  4QX7 B;  1M7K A;  2NOX A;  2ZM8 A;  3MA9 A;  2V5C A;  3N9N A;  3AE8 A;  2J47 A;  4YHJ A;  1FMW A;  3AE9 A;  2A3D A;  3P4P A;  4KX6 A;  1DU2 A;  4DR5 T;  5AQI B;  4JUY A;  4PAG A;  5HXH A;  3SOL A;  4BJN A;  2XM2 A;  4ZK4 A;  3WTN A;  4IE4 A;  3NVO A;  2IC6 A;  4I0U A;  4UXN B;  2Q9Q A;  2KND A;  2BG9 B;  3LK2 B;  4TV8 E;  2K3W A;  4KI0 F;  3C4Z A;  1HTJ F;  3RGL A;  1MIY A;  3N9P A;  5LBQ B;  1YXR A;  3ETU A;  3UFE A;  4HFH A;  1OED E;  4BFQ A;  3CQX C;  2RPA A;  2XJ7 A;  2D2S A;  1S35 A;  3A8Y C;  2DWG A;  4PFP A;  3PUA A;  3K3Q C;  2BBH A;  2WNC A;  3PUQ A;  4GKJ T;  2WDQ A;  4I50 E;  5BW2 A;  3ANW A;  4TZ4 C;  5FP3 A;  2XM1 A;  4XZC A;  3ZJ2 A;  1IBL T;  3KFW X;  5FKY A;  4U74 A;  3ZCJ A;  5ABF A;  2RA1 A;  3EHZ A;  2M6I A;  5AFM A;  1KFY A;  5L3E B;  1UGO A;  1I6Z A;  2DL1 A;  2NTY A;  1HR0 T;  2BS2 A;  2XAG B;  4EYU A;  4ZS2 A;  5AQM B;  2IDO B;  4U31 A;  4HFI A;  4TWD A;  4GIW A;  3PUR A;  4AFH A;  2BJ0 A;  2I6H A;  3I9Y A;  3N9M A;  2X51 A;  2IML A;  4QXB B;  2HH7 A;  2YKS A;  5FVL A;  2VQE T;  2V6Y B;  1E1H B;  2QVA A;  5J2T E;  4DR3 T;  5ABG A;  5ABE A;  4AQF A;  2IC9 A;  2CA5 A;  2X68 A;  1SUM B;  5F8P A;  4JI3 T;  4ZOL E;  3VRA A;  5JH7 E;  2YU1 A;  3K3N A;  4P09 A;  3AVS A;  2CHN A;  4A97 A;  3LK3 B;  4HKA A;  3FXD B;  4EOZ B;  3C4W A;  2XYS A;  3F57 A;  2LJL A;  2VKJ A;  3B13 A;  3MK7 C;  3CML A;  3GA8 A;  5IHY A;  4NZB A;  4IST A;  4LMK A;  4TWH A;  2XZE A;  5AFK A;  1D0X A;  2B1E A;  2JQH A;  2KXP B;  2E9X D;  5LCY A;  4CXW A;  4KMC A;  4C91 A;  2X0Y A;  3ANW B;  3M3Z B;  3ZLI A;  3Q2M A;  1Z8U A;  4G2A A;  2A72 A;  3TLU A;  3K8P C;  1NAF A;  3IA3 A;  5BR8 T;  4ZZC A;  4ILA A;  4O4J E;  2WY2 A;  3CX8 B;  3B5M A;  4BJM A;  4LMJ A;  2DWK A;  2XNV A;  1N32 T;  4U33 A;  4CN4 A;  3SQ9 A;  2LM2 A;  2E9X A;  2L3L A;  4TWF A;  3KV9 A;  5JRC B;  3U8L A;  3EI0 A;  5JRE A;  4ZHQ E;  1IZN B;  2YIN A;  4WBN E;  4DV1 T;  1W0A A;  3JC6 D;  2PTF A;  4ERR A;  5LB7 B;  5JDL A;  3PU3 A;  2H7O A;  2CLY B;  4DID B;  1T8B A;  2Y8D A;  2XAQ B;  3PUX F;  3UUX B;  2VUR A;  2NP9 A;  2LOP A;  5AQJ B;  3KBT A;  4AFT A;  1WYC A;  2M6B A;  4UR9 A;  4WZX A;  4IDP A;  1XMQ T;  3TKL B;  5FY7 A;  3AA0 B;  2NR4 A;  1S94 A;  3PUS A;  4YSX A;  2CXL A;  3JAF A;  1HG2 A;  2W4X A;  4ZXL A;  2E9X C;  4HQP A;  5JR9 C;  3GN5 A;  3ZPO A;  2DLR A;  3U8K A;  4TNW A;  4B3R T;  3AA7 B;  4X1Y E;  3UU6 A;  2KIN B;  2XY8 B;  4YJ3 E;  2M67 A;  3U8M A;  4A98 A;  4QXC B;  2ZJV A;  3RIU C;  3KVA A;  4DO0 A;  3OJA A;  4AKH A;  2FUP A;  3PUG A;  2E2A A;  2LSK A;  5FXZ A;  3UT5 E;  2JMK A;  3PU8 A;  3FXE B;  4C90 A;  1YKH B;  4JI2 T;  4PJN A;  4ILU A;  2LSI A;  2JIW A;  5DAB A;  4E7S A;  5LG3 A;  4KHP T;  3V5S A;  4WW0 A;  1AJ3 A;  3ZN0 B;  2W00 A;  2CBJ A;  4J2C A;  2UUB T;  5KXJ A;  