4NPPA

The glic-his10 wild-type structure in equilibrium between the open and locally-closed (lc) forms
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Crystal structures of a pentameric ligand-gated ion channel provide a mechanism for activation.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4nppA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4nppA01
4HFEA 2YN6A 3RI5A 3U8MA 4ILBA 2W8GA 4QH5A 4TNVA 5L4EA 2WNCA 2XZ6A 3GUAA 4ZZBA 4UY2A 5AFHA 1OEDE 2UZ6A 3U8NA 3LSVA 2Y57A 2WNJA 4UM3P 2XNVA 3RIAA 4ZR6A 4ZK1A 4QABA 1OEDA 2Y58A 3TLVA 3EAMA 4IL9A 2W8FA 2ZJVA 4XHEA 5AFMA 4UM3S 3U8LA 4UM3A 5AFNA 4ZZCA 4A98A 5LG3A 5J5GA 3UU4A 2PH9A 3ZDHA 3C84A 3RIFA 3ZDGA 5HEGA 4ZJSA 2LLYA 5JMEA 2VL0A 2YMDA 4NZBA 4X5TA 3SQ6A 4QH1A 2XQ4A 2PGZA 2XQ9A 2XYSA 3JADA 5J5HA 5CFBA 3WTHA 2XQ3A 3UU8A 4XK9A 3SH1A 3WTLA 1UX2A 4UM1A 2BYRA 3WTJA 1UV6A 3PEOA 2Y7YA 4ZK4A 3UU3A 5HEUA 2XQAA 5L4HA 4HFBA 3U8KA 5HEJA 3PMZA 4UXUA 4QAAA 4A97A 4IREA 4BQTA 2XNTA 2BG9B 2BR8A 3EHZA 4TWFA 2BYPA 5AINA 4PIRA 4Z90A 3UQ4A 2XNUA 2LM2A 3WTOA 3U8JA 4ZJTA 3WIPA 5CO5A 3UU6A 4HFHA 5BP0A 5FJVA 3JAEA 2XQ6A 5HEHA 2WNLA 4LMKA 2ZJUA 2X00D 3WTNA 2M6BA 3RQUA 5LXBA 2QC1B 2MAWA 3JAFA 4TWDA 5IUXA 5BW2A 5J5IA 4FRRA 4HQPA 3T4MA 3WTKA 5BRXA 2BYSA 3C79A 1I9BA 4QH4A 4D01A 4Z91A 2Y54A 5TVCA 2YKSA 3RQWA 2YMEA 2BYQA 2XQ8A 5KE4A 4LMLA 3TLTA 5SYOA 2XZ5A 2XQ5A 4HFDA 4ILAA 3ZKRA 2LKGA 2YOEA 5HEOA 2XYTA 4AFGA 3UU5A 4ALXA 4HFIA 4EZ1A 1OEDB 4LMJA 4ZRUA 2BYNA 4BFQA 2BG9E 5J0ZA 2BG9C 2XQ7A 2C9TA 2KSRA 3UUBA 2Y56A 5AFMB 2BG9A 3P4WA 4TWHA 4AFHA 1OEDC 2WZYA 4WV9A 5KZUA 5HCMA 3RHWA 1UW6A 5HCJA 4TNWA 3WTMA 5AFJA 2M6IA 3UQ7A 2X00A 4B5DA 5L47A 3EI0A 5J5FA 3TLUA 4COFA 3IGQA 4NPPA 3TLWA 2LKHA 2WN9A 4F8HA 3SQ9A 5AFLA 4DBMA 4HFCA 3P50A 3WTIA 4QACA 4ILCA 3SIOA 5AFKA 4AFTA 4IL4A 2BR7A 2BJ0A 3TLSA
chains in the Genus database with same CATH superfamily
4TNVA 3RLFF 1U4QA 2HN1A 1SA0E 1YD8G 5AFNA 3PDYA 3C84A 4GK0E 1KNPA 2VL0A 3F57A 1N32T 3KFWX 4EZ4A 3QB5K 2XYSA 2WU5A 4UM1A 1W0AA 5L4HA 2V6YB 2D0UA 4FJOA 1FIOA 4IE7A 3BQKA 2VKDA 5F8PA 2XSAA 5CGMA 2JQHA 4BJMA 2YEVC 2V8SV 1SHZC 4YLHA 3ZN1B 2X00D 2IHR1 4ZI2C 3U3IA 3N5LA 5ABFA 4FRRA 5AQRB 3QOFA 1MMAA 4QH4A 4LFBT 1I9BA 3MACA 4WNKA 4GKKT 2BYQA 1MIWA 3K3NA 4ERRA 3NBXX 4HWHA 4H63H 5L2LA 3RKGA 2I59A 5LXTE 1HFAA 4I0UA 2VURA 3WTMA 2LE8A 4NPPA 2LSYA 2YK0A 4O4JE 2WN9A 4F8HA 2LT3A 1O3XA 4ASKA 5FXWA 4HN9A 3AVSA 1M7KA 2KNDA 4PK4A 5A1LA 3DTOA 1YQ4A 2UZ6A 2IW5B 4EGWA 2H7OA 3AA6B 2MYSA 3HKCE 2CHOA 3C4WA 4NUUA 4IDQA 4OYJA 3CMLA 3VR8A 2Y8DA 3ZDGA 2E5VA 3L3PA 4OX9T 2XQYA 2XQ4A 2WWVA 1J5WA 4JI3T 4AIUA 2XQ9A 5M4YA 5J5HA 5AQUB 4ZK4A 2CXDA 2LJLA 4PJMA 4OYKA 1N34T 2WAUA 3OBVE 3I1AA 2UU9T 4U7YA 3RYHE 2E9XD 2Y6XA 1E1HB 2HN2A 1BR1A 1XMQT 4U33A 1S35A 5JDNA 5C8YE 3FBZA 5FY1A 5LA6E 4IT4A 5LP6E 5LYJE 2YKSA 2DHRA 4HWDA 4GYRA 5AQIB 3TLTA 3ZKRA 4ALXA 4AFGA 3ZJ2A 2AE9A 2V6YA 2BG9E 3ZMUB 2BG9C 3RKOA 5JH7E 3UUBA 3OYXA 3PUZF 3ZYMA 1X9BA 3AEDA 3F2EA 3LG7A 3PU8A 3L8RA 1IBKT 1G73A 4AFTA 3RX6A 3KINB 2YN6A 4HWFA 3HL6A 3VRAA 4KMCA 4AQFC 3ONXA 2Y57A 2Q9QC 2JPFA 1WCRA 2IIUA 2A72A 2PFVA 2UUBT 2XAHB 2FUPA 3PUVF 5TAOA 1R8IA 3ONJA 2W00A 4MLKA 3FZHB 1JNZA 2OLTA 3BQLA 4UVCB 3WTJA 4HFBA 5HEJA 2HH7A 2KMFA 5C2TA 4B3ST 3CIRA 2XJ7A 4A97A 4LF5T 3RC8A 4NXMT 3C98B 2LSKA 2XM1A 2KWIB 3AA1B 4CXYA 3HKDE 3IBPA 4CN1A 2UXCT 5HXHA 2PTFA 4IHJE 2CWOA 3KV5A 4B3RT 5J0ZA 3EABA 4JEUB 5JDGA 1M62A 2N9DA 4DUZT 3ZYLA 1W09A 2NW9A 4KX6A 2CBIA 2YU2A 5BR8T 4UVBB 5ABEA 3ESLA 2NW7A 4EXTA 4ILCA 4H9QC 2YU1A 1IBLT 1V9DA 4LF7T 2WNCA 5AFHA 2K24A 3LJCA 1HTJF 5JR9B 4JI4T 2UXDT 4IL9A 4NIQA 2WMOA 4DV7T 2NOXA 1LVKA 1XZYA 4JV5T 2VKHA 3D0TA 3UU4A 2PH9A 1KEYA 5FVKA 2NR4A 3AVRA 1IJ6A 2FJDA 2WS3A 2XHEB 2KXPB 2BYRA 4IE5A 2CEAA 3U8KA 5FNVE 1WR6A 1IJ5A 4DV4T 1OWAA 4Z90A 3Q5XA 2QA7A 1SE7A 3SRZA 3C51A 1YXRA 