4NPPA

The glic-his10 wild-type structure in equilibrium between the open and locally-closed (lc) forms
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Crystal structures of a pentameric ligand-gated ion channel provide a mechanism for activation.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4nppA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4nppA01
4FRRA 2XQAA 3WTOA 2VL0A 3UU4A 1UV6A 4X5TA 2X00D 4QABA 4TNVA 3RI5A 5IUXA 5AFHA 3RIAA 4HFBA 2BYSA 2WNLA 4ZRUA 5HEOA 4ZK4A 2BYRA 2XNUA 5JMEA 4TNWA 2BG9B 1UW6A 4ILAA 4ALXA 2YMDA 5CO5A 3P50A 5HEHA 5HEJA 3RQWA 3ZDGA 4IREA 3ZKRA 3JAEA 4Z90A 5L4EA 2BYPA 3ZDHA 4IL4A 4AFHA 5J5IA 3UU3A 1I9BA 5BW2A 1UX2A 2YOEA 2XQ3A 4LMJA 4COFA 3SQ9A 2XQ9A 4Z91A 4NPPA 2XQ4A 2WZYA 5L4HA 2YMEA 2XQ8A 5J0ZA 2XNVA 3EI0A 2XZ5A 4PIRA 1OEDA 3TLSA 4AFGA 3WTKA 3GUAA 5KZUA 2WNJA 2W8GA 3EAMA 4HFCA 3RHWA 5HCMA 5LG3A 4TWFA 4HFIA 4BQTA 4A97A 5AFMB 2W8FA 1OEDE 3WTMA 4HQPA 4A98A 2Y58A 5HEGA 2WN9A 4QACA 2MAWA 4IL9A 4ILBA 4HFHA 1OEDC 2ZJUA 2XNTA 2XQ7A 3U8LA 5CFBA 2KSRA 5FJVA 3C79A 3UUBA 4BFQA 5AFNA 4HFDA 4TWHA 4F8HA 2M6BA 4ZZCA 4ZJSA 3UU8A 5J5FA 5BP0A 3RIFA 5KE4A 3UU5A 2WNCA 4ZZBA 3UU6A 3EHZA 2LLYA 2Y56A 2Y54A 4EZ1A 2XQ5A 5AINA 4XK9A 4QH4A 3WTJA 4QH1A 2X00A 2BG9C 3TLUA 4UM3P 2UZ6A 3U8NA 3WTLA 3IGQA 3C84A 2BYQA 4LMKA 2YKSA 4QAAA 3WTNA 4TWDA 3TLWA 5LXBA 2YN6A 3P4WA 3TLTA 2C9TA 3U8KA 4NZBA 3PEOA 5BRXA 4ZJTA 4XHEA 3U8JA 4WV9A 2LM2A 2LKGA 3UQ4A 2BG9A 5J5GA 3WIPA 3WTIA 2BYNA 2ZJVA 4UM1A 2XQ6A 4UM3S 5J5HA 4D01A 4HFEA 2XYSA 2XZ6A 4UY2A 3SQ6A 4UXUA 3TLVA 4ZK1A 4UM3A 2PH9A 3WTHA 3LSVA 2BG9E 2LKHA 4B5DA 5AFJA 3PMZA 3U8MA 2Y7YA 2QC1B 5HEUA 4AFTA 2XYTA 5AFKA 2PGZA 3JADA 4LMLA 3RQUA 4ZR6A 2BJ0A 5AFLA 3JAFA 3UQ7A 4QH5A 4ILCA 3SIOA 3T4MA 1OEDB 5HCJA 5TVCA 5SYOA 4DBMA 2BR8A 2BR7A 2M6IA 5L47A 3SH1A 5AFMA 2Y57A
chains in the Genus database with same CATH superfamily
5M4YA 4GYSA 4NIQA 1WYCA 2IC6A 4LF7T 3AAIA 2XNUA 2WCAA 3RLFF 4TNWA 4JUYA 3CIRA 3JCFA 5LHIB 4YSZA 1W0BA 4YHHT 3RPUA 3RQWA 5L4EA 4MLKA 1I9BA 3ONXA 1UX2A 2XQ3A 3UT5E 1W9RA 4AKLA 2XAHB 3EI0A 2E8IA 4IE4A 3PU3A 2XZEA 4U3CA 4UV9B 3VR9A 1L0VA 4BQTA 1X79A 2XAGB 4CQIA 1X9BA 3A8YC 3ZMUB 2X0YA 3I0OA 4DV6T 4I55E 1FEWA 2HHHT 2UXDT 3UULA 5EK3A 4WW0A 1XMQT 3RRCA 3ZMTB 