1WFD A;  2XQA A;  1T98 A;  3QOF A;  4UEM A;  3AEA A;  3MKD A;  1ZKE A;  2XZ6 A;  5AQH B;  5AQR B;  3FZL B;  1U4Q A;  3O1I A;  2FJE A;  4UM3 S;  2XSB A;  2NWB A;  1M62 A;  5JDH A;  2XQ8 A;  3KIN B;  4PIR A;  3T4M A;  5LXT E;  2A2F X;  5LA6 E;  2UXB T;  5C2T A;  3O4X E;  1HF8 A;  2UXD T;  4H9P C;  2R6G F;  2GK9 A;  5JDM A;  2XAS B;  3I9W A;  3ZEF B;  4CI3 B;  2ZLY A;  4ZK1 A;  3TLV A;  4NUU A;  1QUU A;  3L8R A;  1KF6 A;  4K0K T;  1N34 T;  3TLT A;  3I0Q A;  4LFC T;  5E0O A;  1EZ3 A;  3O1J A;  2WB5 A;  2WZH A;  2KT9 A;  2I0M A;  2PH9 A; 
#chains in the Genus database with same CATH homology
 4QAA A;  4ZZC A;  5HCM A;  3C79 A;  4COF A;  2W8G A;  5KE4 A;  2LLY A;  2YOE A;  4ILA A;  2WZY A;  4ZJS A;  5L4H A;  5L47 A;  2WN9 A;  5HEH A;  4NPP A;  5AFL A;  4UM3 A;  2BR7 A;  5BP0 A;  5CO5 A;  4DBM A;  5LXB A;  4HFI A;  3PMZ A;  4BQT A;  4TWD A;  1OED A;  2XQ9 A;  4LMJ A;  4AFH A;  2BJ0 A;  2Y58 A;  3PEO A;  2XQ6 A;  2BR8 A;  5J5H A;  2KSR A;  4QH1 A;  2XNV A;  2VL0 A;  2XQ3 A;  3U8J A;  4B5D A;  5BRX A;  1UW6 A;  2XNT A;  3WTI A;  4LML A;  3SQ9 A;  2LM2 A;  4QAB A;  4TWF A;  2LKH A;  3SH1 A;  5HEG A;  3UQ4 A;  2YKS A;  3ZKR A;  3WTK A;  2XZ5 A;  4ZZB A;  4XK9 A;  3U8L A;  2X00 D;  2XYT A;  5HEJ A;  3UQ7 A;  3EI0 A;  2C9T A;  2BYQ A;  3P50 A;  3UU8 A;  3ZDH A;  2MAW A;  3IGQ A;  4HFB A;  3WTN A;  1I9B A;  4ZK4 A;  2XQ4 A;  4TNV A;  5AFM B;  2BG9 A;  5LG3 A;  2XQ7 A;  5HEU A;  2BYP A;  3C84 A;  4HFE A;  4WV9 A;  5HCJ A;  2Y56 A;  5KZU A;  4IL9 A;  3RHW A;  2XQA A;  3UU4 A;  2BG9 B;  4EZ1 A;  3TLS A;  5HEO A;  3JAE A;  4A97 A;  2BYS A;  2YMD A;  3P4W A;  4QAC A;  2XZ6 A;  5AFH A;  4Z91 A;  3LSV A;  1OED B;  1UV6 A;  2BG9 C;  5AFJ A;  5L4E A;  4F8H A;  4UM3 S;  3WTJ A;  4HFH A;  2QC1 B;  4AFT A;  2XQ8 A;  2M6B A;  1OED E;  4UY2 A;  4PIR A;  3RIA A;  3ZDG A;  2XYS A;  4BFQ A;  3T4M A;  5AFN A;  1UX2 A;  4ZRU A;  3UU3 A;  2BYN A;  2Y54 A;  3SIO A;  2XQ5 A;  4ZJT A;  3WTH A;  2BG9 E;  4NZB A;  3UUB A;  3U8N A;  3WTM A;  5AIN A;  4QH4 A;  4HFC A;  4LMK A;  2W8F A;  2WNC A;  5J0Z A;  4TWH A;  3WTO A;  4D01 A;  2Y7Y A;  4Z90 A;  5JME A;  3SQ6 A;  5AFK A;  5BW2 A;  2XNU A;  5IUX A;  5J5G A;  2X00 A;  2YME A;  3TLV A;  3WIP A;  4ZK1 A;  3JAF A;  4UXU A;  4X5T A;  4AFG A;  3RIF A;  2ZJU A;  2LKG A;  5J5I A;  4UM1 A;  2YN6 A;  3EAM A;  2WNL A;  2WNJ A;  3TLW A;  4ZR6 A;  4HQP A;  5CFB A;  5TVC A;  4IRE A;  3U8K A;  4TNW A;  2Y57 A;  3TLT A;  3UU6 A;  4UM3 P;  3RQW A;  4XHE A;  4ILB A;  2PGZ A;  5SYO A;  3GUA A;  3EHZ A;  1OED C;  2M6I A;  4A98 A;  2BYR A;  4QH5 A;  2UZ6 A;  3U8M A;  5AFM A;  4ILC A;  3WTL A;  3RI5 A;  4HFD A;  3RQU A;  3TLU A;  4IL4 A;  3JAD A;  2ZJV A;  4FRR A;  5FJV A;  3UU5 A;  2PH9 A;  5J5F A;  4ALX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...