2M6BA 4DBQA 3ZPOA 4UXNB 3AAAB 5HXSA 1OXZA 3IF8B 2E9XC 3P8CD 2LHNA 4X1YE 3N2OA 4J2CA 1OEDB 4KHPT 4UF0B 5DQWA 3O1JA 2CCQA 3RC3A 4AFHA 1CHUA 4JYAT 2C5IT 4B5DA 3N9QA 3I0QA 5CB4E 3N9MA 3H3AA 1HG2A 5AQJB 3CK6A 4QACA 3RIUC 5LJNA 1HF8A 4UIGA 5L3FB 1UUSA 1YQ3A 2WB5A 5AQHB 3AEAA 4UM3P 3HKEE 4ZEYA 4YSXA 2ZJVA 4GK5E 5AQSB 2MBGA 1NWMX 4H9OC 4ZZCA 4KUMB 4B3TT 3M3ZB 3AA7B 2KWHA 5GONE 4CI2B 4YHJA 3HR0A 5CJ5A 3LK3B 2M67A 3AE3A 3I9YA 5JRCA 2XAFB 1UV6A 3ZCIA 2Y7YA 2JMKA 5HEUA 4BQTA 2X51A 2LRLA 3N9OA 2NTXA 2BYPA 5JR9A 5JDLA 1D0XA 3UQ4A 2MOZA 2X9YA 5ABFB 3U8JA 5HWXA 3WIPA 3S4UA 4OK0A 2WNLA 5LXBA 2C5JA 4O2AE 3AEBA 1ZEEA 3T4MA 4IE6A 4OFZA 5LB7B 2UXNB 4JI2T 4X65T 5AQGB 2WP9A 2IC9A 2CWYA 2XQ7A 5J1GA 5AFMB 3NRYA 1IZNB 2K48A 1DU2A 5HCJA 5L47A 2RPAA 3ZYKA 2A3DA 2LKHA 3ZN0B 3VU7H 1XMOT 5AFKA 4X1IE 3CQCB 3GUAA 1D1BA 4LF4T 1OEDA 2Y58A 2H88A 4JI5T 3EAMA 5FXZA 4QWNB 2DL1A 4XHEA 5AQVB 5LG3A 3HKBE 5E0OA 4HTEA 1FMWA 1US7B 2EHOA 2XAJB 3NVOA 2VVNA 2WZHA 2XQ3A 3AE2A 1MNEA 1J5ET 4ILUA 2XY8B 2QGSA 3CVRA 4DR5T 4GIWA 2J62A 2MTQA 4FI5A 5EK2A 3B5MA 4P09A 1Z8UA 2BS2A 1WR0A 3JAFA 2ODVA 1XNRT 3N9LA 5AQPB 5EK4A 2OV9A 2J4GA 3L09A 2L9QA 2GK9A 3J9X1 2DLRA 4HFDA 5ABGA 3NWIA 2I6HA 1QUUA 4LF6T 2WM9A 4O4LE 3F31A 2N2NA 2WZYA 5KZUA 2WCAA 5DJQC 5C3JA 4YHHT 5LCYA 4ZI3D 2VKOA 4UR9A 3SQ9A 3FXDB 2JQQA 5ABHA 3J7Yq 3AEEA 3SIOA 2CPTA 4C90A 4TZ4C 4EAHA 3TLSA 3RI5A 3VRBA 4ILBA 2VQFT 3U8NA 4YFSA 4X20E 3RIAA 3NRXA 3PUAA 4X66T 5AFMA 4G63A 2XM2A 4QX7B 3ZSSA 1UX5A 1UX4A 5J2UE 3Q5WA 3N9PA 1KNRA 3P4QA 2DWGA 2WWUA 5AQLB 4QX8B 3A7MA 3P4RA 3CX8B 4AKHA 3KVBA 1J1JA 2PG8A 1HS7A 3EUHA 4IREA 3LBXA 1HNZT 2BG9B 4F6RC 5KMGP 2WBLA 4WZXA 2D5UA 4X1KE 2KINB 4LFAT 3KV9A 5TVCA 4ZXLA 4HGAA 2VB6A 3RQWA 4QXBB 5CA1E 1ZOYA 1LKXA 4E7SA 3C4XA 4Q25A 4HFVA 2Q9QB 4EEBA 4JBWF 5DABA 3UQ7A 2XAQB 3TLUA 5FKYA 3UTKA 3Q5DA 3PJAJ 3IEEA 3ZT5A 1D1AA 1T8BA 4DMWA 4QH5A 4C91A 3FBLA 4QABA 4UV9B 4DR1T 1FMVA 2PBIA 4UM3S 4EIWA 2BVMA 2FJEA 1WLXA 3ZDHA 4GOUA 5JDQA 4YT0A 5JDMA 3KV4A 4WBOA 3UFEA 4QH1A 2PGZA 1BR4A 2QRXA 3AE6A 3LFMA 3ZSTA 5FP3A 4NXNT 3PU3A 4IIJE 4U72A 2CM0A 1JNRA 2JJ9A 4TWFA 4YTMA 3HA4A 3A8YC 3BQIA 3JAEA 5HEHA 2ZJUA 4LMKA 5FMNA 3RYFE 3ZMTB 4TWDA 4DV3T 2VASA 1T72A 4HQPA 5BRXA 2BYSA 4IDPA 4ISSA 2BZBA 4Z91A 2Y54A 1WFDA 3SS1A 2V7JA 4DBRA 4I50E 3RRWA 5ADXL 3JCFA 5HWYA 5SYOA 1LRZA 5FY7A 1YKHB 3UU5A 3AB3B 4TN7B 1HR0T 3C50A 2C9TA 2BG9A 4ZHQE 3HI2A 2LSGA 2C0SA 4ANJA 2V5DA 2X0LB 4WYVA 5FY0A 5L3CB 4PK5A 3LK42 1I6ZA 3P50A 1FEWA 3AECA 2L8KA 1MMGA 2WDRA 2NW8A 4AQFA 5LBQB 4ZI3C 3TLVA 3RPUA 2Q9QA 2CHNA 1W0BA 2WMNA 2I0MA 3OYZA 4HWIB 5JRCB 5JMEA 3PUQA 3ZEFB 3SQ6A 2C5KT 2ACXA 4DV6T 4L0RA 3QC9A 5CFBA 4XK9A 3PURA 1H7CA 3PJAA 3QNUA 4I4TE 3UU3A 2E9XB 4XBFB 1WYCA 3EDVA 2XNTA 2V1DB 4N78D 3RGLA 2D2SA 2CE7A 3OVUA 3FHNA 4YSZA 3UU6A 5F5WA 1ZHCA 3RYIE 2XQ6A 4DV5T 2A2FX 3CKDA 3WTNA 4AQGA 2DI4A 2JMHA 4M1PA 4UVAB 4EYUA 4U2ZA 2BKNA 5JTGA 1G8XA 2X9WA 1BR2A 4AISA 5KE4A 3RF1A 2XYTA 2IC6A 2YOEA 3PUXF 3ZT6A 3PUYF 3ETVA 2KLQA 2BYNA 3ZJ1A 2XZEA 3H37A 4BAYB 2Y56A 5LGUB 3EDUA 3CQGB 1HNXT 2RA1A 1KFYA 2X00A 4COFA 3TLWA 3AAIA 1AJ3A 4H9PC 3PV0F 1YW0A 4IE4A 5L4EA 2NWBA 3QUJA 5AFUL 4TV8E 4U3CA 2EHOB 3OKQA 3QB5A 4UM3A 3ABVA 3ZMSB 2D0TA 2V7IA 2JRKA 3ETUA 3EVYA 5FVLA 5FXXA 5L3DB 4NZBA 4DR3T 2E5LT 1XDPA 5LGTB 4O8SA 3SFDA 5L3GB 2XQAA 1B7TA 4O4HE 3GA8A 2WQYA 5KXJA 4QAAA 4KI0F 3AXJB 3OPCA 2YDQA 2ZM8A 3UFGA 1T98A 5IHYA 4P1NA 1UGOA 1VCSA 4E7ZA 5BW2A 5J5IA 2JIWA 1MMNA 3V5SA 4KBMB 4X64T 2J1DG 4ADZA 2X67A 3PUWF 5CA0E 3FB2A 4ILAA 4O2BE 5HEOA 3W15B 2IMLA 5AQQB 2E9XA 4ZRUA 4ZOLE 2KSRA 5KDMC 5AQFB 2ES0A 4QHOA 3O1HA 4EB6E 1OEDC 3KDSE 1UW6A 3A5XA 2ACZA 4ZI7E 3PE0A 4UELA 2UXXB 2X9XA 2FJAA 3SOLA 3WTIA 5LHHB 3T1HT 3ONLC 2HPLA 4YTNA 4XZCA 3GN5B 2CMRA 4HFEA 2ODUA 2SPCA 3C64A 2N1GA 3RIUA 3VR9A 5LG4A 4OHFA 1I94T 3DJBA 4U74A 3UUMA 5J5GA 