3EHZA 4EZ1A 4AQFA 2X68A 4QH1A 4YT0A 2BKNA 3FBLA 1IBKT 2KT9A 2LSIA 2UU9T 3WTLA 4UELA 4C90A 4JI4T 4IDNA 2IMLA 3WTIA 2BYNA 1AJ3A 3FB2A 2XZ6A 4DV7T 3PJAA 4ZI3C 2XJ7A 4EYUA 2PGZA 4KMCA 2XM2A 3R84B 2XHEB 1KNRA 4F6RC 2W4XA 1XNRT 3F31A 2XQAA 5DQVA 1LVKA 3GWHA 4ZK4A 2JMHA 2VWAA 4IE5A 5IWAT 1HNZT 4EEBA 4ZEYA 1SA0E 5DQWA 5LBMA 2RPAA 2WZYA 2KNDA 3W15B 4I0UA 3F57A 1LRZA 4AFGA 2PG8A 1IZNB 3ONLC 2D2SA 2J47A 3SFDA 4QACA 2JQ9A 4IL9A 2ZJUA 3NZPA 4L5GA 4AQYT 2XM1A 1IJ6A 4KP3C 4TWHA 4B3TT 2Y48B 3MZKB 2XAQB 2WS3A 3TKLB 2CA5A 4ZZBA 2VKDA 3WTJA 5LGUB 3ETUA 4AI6A 2V7KA 4TV9E 3H37A 4EOZB 1UX5A 5J2UE 5BRXA 3UUXB 4ZJTA 1XDPA 2LM2A 2ZJVA 4UXUA 4FI5A 3PMZA 4JI7T 5FP3A 3FZHB 4AFTA 4DR2T 4GK0E 4OX9T 2ACZA 2VQFT 5TVCA 4JI6T 5CB4E 5LJNA 4YTNA 5JDQA 4ZRUA 2V26A 1KEYA 2LT3A 2XQYA 5HAXA 3AA0B 1UW6A 4MFRA 4GIWA 3ZMSB 3L39A 2ZMAA 3ZN0B 3JAEA 3AA6B 3MK7C 4IL4A 5CGMA 4HTEA 2WZIA 4ADZA 1YQ3A 4HWDA 4EIWA 4HFIA 2CBJA 5LJMA 1OEDE 5FL0A 5HEGA 2WU5A 4CXXA 4AKRB 1WFDA 5JRCA 2X66A 2YINA 5FJVA 3N2GE 3RYHE 3X1DA 4HFDA 4F8HA 2M6BA 4ZJSA 2CWYA 2DWKA 4AKGA 4H9PC 4JI0T 3ZYKA 3RKOA 2D0TA 4LFCT 4QH4A 2V7LA 4AXPA 3NKZA 3AEFA 1YW0A 2BYQA 2WWVA 1US7B 3U8KA 4NZBA 5FYMA 4P0BA 3L3PA 5J2TE 4DV3T 4QX7B 4UM1A 4D01A 2J62A 3MJXA 5FY1A 2XPKA 2WY2A 4ZK1A 2JPFA 2ZLYA 3LSVA 3AVSA 3F2EA 1NEKA 2F4VT 2QVAA 3RQUA 4XAXB 2BJ0A 2WDVA 1HX8A 4ILCA 5HCJA 2BR7A 2HN1A 1HNXT 2V5CA 2MTQA 3QOFA 3SOLA 5AFHA 3IEEA 3T8OA 3RIAA 2YDSA 3RX6A 3I9YA 2E9XD 3LDQB 4FJOA 4DBRA 2WM9A 5HEJA 3I9WA 3LJCA 2YDRA 5J5IA 2LOSA 3PUQA 5BW2A 5C2TA 3ANWA 4ISTA 3PUAA 4YSYA 1D1CA 3RIUA 3ZLIA 4DV0T 4JI1T 2Y58A 2L8KA 1MIWA 4JEUB 3P4QA 4HN9A 4J2CA 4BA9A 2IDOB 4CN4A 3EUHA 4DUYT 2WDQA 4PK6A 3NRXA 2EHOA 2Y56A 2CM0A 3IA3A 1I6ZA 4AISA 3TLUA 5L3BB 2YKSA 3P4WA 2V6YA 3U8JA 5JDHA 4UM3S 3HL6A 4UF0A 2XQ6A 2H7VC 4K0KT 1D0YA 2CBIA 4DMVA 3MXZA 4AIUA 2LSGA 3J9X1 4IHJE 1XNQT 1NWMX 3LBXB 5HXCA 4ZI2C 2D0UA 1W09A 2DI4A 2VL0A 4PJLA 3CQGB 4PW8A 4QABA 3P7IA 1LVFA 2WNLA 5IHYA 4ALXA 2C5IT 1J1JA 2L3LA 4GKJT 4IREA 3ZKRA 2I59A 5BMVE 4CI2B 2BYPA 4MBQA 1XDOA 5ABEA 2WU2A 1QUUA 1WR6A 5FL1A 2JRKA 5J0ZA 1HR0T 2DNXA 3D0TA 4OFZA 4LF9T 4IT4A 4IIJE 5KZUA 4UIGA 1UURA 5FVKA 2UXNB 5KDMC 5AFMB 1ZKEA 2KINB 3I0QA 3OBVE 2Z6EA 1T98A 3FXEB 4KHPT 2WAUA 4B6XA 3L8RA 