4G2AA 3UUNA 5EK3A 3RIFA 2CRBA 4H9SE 3Q5EA 4IDZA 4O4IE 1CUNA 1E7PA 2Z6EA 3LBXB 3Q2MA 2VK9A 2YDRA 4WW0A 4QKNA 5DQVA 5LHIB 2BR8A 3WAJA 3C4ZA 4JI6T 2V5CA 2KT9A 3NZQA 1E2AA 2VKJA 4ZJTA 4DUYT 5J2TE 3IHRA 2XUEA 2LSIA 3ZT7A 2QC1B 5IUXA 1KK7A 2H89A 4CXWA 3KV6A 3NKZA 2YMEA 4UV8B 4U2YA 3M65A 1UCUA 2CXFA 2LKGA 2UXBT 4YJ3E 4YTPA 4LMJA 2J47A 3I0OA 4PK6A 4AXPA 3AXJA 5AQTB 2BS4A 2M6IA 2LEHA 2BVLA 3RYCE 3EI0A 4DV0T 2XSBA 2XASB 4DBMA 2BS3A 4PAGA 3WI3A 4B3MT 2ZLYA 2UUAT 3O9XA 3OTOT 2CLYC 5JREA 4UY2A 5L3BB 4ZZBA 3MK7C 4AKGA 3LSVA 1U5PA 5H6RB 1LVFA 3KVAA 4TUYE 4ZK1A 2W67A 3G06A 4GYSA 2VVSA 2B1EA 4JI0T 1HX8A 4A98A 5FL0A 1ZV4X 3E22E 1X79A 3VKGA 2YMDA 2WY2A 4TX5A 3P7IA 3MKDA 3U78A 2K3WA 4DR6T 3UU8A 3PEOA 2V26A 2W61A 5LGNB 3AE4A 4DV1T 2HHHT 3GN5A 2WU2A 3KBUA 2PJQA 2BBJA 4PFPA 4I43B 2A9UA 4QXCB 2LM2A 4JI1T 4PFOA 2WDVA 3L39A 4AI6A 5CO5A 1VCTA 4EOZB 3CPZA 2BKPA 2R6GF 2X0YA 3FZMB 3VKHA 1YKEB 3ZC0A 2XQ8A 1Y01A 4LMLA 4DR7T 1Y64B 2XQ5A 4LF8T 3MZKB 4U31A 4IE0A 3WAKA 2WDQA 4WV9A 3DP7A 3RHWA 5AFJA 2BBHA 3UT5E 4ISTA 1KNZA 3IGQA 4DR4T 4WBNE 2CXLA 4I55E 5F3JA 3ZLIA 3IA3A 4IL4A 1D1CA 4AKLA 3GWHA 1N36T 2E2AA 3U8MA 4TV9E 3AE1A 4ZR6A 2IDOB 2W63A 4EZHA 3MJXA 3B57A 4H9RC 3K3QC 3AE9A 2D9DA 2JQ9A 3FZFB 3SFEA 4CI1B 1VOMA 2V6XA 5HYAA 4AKRB 5AQMB 5FYMA 3E08A 1N33T 3SH1A 2LOSA 5JDHA 4UXUA 4DVDA 4JLEA 3JC6D 3EHZA 4PJNA 4PIRA 2V7KA 1MNDA 2OA5A 4DMVA 2CA5A 2ZM6T 2BDEA 5AQKB 2UUCT 4HFHA 5IYZE 4Z8XA 3SWHA 1NAFA 4PJJA 4PJLA 3WTKA 2IAKA 3C79A 3AE7A 1XNQT 3P4PA 4YXDA 4D01A 2ZM0A 3Q9DA 2XZ5A 1HX1B 2YINA 3LK2B 1HCIA 3AE5A 4JI7T 4A5XA 2XAGB 1WRDA 1L0VA 4GKJT 1HG5A 2X9HA 3P4SA 5HXRA 4HEAA 2KZ7B 3B13A 5AFLA 4HFCA 4CXXA 2FBWA 3MA9A 2EHOD 5AQOB 2LOPA 2V7MA 2W8GA 4EV6A 4P0BA 1T7SA 4PNIA 1KF6A 1GQEA 2WNJA 2W4XA 4ZS3A 2WSSV 2LSJA 2P9BA 3ANWB 4CN6A 2CBJA 2NP9A 3ZMVB 4ZJSA 2VL8A 2B76A 4CQIA 5LMUT 4CI3B 3AE8A 3WTLA 5H6QB 2FJBA 5LOVE 2W66A 2W2UA 2G0UA 3ZC1A 5LBMA 2X66A 3WTOA 4HKAA 2NTYA 5FJVA 4KHZF 2DWKA 1Z0PA 3RQUA 1FJGT 1XDOA 2MAWA 4P0AA 4LF9T 3PUSA 3N2GE 1XWMA 1QSDA 3AA0B 5LMNT 5LNKA 2IUBA 2ZM2A 4LFCT 4HFIA 4BFQA 4MALA 1S94A 3AAEB 3P4WA 2W0GA 3OJAA 2VWAA 5HXCA 2QYWA 3O4XE 2DCFA 3ZMZB 1MIYA 3V5UA 2BKOA 1W9RA 2XZ6A 1BR0A 1NENA 3BK9A 2LHRA 3AEFA 3CWZB 1IAPA 3VHLA 3CQXC 5FXVA 4YJ2E 4DNDA 4MBQA 5HEGA 3I9WA 4U7IA 2K5BB 2LM9A 2X0HA 4BA9A 3WTHA 2E8IA 5AQNB 4ZI2D 4DR2T 2ZMAA 3PMZA 1NEKA 4IGUA 4HWCA 1WYBA 3RH3A 5JR9C 3T1YT 5LJMA 3FZKB 4V1Av 5LHGB 3K8PC 1SUMB 5ETWA 4B6XA 5L3EB 3ANWA 3PTRB 5FL1A 3QK6A 3N2KE 3PUGA 4HE8A 4JUYA 4L9IA 1MIVA 3NZPA 4K0KT 2DNXA 3KBTA 3JC6C 3CX6B 1VRBA 4H9NC 4JEHB 4EZ1A 1UURA 5BMVE 1MMDA 2HPJA 2V7LA 3GMIA 4MHCA 4DV2T 3LDQB 4TWHA 4YY3T 3UUXB 4ZS2A 4EEDA 2H3RA 3X1DA 5EZYE 4K0UA 4QXHB 2YDSA 4IDOA 3O1IA 5JDFA 4X62T 4L5GA 4JI8T 5JQGE 2Y48B 4XAXB 1OEDE 2L3LA 4YSYA 4H63V 2XNVA 2WZIA 2W8FA 3R84B 3FZLB 3U8LA 2H7VC 3T8OA 2EHOC 3K3OA 3UULA 2LLYA 4X5TA 5KX5E 2K9AA 2W62A 4AQYT 3JADA 4KP3C 4DO0A 1UX2A 2F4VT 4DIDB 3H3MA 1UK5A 3N9NA 5AINA 2XNUA 2XTLA 4PW8A 3ZCJA 1IBMT 4EYYR 5BP0A 4UEMA 4IDNA 5JVDE 4CN4A 1D0ZA 2X68A 2CLYB 1QLBA 3K1SA 1HNWT 2VQET 4BJNA 5HXEA 3R6NA 4NUVA 3CX7B 1D0YA 3AEGA 5HCMA 2XPKA 4TNWA 5IWAT 5HAXA 2Q9QD 1ZKEA 3MXZA 2QVAA 4A56A 5J5FA 4UF0A 2LRKA 4MFRA 2MPKA 2JQKA 3FXEB 1ZP0A 4CZZB 3E0ZA 4AKIA 3TKLB 2AXDS 2RP4A 2BR7A 2BJ0A 1EZ3A 3RRCA
chains in the Genus database with same CATH topology
4HFEA 2YN6A 3RI5A 3U8MA 4ILBA 2W8GA 4QH5A 4TNVA 5L4EA 2WNCA 2XZ6A 3GUAA 4ZZBA 4UY2A 5AFHA 1OEDE 2UZ6A 3U8NA 3LSVA 2Y57A 2WNJA 4UM3P 2XNVA 3RIAA 4ZR6A 4ZK1A 4QABA 1OEDA 2Y58A 3TLVA 3EAMA 4IL9A 2W8FA 2ZJVA 4XHEA 5AFMA 4UM3S 3U8LA 4UM3A 5AFNA 4ZZCA 4A98A 5LG3A 5J5GA 3UU4A 2PH9A 3ZDHA 3C84A 3RIFA 3ZDGA 5HEGA 4ZJSA 2LLYA 5JMEA 2VL0A 2YMDA 4NZBA 4X5TA 3SQ6A 4QH1A 2XQ4A 2PGZA 2XQ9A 2XYSA 3JADA 5J5HA 5CFBA 3WTHA 2XQ3A 3UU8A 4XK9A 3SH1A 3WTLA 1UX2A 4UM1A 2BYRA 3WTJA 1UV6A 3PEOA 2Y7YA 4ZK4A 3UU3A 5HEUA 2XQAA 5L4HA 4HFBA 3U8KA 5HEJA 3PMZA 4UXUA 4QAAA 4A97A 4IREA 4BQTA 2XNTA 2BG9B 2BR8A 3EHZA 4TWFA 2BYPA 5AINA 4PIRA 4Z90A 3UQ4A 2XNUA 2LM2A 3WTOA 3U8JA 4ZJTA 3WIPA 5CO5A 3UU6A 4HFHA 5BP0A 5FJVA 3JAEA 2XQ6A 5HEHA 2WNLA 4LMKA 2ZJUA 2X00D 3WTNA 2M6BA 3RQUA 5LXBA 2QC1B 2MAWA 3JAFA 4TWDA 5IUXA 5BW2A 5J5IA 4FRRA 4HQPA 3T4MA 3WTKA 5BRXA 2BYSA 3C79A 1I9BA 4QH4A 4D01A 4Z91A 2Y54A 5TVCA 2YKSA 3RQWA 2YMEA 2BYQA 2XQ8A 5KE4A 4LMLA 3TLTA 5SYOA 2XZ5A 2XQ5A 4HFDA 4ILAA 3ZKRA 2LKGA 2YOEA 5HEOA 2XYTA 4AFGA 3UU5A 4ALXA 4HFIA 4EZ1A 1OEDB 4LMJA 4ZRUA 2BYNA 4BFQA 2BG9E 5J0ZA 2BG9C 2XQ7A 2C9TA 2KSRA 3UUBA 2Y56A 5AFMB 2BG9A 3P4WA 4TWHA 4AFHA 1OEDC 2WZYA 4WV9A 5KZUA 5HCMA 3RHWA 1UW6A 5HCJA 4TNWA 3WTMA 5AFJA 2M6IA 3UQ7A 2X00A 4B5DA 5L47A 3EI0A 5J5FA 3TLUA 4COFA 3IGQA 4NPPA 3TLWA 2LKHA 2WN9A 4F8HA 3SQ9A 5AFLA 4DBMA 4HFCA 3P50A 3WTIA 4QACA 4ILCA 3SIOA 5AFKA 4AFTA 4IL4A 2BR7A 2BJ0A 3TLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFE A;  2YN6 A;  3RI5 A;  3U8M A;  4ILB A;  2W8G A;  4QH5 A;  4TNV A;  5L4E A;  2WNC A;  2XZ6 A;  3GUA A;  4ZZB A;  4UY2 A;  5AFH A;  1OED E;  2UZ6 A;  3U8N A;  3LSV A;  2Y57 A;  2WNJ A;  4UM3 P;  2XNV A;  3RIA A;  4ZR6 A;  4ZK1 A;  4QAB A;  1OED A;  2Y58 A;  3TLV A;  3EAM A;  4IL9 A;  2W8F A;  2ZJV A;  4XHE A;  5AFM A;  4UM3 S;  3U8L A;  4UM3 A;  5AFN A;  4ZZC A;  4A98 A;  5LG3 A;  5J5G A;  3UU4 A;  2PH9 A;  3ZDH A;  3C84 A;  3RIF A;  3ZDG A;  5HEG A;  4ZJS A;  2LLY A;  5JME A;  2VL0 A;  2YMD A;  4NZB A;  4X5T A;  3SQ6 A;  4QH1 A;  2XQ4 A;  2PGZ A;  2XQ9 A;  2XYS A;  3JAD A;  5J5H A;  5CFB A;  3WTH A;  2XQ3 A;  3UU8 A;  4XK9 A;  3SH1 A;  3WTL A;  1UX2 A;  4UM1 A;  2BYR A;  3WTJ A;  1UV6 A;  3PEO A;  2Y7Y A;  4ZK4 A;  3UU3 A;  5HEU A;  2XQA A;  5L4H A;  4HFB A;  3U8K A;  5HEJ A;  3PMZ A;  4UXU A;  4QAA A;  4A97 A;  4IRE A;  4BQT A;  2XNT A;  2BG9 B;  2BR8 A;  3EHZ A;  4TWF A;  2BYP A;  5AIN A;  4PIR A;  4Z90 A;  3UQ4 A;  2XNU A;  2LM2 A;  3WTO A;  3U8J A;  4ZJT A;  3WIP A;  5CO5 A;  3UU6 A;  4HFH A;  5BP0 A;  5FJV A;  3JAE A;  2XQ6 A;  5HEH A;  2WNL A;  4LMK A;  2ZJU A;  2X00 D;  3WTN A;  2M6B A;  3RQU A;  5LXB A;  2QC1 B;  2MAW A;  3JAF A;  4TWD A;  5IUX A;  5BW2 A;  5J5I A;  4FRR A;  4HQP A;  3T4M A;  3WTK A;  5BRX A;  2BYS A;  3C79 A;  1I9B A;  4QH4 A;  4D01 A;  4Z91 A;  2Y54 A;  5TVC A;  2YKS A;  3RQW A;  2YME A;  2BYQ A;  2XQ8 A;  5KE4 A;  4LML A;  3TLT A;  5SYO A;  2XZ5 A;  2XQ5 A;  4HFD A;  4ILA A;  3ZKR A;  2LKG A;  2YOE A;  5HEO A;  2XYT A;  4AFG A;  3UU5 A;  4ALX A;  4HFI A;  4EZ1 A;  1OED B;  4LMJ A;  4ZRU A;  2BYN A;  4BFQ A;  2BG9 E;  5J0Z A;  2BG9 C;  2XQ7 A;  2C9T A;  2KSR A;  3UUB A;  2Y56 A;  5AFM B;  2BG9 A;  3P4W A;  4TWH A;  4AFH A;  1OED C;  2WZY A;  4WV9 A;  5KZU A;  5HCM A;  3RHW A;  1UW6 A;  5HCJ A;  4TNW A;  3WTM A;  5AFJ A;  2M6I A;  3UQ7 A;  2X00 A;  4B5D A;  5L47 A;  3EI0 A;  5J5F A;  3TLU A;  4COF A;  3IGQ A;  4NPP A;  3TLW A;  2LKH A;  2WN9 A;  4F8H A;  3SQ9 A;  5AFL A;  4DBM A;  4HFC A;  3P50 A;  3WTI A;  4QAC A;  4ILC A;  3SIO A;  5AFK A;  4AFT A;  4IL4 A;  2BR7 A;  2BJ0 A;  3TLS A; 
#chains in the Genus database with same CATH topology