3C4ZA 4I50E 5AQIB 5CFBA 3C50A 3RRWA 4BFQA 2VURA 5DABA 4PJJA 1IJ5A 3N5LA 2QYWA 3E0ZA 3ZT5A 2NTYA 1YKEB 2H88A 2ODUA 1NAFA 2C9TA 3PEOA 1ZV4X 5FVLA 5JVDE 3LK42 2VL8A 5KX5E 4UR9A 4JV5T 1QLBA 5JDMA 4GOUA 2LKHA 3RYCE 4PAGA 2CLYB 4AKHA 3PUVF 4QXCB 2XSAA 3FZFB 4HEAA 5HXRA 1FIOA 3UQ7A 1DU2A 5CA1E 2BR8A 5L47A 3SH1A 5LMNT 5HXEA 4DR5T 4TNVA 5IUXA 4QXBB 2BS4A 4DV2T 2CRBA 2L9QA 5ABGA 1N33T 4JEHB 5JMEA 1V9DA 3CPZA 1VCSA 4B3RT 4DR3T 4WYVA 4JLEA 3RH3A 5AQLB 1ZOYA 3C51A 2LSKA 4PIRA 3WTKA 3GUAA 4HWIB 1OXZA 4X65T 3EAMA 4HFCA 4EXTA 2ZM6T 3PUWF 3C98B 3AEAA 1T8BA 4YY3T 3EDVA 2A2FX 4HQPA 5JREA 3AA1B 4TV8E 1FMWA 4HFHA 2BKPA 3K3QC 3PU8A 5ADXL 3N2OA 2LSYA 2W66A 1UUSA 4KX6A 3SFEA 2KLQA 3RF1A 2HH7A 3FZMB 5DJQC 3H3MA 1KNPA 2V5DA 3WTNA 2W62A 2YN6A 4X20E 3CX7B 2Q9QB 3WIPA 2BG9A 3AE3A 3BQIA 2YK0A 3UFGA 2XYSA 4UY2A 1HX1B 4O2AE 4CN6A 2PH9A 5AFJA 4YTPA 2HPLA 2C0SA 5AQQB 4NXMT 4X1KE 3JAFA 2CCQA 2PJQA 3IBPA 5HWXA 1MMDA 3OYXA 2DHRA 2X00D 1M7KA 3GN5A 2BS3A 3OYZA 4ZOLE 3QUJA 3AEDA 3AECA 3PTRB 2ZM0A 2YMDA 4LF6T 4PJNA 4PFPA 1NENA 2B76A 3A7MA 4L0RA 4DR4T 2VVSA 3OJAA 4LMJA 5A1LA 2FJDA 3V5SA 2CLYC 3EABA 3K3OA 1MNDA 2W63A 5LG4A 4UVCB 1VCTA 3AE1A 4MALA 2LRKA 3T1YT 5LXTE 5AQVB 5BP0A 2PBIA 5KE4A 3UU5A 5JR9A 2SPCA 5AINA 2NP9A 4KHZF 4IDQA 1E1HB 1M62A 4UXNB 3PUSA 3NBXX 2X67A 2ES0A 3H3AA 4BJMA 3TLTA 3AB3B 3EVYA 3ZSTA 3K1SA 4H63V 4XHEA 4U74A 4WV9A 4V1Av 4JBWF 2V6XA 3HKCE 2QGSA 5EZYE 1HTJF 2IW5B 2IUBA 2FUPA 4TX5A 2OLTA 4QHOA 5JH7E 2DWGA 3DTOA 1OEDB 5SYOA 4FRRA 3BQLA 3CVRA 4Q25A 1KK7A 1U4QA 1MMGA 2JQHA 2JMKA 2W67A 2N9DA 4E7ZA 2AXDS 1T7SA 1UGOA 4LF8T 4IDOA 2PTFA 2MPKA 3ZDHA 2LEHA 1Z0PA 4ZI2D 2Q9QC 3B5MA 5LHGB 2XQ4A 2CHOA 5C8YE 3AXJA 3KVBA 4U7YA 3PUGA 2W8GA 4A97A 3IHRA 4KUMB 4YFSA 5HXHA 2C5JA 3DJBA 1N34T 3VKGA 1GQEA 3E22E 3P8CD 4OYJA 3HI2A 4ZS2A 3RC8A 3VKHA 4XK9A 2X00A 2DCFA 1WCRA 1D0ZA 1WLXA 3CWZB 3ANWB 3N9NA 4LMKA 4U33A 2IHR1 4DO0A 2I6HA 2BBJA 2LKGA 2JQQA 5AQMB 3KDSE 2UUBT 2UXCT 2QC1B 1I94T 3KINB 1KNZA 3ZT7A 4WZXA 1QSDA 5AFLA 5L3DB 5HYAA 2EHOB 1SHZC 5F8PA 5EK4A 2LHNA 5JDNA 2CXLA 4PFOA 2MOZA 4ZXLA 3AE9A 2Y57A 3Q9DA 3Q5EA 2WSSV 4OHFA 1XWMA 1JNZA 2V6YB 2BYRA 3Q5DA 4HWCA 4UF0B 2WQYA 3ZDGA 3FZLB 2XQ9A 2YMEA 5L4HA 3KV5A 3ZT6A 5FY0A 5FXZA 4TWFA 2A3DA 3AVRA 1WR0A 3RYIE 1B7TA 