 4TNV A;  3RLF F;  1U4Q A;  2HN1 A;  1SA0 E;  1YD8 G;  5AFN A;  3PDY A;  3C84 A;  4GK0 E;  1KNP A;  2VL0 A;  3F57 A;  1N32 T;  3KFW X;  4EZ4 A;  3QB5 K;  2XYS A;  2WU5 A;  4UM1 A;  1W0A A;  5L4H A;  2V6Y B;  2D0U A;  4FJO A;  1FIO A;  4IE7 A;  3BQK A;  2VKD A;  5F8P A;  2XSA A;  5CGM A;  2JQH A;  4BJM A;  2YEV C;  2V8S V;  1SHZ C;  4YLH A;  3ZN1 B;  2X00 D;  2IHR 1;  4ZI2 C;  3U3I A;  3N5L A;  5ABF A;  4FRR A;  5AQR B;  3QOF A;  1MMA A;  4QH4 A;  4LFB T;  1I9B A;  3MAC A;  4WNK A;  4GKK T;  2BYQ A;  1MIW A;  3K3N A;  4ERR A;  3NBX X;  4HWH A;  4H63 H;  5L2L A;  3RKG A;  2I59 A;  5LXT E;  1HFA A;  4I0U A;  2VUR A;  3WTM A;  2LE8 A;  4NPP A;  2LSY A;  2YK0 A;  4O4J E;  2WN9 A;  4F8H A;  2LT3 A;  1O3X A;  4ASK A;  5FXW A;  4HN9 A;  3AVS A;  1M7K A;  2KND A;  4PK4 A;  5A1L A;  3DTO A;  1YQ4 A;  2UZ6 A;  2IW5 B;  4EGW A;  2H7O A;  3AA6 B;  2MYS A;  3HKC E;  2CHO A;  3C4W A;  4NUU A;  4IDQ A;  4OYJ A;  3CML A;  3VR8 A;  2Y8D A;  3ZDG A;  2E5V A;  3L3P A;  4OX9 T;  2XQY A;  2XQ4 A;  2WWV A;  1J5W A;  4JI3 T;  4AIU A;  2XQ9 A;  5M4Y A;  5J5H A;  5AQU B;  4ZK4 A;  2CXD A;  2LJL A;  4PJM A;  4OYK A;  1N34 T;  2WAU A;  3OBV E;  3I1A A;  2UU9 T;  4U7Y A;  3RYH E;  2E9X D;  2Y6X A;  1E1H B;  2HN2 A;  1BR1 A;  1XMQ T;  4U33 A;  1S35 A;  5JDN A;  5C8Y E;  3FBZ A;  5FY1 A;  5LA6 E;  4IT4 A;  5LP6 E;  5LYJ E;  2YKS A;  2DHR A;  4HWD A;  4GYR A;  5AQI B;  3TLT A;  3ZKR A;  4ALX A;  4AFG A;  3ZJ2 A;  2AE9 A;  2V6Y A;  2BG9 E;  3ZMU B;  2BG9 C;  3RKO A;  5JH7 E;  3UUB A;  3OYX A;  3PUZ F;  3ZYM A;  1X9B A;  3AED A;  3F2E A;  3LG7 A;  3PU8 A;  3L8R A;  1IBK T;  1G73 A;  4AFT A;  3RX6 A;  3KIN B;  2YN6 A;  4HWF A;  3HL6 A;  3VRA A;  4KMC A;  4AQF C;  3ONX A;  2Y57 A;  2Q9Q C;  2JPF A;  1WCR A;  2IIU A;  2A72 A;  2PFV A;  2UUB T;  2XAH B;  2FUP A;  3PUV F;  5TAO A;  1R8I A;  3ONJ A;  2W00 A;  4MLK A;  3FZH B;  1JNZ A;  2OLT A;  3BQL A;  4UVC B;  3WTJ A;  4HFB A;  5HEJ A;  2HH7 A;  2KMF A;  5C2T A;  4B3S T;  3CIR A;  2XJ7 A;  4A97 A;  4LF5 T;  3RC8 A;  4NXM T;  3C98 B;  2LSK A;  2XM1 A;  2KWI B;  3AA1 B;  4CXY A;  3HKD E;  3IBP A;  4CN1 A;  2UXC T;  5HXH A;  2PTF A;  4IHJ E;  2CWO A;  3KV5 A;  4B3R T;  5J0Z A;  3EAB A;  4JEU B;  5JDG A;  1M62 A;  2N9D A;  4DUZ T;  3ZYL A;  1W09 A;  2NW9 A;  4KX6 A;  2CBI A;  2YU2 A;  5BR8 T;  4UVB B;  5ABE A;  3ESL A;  2NW7 A;  4EXT A;  4ILC A;  4H9Q C;  2YU1 A;  1IBL T;  1V9D A;  4LF7 T;  2WNC A;  5AFH A;  2K24 A;  3LJC A;  1HTJ F;  5JR9 B;  4JI4 T;  2UXD T;  4IL9 A;  4NIQ A;  2WMO A;  4DV7 T;  2NOX A;  1LVK A;  1XZY A;  4JV5 T;  2VKH A;  3D0T A;  3UU4 A;  2PH9 A;  1KEY A;  5FVK A;  2NR4 A;  3AVR A;  1IJ6 A;  2FJD A;  2WS3 A;  2XHE B;  2KXP B;  2BYR A;  4IE5 A;  2CEA A;  3U8K A;  5FNV E;  1WR6 A;  1IJ5 A;  4DV4 T;  1OWA A;  4Z90 A;  3Q5X A;  2QA7 A;  1SE7 A;  3SRZ A;  3C51 A;  1YXR A;  2M6B A;  4DBQ A;  3ZPO A;  4UXN B;  3AAA B;  5HXS A;  1OXZ A;  3IF8 B;  2E9X C;  3P8C D;  2LHN A;  4X1Y E;  3N2O A;  4J2C A;  1OED B;  4KHP T;  4UF0 B;  5DQW A;  3O1J A;  2CCQ A;  3RC3 A;  4AFH A;  1CHU A;  4JYA T;  2C5I T;  4B5D A;  3N9Q A;  3I0Q A;  5CB4 E;  3N9M A;  3H3A A;  1HG2 A;  5AQJ B;  3CK6 A;  4QAC A;  3RIU C;  5LJN A;  1HF8 A;  4UIG A;  5L3F B;  1UUS A;  1YQ3 A;  2WB5 A;  5AQH B;  3AEA A;  4UM3 P;  3HKE E;  4ZEY A;  4YSX A;  2ZJV A;  4GK5 E;  5AQS B;  2MBG A;  1NWM X;  4H9O C;  4ZZC A;  4KUM B;  4B3T T;  3M3Z B;  3AA7 B;  2KWH A;  5GON E;  4CI2 B;  4YHJ A;  3HR0 A;  5CJ5 A;  3LK3 B;  2M67 A;  3AE3 A;  3I9Y A;  5JRC A;  2XAF B;  1UV6 A;  3ZCI A;  2Y7Y A;  2JMK A;  5HEU A;  4BQT A;  2X51 A;  2LRL A;  3N9O A;  2NTX A;  2BYP A;  5JR9 A;  5JDL A;  1D0X A;  3UQ4 A;  2MOZ A;  2X9Y A;  5ABF B;  3U8J A;  5HWX A;  3WIP A;  3S4U A;  4OK0 A;  2WNL A;  5LXB A;  2C5J A;  4O2A E;  3AEB A;  1ZEE A;  3T4M A;  4IE6 A;  4OFZ A;  5LB7 B;  2UXN B;  4JI2 T;  4X65 T;  5AQG B;  2WP9 A;  2IC9 A;  2CWY A;  2XQ7 A;  5J1G A;  5AFM B;  3NRY A;  1IZN B;  2K48 A;  1DU2 A;  5HCJ A;  5L47 A;  2RPA A;  3ZYK A;  2A3D A;  2LKH A;  3ZN0 B;  3VU7 H;  1XMO T;  5AFK A;  4X1I E;  3CQC B;  3GUA A;  1D1B A;  4LF4 T;  1OED A;  2Y58 A;  2H88 A;  4JI5 T;  3EAM A;  5FXZ A;  4QWN B;  2DL1 A;  4XHE A;  5AQV B;  5LG3 A;  3HKB E;  5E0O A;  4HTE A;  1FMW A;  1US7 B;  2EHO A;  2XAJ B;  3NVO A;  2VVN A;  2WZH A;  2XQ3 A;  3AE2 A;  1MNE A;  