2W2UA 3O1IA 4U31A 4LF4T 1OEDC 2BS2A 4CXYA 1WRDA 3N9MA 2K9AA 3V5UA 2YU1A 2XQ5A 3GA8A 1YXRA 5FXXA 4UM3P 4DIDB 4ISSA 4YSXA 3VHLA 2MYSA 2CWOA 4NUVA 5LHHB 4U72A 1SUMB 3UQ4A 3CX8B 1CUNA 3ZYMA 3DP7A 3WTHA 2H7OA 2WWUA 2NR4A 4PNIA 3FBZA 4NXNT 3U8MA 3M3ZB 5HEUA 4GK5E 4H9NC 3HKDE 5AFUL 5ABHA 3SIOA 2LE8A 3FZKB 4BAYB 3J7Yq 1G8XA 4EGWA 1UV6A 3E08A 3WAKA 2J1DG 2X0HA 4LFBT 4HFBA 2UXXB 5HEOA 3ZCIA 2UUCT 2WP9A 2N2NA 2WMNA 5F3JA 3Q2MA 5LP6E 3QK6A 5JQGE 3UUNA 2LM9A 2I0MA 3SRZA 4U2ZA 1HNWT 5ETWA 1LKXA 2QRXA 3M65A 4M1PA 2EHOC 5F5WA 3AE6A 4U2YA 1VOMA 3UTKA 4QKNA 4YTMA 3N9LA 2WNCA 5L3EB 3U78A 3HR0A 5IYZE 2W00A 4IE6A 4OYKA 3IGQA 2VQET 3C84A 2X0LB 4P1NA 3HKEE 3LG7A 3I1AA 4DBQA 2CXFA 2Y8DA 4DNDA 1HFAA 5J5HA 4WBNE 5KMGP 3CK6A 1N36T 4ANJA 4EZHA 2HPJA 1Y64B 4YXDA 2LHRA 1KFYA 1EZ3A 4B3MT 5KXJA 3ABVA 5AQUB 4QH5A 1YQ4A 3R6NA 2VB6A 1D0XA 4IDZA 2E9XA 2M6IA 2DL1A 3CKDA 3ZSSA 3AE8A 3QC9A 5CJ5A 4DR7T 2BYSA 5JDFA 3RKGA 5GONE 3VRBA 2G0UA 2BG9B 3RGLA 5HEHA 3VRAA 1D1AA 3KV9A 1UK5A 1Z8UA 3LBXA 3S4UA 5JDLA 5AQOB 2VVNA 2XQ8A 4CXWA 1Y01A 2FBWA 3OKQA 5HCMA 4KBMB 3O9XA 1HCIA 2B1EA 2W8FA 2V8SV 3WTMA 3BK9A 2WN9A 2MAWA 4KI0F 3OPCA 2W0GA 3GN5B 4DV1T 4H9QC 2R6GF 3KVAA 4U7IA 2Q9QD 2JJ9A 3LFMA 1BR0A 4TZ4C 2CXDA 4PJMA 3UU6A 3NZQA 4EAHA 4HWHA 2YU2A 2X9HA 3NWIA 5LCYA 4WBOA 4UVAB 5LXBA 3KV6A 2X9YA 5J5FA 3P4RA 5AQFB 1J5ET 2XTLA 3SQ6A 3TLVA 4UM3A 2V7JA 2BG9E 2W61A 5LB7B 2PFVA 4YLHA 2Y7YA 4O2BE 2KWIB 5TAOA 3JADA 4LMLA 4ZS3A 2K24A 5H6RB 3N9QA 5JR9B 4H9OC 2CE7A 2UUAT 3N9OA 1BR1A 2RA1A 1MIYA 3AE5A 4H9RC 1MIVA 3OTOT 3ETVA 3PUZF 3ONJA 3QNUA 3P50A 5LOVE 1E2AA 2KMFA 4AFHA 2E5LT 5LBQB 2YOEA 2QA7A 3Q5XA 3AAEB 4E7SA 5E0OA 2FJAA 3TLSA 2NTXA 4YHJA 3RHWA 4HFVA 3AE2A 3JC6C 4O4JE 4TN7B 3KV4A 1HG2A 3ZPOA 1YKHB 3LK3B 5AQTB 2WB5A 5ABFA 3C79A 2CEAA 2KWHA 3RC3A 4DV5T 3AA7B 2BBHA 3O1HA 2HN2A 2IIUA 4I43B 2BG9C 3U8NA 4JI3T 1YD8G 4DUZT 2ZM2A 4YJ3E 4CN1A 1J5WA 3ZJ2A 3AXJB 1IAPA 2WDRA 3KFWX 4QAAA 2X51A 5EK2A 4GYRA 4AQFC 3UUMA 4O4IE 5J5GA 3CQCB 3ZEFB 4IE7A 5L3FB 1FJGT 4QX8B 5AQPB 1IBMT 3PURA 4EB6E 2RP4A 2VKJA 4ERRA 3LK2B 3T4MA 5CA0E 2CMRA 1N32T 3ZC0A 4CZZB 2M67A 4X5TA 3A5XA 3NRYA 4JYAT 4QXHB 1WYBA 4B3ST 1ZHCA 2Q9QA 1UX4A 5JRCB 4ILAA 5CO5A 2J4GA 4LFAT 3PE0A 4IGUA 2Y6XA 3O4XE 2H3RA 3VR8A 5L2LA 3SQ9A 4K0UA 1R8IA 1IBLT 2N1GA 3N9PA 3K8PC 3AAAB 5FMNA 3ESLA 5FXVA 3OVUA 2XAJB 5FNVE 1HS7A 3QB5A 5JR9C 2E2AA 5LGTB 4EEDA 5J1GA 3PJAJ 5LNKA 2XNTA 1VRBA 3U8LA 3HA4A 5LMUT 2P9BA 2WBLA 3ZN1B 4JI8T 5L3CB 4O4LE 3B57A 3RIFA 5LA6E 2Y54A 1BR2A 1KF6A 2OV9A 2WMOA 4IDPA 3G06A 2BZBA 1T72A 1MMNA 2NW7A 2C5KT 2EHOD 4H9SE 4ZHQE 4DMWA 5AQNB 2X9WA 3C4WA 2UXBT 4HFEA 2V7MA 1E7PA 2YEVC 2BKOA 2KZ7B 3AEEA 4X62T 1OWAA 4AQGA 3P4PA 1U5PA 4Z8XA 2GK9A 5AQRB 5AQHB 4ASKA 2DLRA 4DR1T 3ZYLA 3ZJ1A 3C64A 2LSJA 4O8SA 2BVMA 2IAKA 2LOPA 1CHUA 2XAFB 4X1YE 3FXDB 3AE7A 4CI1B 3VU7H 4TUYE 4DV4T 2XZ5A 1OEDA 4DR6T 2WZHA 3BQKA 2LRLA 3QB5K 4JI5T 4A56A 1MNEA 4XBFB 4NUUA 1SE7A 3UUBA 3CX6B 5AFNA 3PUXF 1O3XA 3UU8A 2NWBA 2XY8B 2LLYA 2VK9A 3PV0F 3WI3A 1S35A 1HF8A 5JTGA 2K3WA 3SWHA 2IC9A 5FY7A 4GKKT 2CHNA 4X66T 3U3IA 3T1HT 2YDQA 1ZP0A 1FMVA 5JDGA 4HWFA 5HXSA 2XASB 4HGAA 5C3JA 4B5DA 1HG5A 4UEMA 2NW9A 4N78D 2ODVA 4I4TE 2D5UA 5H6QB 3WTOA 4OK0A 2H89A 4IE0A 3RI5A 4X64T 2FJEA 3CQXC 4XZCA 2K48A 3ZCJA 1ZEEA 3ZC1A 3MKDA 4EYYR 1D1BA 5LYJE 2VKOA 4Z90A 2K5BB 4O4HE 3MA9A 5BR8T 4Z91A 3L09A 3ZMVB 4PK5A 2XNVA 1XZYA 1W0AA 4G2AA 4L9IA 2VASA 4WNKA 2KXPB 2E9XB 2A72A 4A98A 1UCUA 2XUEA 3PDYA 4HE8A 3IF8B 2XQ7A 3RIUC 2KSRA 3AEGA 3UFEA 3AEBA 4C91A 5L3GB 3HKBE 4QWNB 5AQJB 3RYFE 2UZ6A 3JC6D 1XMOT 4TWDA 3P4SA 1BR4A 3KBUA 4PK4A 2V7IA 2FJBA 4BJNA 4ZI3D 5AFKA 4ZR6A 4A5XA 5FKYA 5AQSB 4H63H 3WAJA 3CMLA 3C4XA 1JNRA 4ILUA 2JIWA 1H7CA 4DBMA 3UU4A 3SS1A 2NW8A 3AE4A 3N2KE 4ZI7E 4CI3B 2BDEA 2V1DB 4LF5T 5AQGB 4P0AA 3UU3A 4COFA 2X9XA 3NVOA 4NPPA 5AQKB 3MACA 2D9DA 3ZMZB 2WNJA 5LG3A 4G63A 4JI2T 2XSBA 4EZ4A 2E5VA 2BVLA 4ILBA 4P09A 5HWYA 1MMAA 2VKHA 2AE9A 4ZZCA 4MHCA 3GMIA 3KBTA 4HKAA 5LGNB 4UV8B 3EDUA 1G73A 2A9UA 2ZM8A 3TLWA 3FHNA 3B13A 4DVDA 1S94A 3PUYF 2CPTA 4YJ2E 2LJLA 4EV6A 5FXWA 2JQKA 4X1IE 3Q5WA 3K3NA 2OA5A 2E9XC 3O1JA 5ABFB 2XYTA 2ACXA 2NOXA 4AKIA 2MBGA 4UVBB 5AFMA
chains in the Genus database with same CATH topology
4FRRA 2XQAA 3WTOA 2VL0A 3UU4A 1UV6A 4X5TA 2X00D 4QABA 4TNVA 3RI5A 5IUXA 5AFHA 3RIAA 4HFBA 2BYSA 2WNLA 4ZRUA 5HEOA 4ZK4A 2BYRA 2XNUA 5JMEA 4TNWA 2BG9B 1UW6A 4ILAA 4ALXA 2YMDA 5CO5A 3P50A 5HEHA 5HEJA 3RQWA 3ZDGA 4IREA 3ZKRA 3JAEA 4Z90A 5L4EA 2BYPA 3ZDHA 4IL4A 4AFHA 5J5IA 3UU3A 1I9BA 5BW2A 1UX2A 2YOEA 2XQ3A 4LMJA 4COFA 3SQ9A 2XQ9A 4Z91A 4NPPA 2XQ4A 2WZYA 5L4HA 2YMEA 2XQ8A 5J0ZA 2XNVA 3EI0A 2XZ5A 4PIRA 1OEDA 3TLSA 4AFGA 3WTKA 3GUAA 5KZUA 2WNJA 2W8GA 3EAMA 4HFCA 3RHWA 5HCMA 5LG3A 4TWFA 4HFIA 4BQTA 4A97A 5AFMB 2W8FA 1OEDE 3WTMA 4HQPA 4A98A 2Y58A 5HEGA 2WN9A 4QACA 2MAWA 4IL9A 4ILBA 4HFHA 1OEDC 2ZJUA 2XNTA 2XQ7A 3U8LA 5CFBA 2KSRA 5FJVA 3C79A 3UUBA 4BFQA 5AFNA 4HFDA 4TWHA 4F8HA 2M6BA 4ZZCA 4ZJSA 3UU8A 5J5FA 5BP0A 3RIFA 5KE4A 3UU5A 2WNCA 4ZZBA 3UU6A 3EHZA 2LLYA 2Y56A 2Y54A 4EZ1A 2XQ5A 5AINA 4XK9A 4QH4A 3WTJA 4QH1A 2X00A 2BG9C 3TLUA 4UM3P 2UZ6A 3U8NA 3WTLA 3IGQA 3C84A 2BYQA 4LMKA 2YKSA 4QAAA 3WTNA 4TWDA 3TLWA 5LXBA 2YN6A 3P4WA 3TLTA 2C9TA 3U8KA 4NZBA 3PEOA 5BRXA 4ZJTA 4XHEA 3U8JA 4WV9A 2LM2A 2LKGA 3UQ4A 2BG9A 5J5GA 3WIPA 3WTIA 2BYNA 2ZJVA 4UM1A 2XQ6A 4UM3S 5J5HA 4D01A 4HFEA 2XYSA 2XZ6A 4UY2A 3SQ6A 4UXUA 3TLVA 4ZK1A 4UM3A 2PH9A 3WTHA 3LSVA 2BG9E 2LKHA 4B5DA 5AFJA 3PMZA 3U8MA 2Y7YA 2QC1B 5HEUA 4AFTA 2XYTA 5AFKA 2PGZA 3JADA 4LMLA 3RQUA 4ZR6A 2BJ0A 5AFLA 3JAFA 3UQ7A 4QH5A 4ILCA 3SIOA 3T4MA 1OEDB 5HCJA 5TVCA 5SYOA 4DBMA 2BR8A 2BR7A 2M6IA 5L47A 3SH1A 5AFMA 2Y57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRR A;  2XQA A;  3WTO A;  2VL0 A;  3UU4 A;  1UV6 A;  4X5T A;  2X00 D;  4QAB A;  4TNV A;  3RI5 A;  5IUX A;  5AFH A;  3RIA A;  4HFB A;  2BYS A;  2WNL A;  4ZRU A;  5HEO A;  4ZK4 A;  2BYR A;  2XNU A;  5JME A;  4TNW A;  2BG9 B;  1UW6 A;  4ILA A;  4ALX A;  2YMD A;  5CO5 A;  3P50 A;  5HEH A;  5HEJ A;  3RQW A;  3ZDG A;  4IRE A;  3ZKR A;  3JAE A;  4Z90 A;  5L4E A;  2BYP A;  3ZDH A;  4IL4 A;  4AFH A;  5J5I A;  3UU3 A;  1I9B A;  5BW2 A;  1UX2 A;  2YOE A;  2XQ3 A;  4LMJ A;  4COF A;  3SQ9 A;  2XQ9 A;  4Z91 A;  4NPP A;  2XQ4 A;  2WZY A;  5L4H A;  2YME A;  2XQ8 A;  5J0Z A;  2XNV A;  3EI0 A;  2XZ5 A;  4PIR A;  1OED A;  3TLS A;  4AFG A;  3WTK A;  3GUA A;  5KZU A;  2WNJ A;  2W8G A;  3EAM A;  4HFC A;  3RHW A;  5HCM A;  5LG3 A;  4TWF A;  4HFI A;  4BQT A;  4A97 A;  5AFM B;  2W8F A;  1OED E;  3WTM A;  4HQP A;  4A98 A;  2Y58 A;  5HEG A;  2WN9 A;  4QAC A;  2MAW A;  4IL9 A;  4ILB A;  4HFH A;  1OED C;  2ZJU A;  2XNT A;  2XQ7 A;  3U8L A;  5CFB A;  2KSR A;  5FJV A;  3C79 A;  3UUB A;  4BFQ A;  5AFN A;  4HFD A;  4TWH A;  4F8H A;  2M6B