1J5E T;  4ILU A;  2XY8 B;  2QGS A;  3CVR A;  4DR5 T;  4GIW A;  2J62 A;  2MTQ A;  4FI5 A;  5EK2 A;  3B5M A;  4P09 A;  1Z8U A;  2BS2 A;  1WR0 A;  3JAF A;  2ODV A;  1XNR T;  3N9L A;  5AQP B;  5EK4 A;  2OV9 A;  2J4G A;  3L09 A;  2L9Q A;  2GK9 A;  3J9X 1;  2DLR A;  4HFD A;  5ABG A;  3NWI A;  2I6H A;  1QUU A;  4LF6 T;  2WM9 A;  4O4L E;  3F31 A;  2N2N A;  2WZY A;  5KZU A;  2WCA A;  5DJQ C;  5C3J A;  4YHH T;  5LCY A;  4ZI3 D;  2VKO A;  4UR9 A;  3SQ9 A;  3FXD B;  2JQQ A;  5ABH A;  3J7Y q;  3AEE A;  3SIO A;  2CPT A;  4C90 A;  4TZ4 C;  4EAH A;  3TLS A;  3RI5 A;  3VRB A;  4ILB A;  2VQF T;  3U8N A;  4YFS A;  4X20 E;  3RIA A;  3NRX A;  3PUA A;  4X66 T;  5AFM A;  4G63 A;  2XM2 A;  4QX7 B;  3ZSS A;  1UX5 A;  1UX4 A;  5J2U E;  3Q5W A;  3N9P A;  1KNR A;  3P4Q A;  2DWG A;  2WWU A;  5AQL B;  4QX8 B;  3A7M A;  3P4R A;  3CX8 B;  4AKH A;  3KVB A;  1J1J A;  2PG8 A;  1HS7 A;  3EUH A;  4IRE A;  3LBX A;  1HNZ T;  2BG9 B;  4F6R C;  5KMG P;  2WBL A;  4WZX A;  2D5U A;  4X1K E;  2KIN B;  4LFA T;  3KV9 A;  5TVC A;  4ZXL A;  4HGA A;  2VB6 A;  3RQW A;  4QXB B;  5CA1 E;  1ZOY A;  1LKX A;  4E7S A;  3C4X A;  4Q25 A;  4HFV A;  2Q9Q B;  4EEB A;  4JBW F;  5DAB A;  3UQ7 A;  2XAQ B;  3TLU A;  5FKY A;  3UTK A;  3Q5D A;  3PJA J;  3IEE A;  3ZT5 A;  1D1A A;  1T8B A;  4DMW A;  4QH5 A;  4C91 A;  3FBL A;  4QAB A;  4UV9 B;  4DR1 T;  1FMV A;  2PBI A;  4UM3 S;  4EIW A;  2BVM A;  2FJE A;  1WLX A;  3ZDH A;  4GOU A;  5JDQ A;  4YT0 A;  5JDM A;  3KV4 A;  4WBO A;  3UFE A;  4QH1 A;  2PGZ A;  1BR4 A;  2QRX A;  3AE6 A;  3LFM A;  3ZST A;  5FP3 A;  4NXN T;  3PU3 A;  4IIJ E;  4U72 A;  2CM0 A;  1JNR A;  2JJ9 A;  4TWF A;  4YTM A;  3HA4 A;  3A8Y C;  3BQI A;  3JAE A;  5HEH A;  2ZJU A;  4LMK A;  5FMN A;  3RYF E;  3ZMT B;  4TWD A;  4DV3 T;  2VAS A;  1T72 A;  4HQP A;  5BRX A;  2BYS A;  4IDP A;  4ISS A;  2BZB A;  4Z91 A;  2Y54 A;  1WFD A;  3SS1 A;  2V7J A;  4DBR A;  4I50 E;  3RRW A;  5ADX L;  3JCF A;  5HWY A;  5SYO A;  1LRZ A;  5FY7 A;  1YKH B;  3UU5 A;  3AB3 B;  4TN7 B;  1HR0 T;  3C50 A;  2C9T A;  2BG9 A;  4ZHQ E;  3HI2 A;  2LSG A;  2C0S A;  4ANJ A;  2V5D A;  2X0L B;  4WYV A;  5FY0 A;  5L3C B;  4PK5 A;  3LK4 2;  1I6Z A;  3P50 A;  1FEW A;  3AEC A;  2L8K A;  1MMG A;  2WDR A;  2NW8 A;  4AQF A;  5LBQ B;  4ZI3 C;  3TLV A;  3RPU A;  2Q9Q A;  2CHN A;  1W0B A;  2WMN A;  2I0M A;  3OYZ A;  4HWI B;  5JRC B;  5JME A;  3PUQ A;  3ZEF B;  3SQ6 A;  2C5K T;  2ACX A;  4DV6 T;  4L0R A;  3QC9 A;  5CFB A;  4XK9 A;  3PUR A;  1H7C A;  3PJA A;  3QNU A;  4I4T E;  3UU3 A;  2E9X B;  4XBF B;  1WYC A;  3EDV A;  2XNT A;  2V1D B;  4N78 D;  3RGL A;  2D2S A;  2CE7 A;  3OVU A;  3FHN A;  4YSZ A;  3UU6 A;  5F5W A;  1ZHC A;  3RYI E;  2XQ6 A;  4DV5 T;  2A2F X;  3CKD A;  3WTN A;  4AQG A;  2DI4 A;  2JMH A;  4M1P A;  4UVA B;  4EYU A;  4U2Z A;  2BKN A;  5JTG A;  1G8X A;  2X9W A;  1BR2 A;  4AIS A;  5KE4 A;  3RF1 A;  2XYT A;  2IC6 A;  2YOE A;  3PUX F;  3ZT6 A;  3PUY F;  3ETV A;  2KLQ A;  2BYN A;  3ZJ1 A;  2XZE A;  3H37 A;  4BAY B;  2Y56 A;  5LGU B;  3EDU A;  3CQG B;  1HNX T;  2RA1 A;  1KFY A;  2X00 A;  4COF A;  3TLW A;  3AAI A;  1AJ3 A;  4H9P C;  3PV0 F;  1YW0 A;  4IE4 A;  5L4E A;  2NWB A;  3QUJ A;  5AFU L;  4TV8 E;  4U3C A;  2EHO B;  3OKQ A;  3QB5 A;  4UM3 A;  3ABV A;  3ZMS B;  2D0T A;  2V7I A;  2JRK A;  3ETU A;  3EVY A;  5FVL A;  5FXX A;  5L3D B;  4NZB A;  4DR3 T;  2E5L T;  1XDP A;  5LGT B;  4O8S A;  3SFD A;  5L3G B;  2XQA A;  1B7T A;  4O4H E;  3GA8 A;  2WQY A;  5KXJ A;  4QAA A;  4KI0 F;  3AXJ B;  3OPC A;  2YDQ A;  2ZM8 A;  3UFG A;  1T98 A;  5IHY A;  4P1N A;  1UGO A;  1VCS A;  4E7Z A;  5BW2 A;  5J5I A;  2JIW A;  1MMN A;  3V5S A;  4KBM B;  4X64 T;  2J1D G;  4ADZ A;  2X67 A;  3PUW F;  5CA0 E;  3FB2 A;  4ILA A;  4O2B E;  5HEO A;  3W15 B;  2IML A;  5AQQ B;  2E9X A;  4ZRU A;  