A;  4ZZC A;  4ZJS A;  3UU8 A;  5J5F A;  5BP0 A;  3RIF A;  5KE4 A;  3UU5 A;  2WNC A;  4ZZB A;  3UU6 A;  3EHZ A;  2LLY A;  2Y56 A;  2Y54 A;  4EZ1 A;  2XQ5 A;  5AIN A;  4XK9 A;  4QH4 A;  3WTJ A;  4QH1 A;  2X00 A;  2BG9 C;  3TLU A;  4UM3 P;  2UZ6 A;  3U8N A;  3WTL A;  3IGQ A;  3C84 A;  2BYQ A;  4LMK A;  2YKS A;  4QAA A;  3WTN A;  4TWD A;  3TLW A;  5LXB A;  2YN6 A;  3P4W A;  3TLT A;  2C9T A;  3U8K A;  4NZB A;  3PEO A;  5BRX A;  4ZJT A;  4XHE A;  3U8J A;  4WV9 A;  2LM2 A;  2LKG A;  3UQ4 A;  2BG9 A;  5J5G A;  3WIP A;  3WTI A;  2BYN A;  2ZJV A;  4UM1 A;  2XQ6 A;  4UM3 S;  5J5H A;  4D01 A;  4HFE A;  2XYS A;  2XZ6 A;  4UY2 A;  3SQ6 A;  4UXU A;  3TLV A;  4ZK1 A;  4UM3 A;  2PH9 A;  3WTH A;  3LSV A;  2BG9 E;  2LKH A;  4B5D A;  5AFJ A;  3PMZ A;  3U8M A;  2Y7Y A;  2QC1 B;  5HEU A;  4AFT A;  2XYT A;  5AFK A;  2PGZ A;  3JAD A;  4LML A;  3RQU A;  4ZR6 A;  2BJ0 A;  5AFL A;  3JAF A;  3UQ7 A;  4QH5 A;  4ILC A;  3SIO A;  3T4M A;  1OED B;  5HCJ A;  5TVC A;  5SYO A;  4DBM A;  2BR8 A;  2BR7 A;  2M6I A;  5L47 A;  3SH1 A;  5AFM A;  2Y57 A; 
#chains in the Genus database with same CATH topology
 5M4Y A;  4GYS A;  4NIQ A;  1WYC A;  2IC6 A;  4LF7 T;  3AAI A;  2XNU A;  2WCA A;  3RLF F;  4TNW A;  4JUY A;  3CIR A;  3JCF A;  5LHI B;  4YSZ A;  1W0B A;  4YHH T;  3RPU A;  3RQW A;  5L4E A;  4MLK A;  1I9B A;  3ONX A;  1UX2 A;  2XQ3 A;  3UT5 E;  1W9R A;  4AKL A;  2XAH B;  3EI0 A;  2E8I A;  4IE4 A;  3PU3 A;  2XZE A;  4U3C A;  4UV9 B;  3VR9 A;  1L0V A;  4BQT A;  1X79 A;  2XAG B;  4CQI A;  1X9B A;  3A8Y C;  3ZMU B;  2X0Y A;  3I0O A;  4DV6 T;  4I55 E;  1FEW A;  2HHH T;  2UXD T;  3UUL A;  5EK3 A;  4WW0 A;  1XMQ T;  3RRC A;  3ZMT B;  3EHZ A;  4EZ1 A;  4AQF A;  2X68 A;  4QH1 A;  4YT0 A;  2BKN A;  3FBL A;  1IBK T;  2KT9 A;  2LSI A;  2UU9 T;  3WTL A;  4UEL A;  4C90 A;  4JI4 T;  4IDN A;  2IML A;  3WTI A;  2BYN A;  1AJ3 A;  3FB2 A;  2XZ6 A;  4DV7 T;  3PJA A;  4ZI3 C;  2XJ7 A;  4EYU A;  2PGZ A;  4KMC A;  2XM2 A;  3R84 B;  2XHE B;  1KNR A;  4F6R C;  2W4X A;  1XNR T;  3F31 A;  2XQA A;  5DQV A;  1LVK A;  3GWH A;  4ZK4 A;  2JMH A;  2VWA A;  4IE5 A;  5IWA T;  1HNZ T;  4EEB A;  4ZEY A;  1SA0 E;  5DQW A;  5LBM A;  2RPA A;  2WZY A;  2KND A;  3W15 B;  4I0U A;  3F57 A;  