4ZOL E;  2KSR A;  5KDM C;  5AQF B;  2ES0 A;  4QHO A;  3O1H A;  4EB6 E;  1OED C;  3KDS E;  1UW6 A;  3A5X A;  2ACZ A;  4ZI7 E;  3PE0 A;  4UEL A;  2UXX B;  2X9X A;  2FJA A;  3SOL A;  3WTI A;  5LHH B;  3T1H T;  3ONL C;  2HPL A;  4YTN A;  4XZC A;  3GN5 B;  2CMR A;  4HFE A;  2ODU A;  2SPC A;  3C64 A;  2N1G A;  3RIU A;  3VR9 A;  5LG4 A;  4OHF A;  1I94 T;  3DJB A;  4U74 A;  3UUM A;  5J5G A;  4G2A A;  3UUN A;  5EK3 A;  3RIF A;  2CRB A;  4H9S E;  3Q5E A;  4IDZ A;  4O4I E;  1CUN A;  1E7P A;  2Z6E A;  3LBX B;  3Q2M A;  2VK9 A;  2YDR A;  4WW0 A;  4QKN A;  5DQV A;  5LHI B;  2BR8 A;  3WAJ A;  3C4Z A;  4JI6 T;  2V5C A;  2KT9 A;  3NZQ A;  1E2A A;  2VKJ A;  4ZJT A;  4DUY T;  5J2T E;  3IHR A;  2XUE A;  2LSI A;  3ZT7 A;  2QC1 B;  5IUX A;  1KK7 A;  2H89 A;  4CXW A;  3KV6 A;  3NKZ A;  2YME A;  4UV8 B;  4U2Y A;  3M65 A;  1UCU A;  2CXF A;  2LKG A;  2UXB T;  4YJ3 E;  4YTP A;  4LMJ A;  2J47 A;  3I0O A;  4PK6 A;  4AXP A;  3AXJ A;  5AQT B;  2BS4 A;  2M6I A;  2LEH A;  2BVL A;  3RYC E;  3EI0 A;  4DV0 T;  2XSB A;  2XAS B;  4DBM A;  2BS3 A;  4PAG A;  3WI3 A;  4B3M T;  2ZLY A;  2UUA T;  3O9X A;  3OTO T;  2CLY C;  5JRE A;  4UY2 A;  5L3B B;  4ZZB A;  3MK7 C;  4AKG A;  3LSV A;  1U5P A;  5H6R B;  1LVF A;  3KVA A;  4TUY E;  4ZK1 A;  2W67 A;  3G06 A;  4GYS A;  2VVS A;  2B1E A;  4JI0 T;  1HX8 A;  4A98 A;  5FL0 A;  1ZV4 X;  3E22 E;  1X79 A;  3VKG A;  2YMD A;  2WY2 A;  4TX5 A;  3P7I A;  3MKD A;  3U78 A;  2K3W A;  4DR6 T;  3UU8 A;  3PEO A;  2V26 A;  2W61 A;  5LGN B;  3AE4 A;  4DV1 T;  2HHH T;  3GN5 A;  2WU2 A;  3KBU A;  2PJQ A;  2BBJ A;  4PFP A;  4I43 B;  2A9U A;  4QXC B;  2LM2 A;  4JI1 T;  4PFO A;  2WDV A;  3L39 A;  4AI6 A;  5CO5 A;  1VCT A;  4EOZ B;  3CPZ A;  2BKP A;  2R6G F;  2X0Y A;  3FZM B;  3VKH A;  1YKE B;  3ZC0 A;  2XQ8 A;  1Y01 A;  4LML A;  4DR7 T;  1Y64 B;  2XQ5 A;  4LF8 T;  3MZK B;  4U31 A;  4IE0 A;  3WAK A;  2WDQ A;  4WV9 A;  3DP7 A;  3RHW A;  5AFJ A;  2BBH A;  3UT5 E;  4IST A;  1KNZ A;  3IGQ A;  4DR4 T;  4WBN E;  2CXL A;  4I55 E;  5F3J A;  3ZLI A;  3IA3 A;  4IL4 A;  1D1C A;  4AKL A;  3GWH A;  1N36 T;  2E2A A;  3U8M A;  4TV9 E;  3AE1 A;  4ZR6 A;  2IDO B;  2W63 A;  4EZH A;  3MJX A;  3B57 A;  4H9R C;  3K3Q C;  3AE9 A;  2D9D A;  2JQ9 A;  3FZF B;  3SFE A;  4CI1 B;  1VOM A;  2V6X A;  5HYA A;  4AKR B;  5AQM B;  5FYM A;  3E08 A;  1N33 T;  3SH1 A;  2LOS A;  5JDH A;  4UXU A;  4DVD A;  4JLE A;  3JC6 D;  3EHZ A;  4PJN A;  4PIR A;  2V7K A;  1MND A;  2OA5 A;  4DMV A;  2CA5 A;  2ZM6 T;  2BDE A;  5AQK B;  2UUC T;  4HFH A;  5IYZ E;  4Z8X A;  3SWH A;  1NAF A;  4PJJ A;  4PJL A;  3WTK A;  2IAK A;  3C79 A;  3AE7 A;  1XNQ T;  3P4P A;  4YXD A;  4D01 A;  2ZM0 A;  3Q9D A;  2XZ5 A;  1HX1 B;  2YIN A;  3LK2 B;  1HCI A;  3AE5 A;  4JI7 T;  4A5X A;  2XAG B;  1WRD A;  1L0V A;  4GKJ T;  1HG5 A;  2X9H A;  3P4S A;  5HXR A;  4HEA A;  2KZ7 B;  3B13 A;  5AFL A;  4HFC A;  4CXX A;  2FBW A;  3MA9 A;  2EHO D;  5AQO B;  2LOP A;  2V7M A;  2W8G A;  4EV6 A;  4P0B A;  1T7S A;  4PNI A;  1KF6 A;  1GQE A;  2WNJ A;  2W4X A;  4ZS3 A;  2WSS V;  2LSJ A;  2P9B A;  3ANW B;  4CN6 A;  2CBJ A;  2NP9 A;  3ZMV B;  4ZJS A;  2VL8 A;  2B76 A;  4CQI A;  5LMU T;  4CI3 B;  3AE8 A;  3WTL A;  5H6Q B;  2FJB A;  5LOV E;  2W66 A;  2W2U A;  2G0U A;  3ZC1 A;  5LBM A;  2X66 A;  3WTO A;  4HKA A;  2NTY A;  5FJV A;  4KHZ F;  2DWK A;  1Z0P A;  3RQU A;  1FJG T;  1XDO A;  2MAW A;  4P0A A;  4LF9 T;  3PUS A;  3N2G E;  1XWM A;  1QSD A;  3AA0 B;  5LMN T;  5LNK A;  2IUB A;  2ZM2 A;  4LFC T;  4HFI A;  4BFQ A;  4MAL A;  1S94 A;  3AAE B;  3P4W A;  2W0G A;  3OJA A;  2VWA A;  5HXC A;  2QYW A;  3O4X E;  2DCF A;  3ZMZ B;  1MIY A;  3V5U A;  2BKO A;  1W9R A;  2XZ6 A;  1BR0 A;  1NEN A;  3BK9 A;  2LHR A;  3AEF A;  3CWZ B;  1IAP A;  3VHL A;  3CQX C;  5FXV A;  4YJ2 E;  4DND A;  4MBQ A;  5HEG A;  3I9W A;  4U7I A;  2K5B B;  2LM9 A;  2X0H A;  4BA9 A;  3WTH A;  2E8I A;  5AQN B;  4ZI2 D;  4DR2 T;  2ZMA A;  3PMZ A;  1NEK A;  4IGU A;  4HWC A;  1WYB A;  3RH3 A;  5JR9 C;  3T1Y T;  5LJM A;  3FZK B;  4V1A v;  5LHG B;  3K8P C;  1SUM B;  5ETW A;  4B6X A;  5L3E B;  3ANW A;  3PTR B;  5FL1 A;  3QK6 A;  3N2K E;  3PUG A;  4HE8 A;  4JUY A;  4L9I A;  1MIV A;  3NZP A;  4K0K T;  2DNX A;  3KBT A;  3JC6 C;  3CX6 B;  1VRB A;  4H9N C;  4JEH B;  4EZ1 A;  1UUR A;  5BMV E;  1MMD A;  2HPJ A;  2V7L A;  3GMI A;  4MHC A;  4DV2 T;  3LDQ B;  4TWH A;  4YY3 T;  3UUX B;  4ZS2 A;  4EED A;  2H3R A;  3X1D A;  5EZY E;  4K0U A;  4QXH B;  2YDS A;  4IDO A;  3O1I A;  5JDF A;  4X62 T;  4L5G A;  4JI8 T;  5JQG E;  2Y48 B;  4XAX B;  1OED E;  2L3L A;  4YSY A;  4H63 V;  2XNV A;  2WZI A;  2W8F A;  3R84 B;  3FZL B;  3U8L A;  2H7V C;  3T8O A;  2EHO C;  3K3O A;  3UUL A;  2LLY A;  4X5T A;  5KX5 E;  2K9A A;  2W62 A;  4AQY T;  3JAD A;  4KP3 C;  4DO0 A;  1UX2 A;  2F4V T;  4DID B;  3H3M A;  1UK5 A;  3N9N A;  5AIN A;  2XNU A;  2XTL A;  4PW8 A;  3ZCJ A;  1IBM T;  4EYY R;  5BP0 A;  4UEM A;  4IDN A;  5JVD E;  4CN4 A;  1D0Z A;  2X68 A;  2CLY B;  1QLB A;  3K1S A;  1HNW T;  2VQE T;  4BJN A;  5HXE A;  3R6N A;  4NUV A;  3CX7 B;  1D0Y A;  3AEG A;  5HCM A;  2XPK A;  4TNW A;  5IWA T;  5HAX A;  2Q9Q D;  1ZKE A;  3MXZ A;  2QVA A;  4A56 A;  5J5F A;  4UF0 A;  2LRK A;  4MFR A;  2MPK A;  2JQK A;  3FXE B;  1ZP0 A;  4CZZ B;  3E0Z A;  4AKI A;  3TKL B;  2AXD S;  2RP4 A;  2BR7 A;  2BJ0 A;  1EZ3 A;  3RRC A; 
#chains in the Genus database with same CATH homology
 4HFE A;  2YN6 A;  3RI5 A;  3U8M A;  4ILB A;  2W8G A;  4QH5 A;  4TNV A;  5L4E A;  2WNC A;  2XZ6 A;  3GUA A;  4ZZB A;  4UY2 A;  5AFH A;  1OED E;  2UZ6 A;  3U8N A;  3LSV A;  2Y57 A;  2WNJ A;  4UM3 P;  2XNV A;  3RIA A;  4ZR6 A;  4ZK1 A;  4QAB A;  1OED A;  2Y58 A;  3TLV A;  3EAM A;  4IL9 A;  2W8F A;  2ZJV A;  4XHE A;  5AFM A;  4UM3 S;  3U8L A;  4UM3 A;  5AFN A;  4ZZC A;  4A98 A;  5LG3 A;  5J5G A;  3UU4 A;  2PH9 A;  3ZDH A;  3C84 A;  3RIF A;  3ZDG A;  5HEG A;  4ZJS A;  2LLY A;  5JME A;  2VL0 A;  2YMD A;  4NZB A;  4X5T A;  3SQ6 A;  4QH1 A;  2XQ4 A;  2PGZ A;  2XQ9 A;  2XYS A;  3JAD A;  5J5H A;  5CFB A;  3WTH A;  2XQ3 A;  3UU8 A;  4XK9 A;  3SH1 A;  3WTL A;  1UX2 A;  4UM1 A;  2BYR A;  3WTJ A;  1UV6 A;  3PEO A;  2Y7Y A;  4ZK4 A;  3UU3 A;  5HEU A;  2XQA A;  5L4H A;  4HFB A;  3U8K A;  5HEJ A;  3PMZ A;  4UXU A;  4QAA A;  4A97 A;  4IRE A;  4BQT A;  2XNT A;  2BG9 B;  2BR8 A;  3EHZ A;  4TWF A;  2BYP A;  5AIN A;  4PIR A;  4Z90 A;  3UQ4 A;  2XNU A;  2LM2 A;  3WTO A;  3U8J A;  4ZJT A;  3WIP A;  5CO5 A;  3UU6 A;  4HFH A;  5BP0 A;  5FJV A;  3JAE A;  2XQ6 A;  5HEH A;  2WNL A;  4LMK A;  2ZJU A;  2X00 D;  3WTN A;  2M6B A;  3RQU A;  5LXB A;  2QC1 B;  2MAW A;  3JAF A;  4TWD A;  5IUX A;  5BW2 A;  5J5I A;  4FRR A;  4HQP A;  3T4M A;  3WTK A;  5BRX A;  2BYS A;  3C79 A;  1I9B A;  4QH4 A;  4D01 A;  4Z91 A;  2Y54 A;  5TVC A;  2YKS A;  3RQW A;  2YME A;  2BYQ A;  2XQ8 A;  5KE4 A;  4LML A;  3TLT A;  5SYO A;  2XZ5 A;  2XQ5 A;  4HFD A;  4ILA A;  3ZKR A;  2LKG A;  2YOE A;  5HEO A;  2XYT A;  4AFG A;  3UU5 A;  4ALX A;  4HFI A;  4EZ1 A;  1OED B;  4LMJ A;  4ZRU A;  2BYN A;  4BFQ A;  2BG9 E;  5J0Z A;  2BG9 C;  2XQ7 A;  2C9T A;  2KSR A;  3UUB A;  2Y56 A;  5AFM B;  2BG9 A;  3P4W A;  4TWH A;  4AFH A;  1OED C;  2WZY A;  4WV9 A;  5KZU A;  5HCM A;  3RHW A;  1UW6 A;  5HCJ A;  4TNW A;  3WTM A;  5AFJ A;  2M6I A;  3UQ7 A;  2X00 A;  4B5D A;  5L47 A;  3EI0 A;  5J5F A;  3TLU A;  4COF A;  3IGQ A;  4NPP A;  3TLW A;  2LKH A;  2WN9 A;  4F8H A;  3SQ9 A;  5AFL A;  4DBM A;  4HFC A;  3P50 A;  3WTI A;  4QAC A;  4ILC A;  3SIO A;  5AFK A;  4AFT A;  4IL4 A;  2BR7 A;  2BJ0 A;  3TLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...