1LRZ A;  4AFG A;  2PG8 A;  1IZN B;  3ONL C;  2D2S A;  2J47 A;  3SFD A;  4QAC A;  2JQ9 A;  4IL9 A;  2ZJU A;  3NZP A;  4L5G A;  4AQY T;  2XM1 A;  1IJ6 A;  4KP3 C;  4TWH A;  4B3T T;  2Y48 B;  3MZK B;  2XAQ B;  2WS3 A;  3TKL B;  2CA5 A;  4ZZB A;  2VKD A;  3WTJ A;  5LGU B;  3ETU A;  4AI6 A;  2V7K A;  4TV9 E;  3H37 A;  4EOZ B;  1UX5 A;  5J2U E;  5BRX A;  3UUX B;  4ZJT A;  1XDP A;  2LM2 A;  2ZJV A;  4UXU A;  4FI5 A;  3PMZ A;  4JI7 T;  5FP3 A;  3FZH B;  4AFT A;  4DR2 T;  4GK0 E;  4OX9 T;  2ACZ A;  2VQF T;  5TVC A;  4JI6 T;  5CB4 E;  5LJN A;  4YTN A;  5JDQ A;  4ZRU A;  2V26 A;  1KEY A;  2LT3 A;  2XQY A;  5HAX A;  3AA0 B;  1UW6 A;  4MFR A;  4GIW A;  3ZMS B;  3L39 A;  2ZMA A;  3ZN0 B;  3JAE A;  3AA6 B;  3MK7 C;  4IL4 A;  5CGM A;  4HTE A;  2WZI A;  4ADZ A;  1YQ3 A;  4HWD A;  4EIW A;  4HFI A;  2CBJ A;  5LJM A;  1OED E;  5FL0 A;  5HEG A;  2WU5 A;  4CXX A;  4AKR B;  1WFD A;  5JRC A;  2X66 A;  2YIN A;  5FJV A;  3N2G E;  3RYH E;  3X1D A;  4HFD A;  4F8H A;  2M6B A;  4ZJS A;  2CWY A;  2DWK A;  4AKG A;  4H9P C;  4JI0 T;  3ZYK A;  3RKO A;  2D0T A;  4LFC T;  4QH4 A;  2V7L A;  4AXP A;  3NKZ A;  3AEF A;  1YW0 A;  2BYQ A;  2WWV A;  1US7 B;  3U8K A;  4NZB A;  5FYM A;  4P0B A;  3L3P A;  5J2T E;  4DV3 T;  4QX7 B;  4UM1 A;  4D01 A;  2J62 A;  3MJX A;  5FY1 A;  2XPK A;  2WY2 A;  4ZK1 A;  2JPF A;  2ZLY A;  3LSV A;  3AVS A;  3F2E A;  1NEK A;  2F4V T;  2QVA A;  3RQU A;  4XAX B;  2BJ0 A;  2WDV A;  1HX8 A;  4ILC A;  5HCJ A;  2BR7 A;  2HN1 A;  1HNX T;  2V5C A;  2MTQ A;  3QOF A;  3SOL A;  5AFH A;  3IEE A;  3T8O A;  3RIA A;  2YDS A;  3RX6 A;  3I9Y A;  2E9X D;  3LDQ B;  4FJO A;  4DBR A;  2WM9 A;  5HEJ A;  3I9W A;  3LJC A;  2YDR A;  5J5I A;  2LOS A;  3PUQ A;  5BW2 A;  5C2T A;  3ANW A;  4IST A;  3PUA A;  4YSY A;  1D1C A;  3RIU A;  3ZLI A;  4DV0 T;  4JI1 T;  2Y58 A;  2L8K A;  1MIW A;  4JEU B;  3P4Q A;  4HN9 A;  4J2C A;  4BA9 A;  2IDO B;  4CN4 A;  3EUH A;  4DUY T;  2WDQ A;  4PK6 A;  3NRX A;  2EHO A;  2Y56 A;  2CM0 A;  3IA3 A;  1I6Z A;  4AIS A;  3TLU A;  5L3B B;  2YKS A;  3P4W A;  2V6Y A;  3U8J A;  5JDH A;  4UM3 S;  3HL6 A;  4UF0 A;  2XQ6 A;  2H7V C;  4K0K T;  1D0Y A;  2CBI A;  4DMV A;  3MXZ A;  4AIU A;  2LSG A;  3J9X 1;  4IHJ E;  1XNQ T;  1NWM X;  3LBX B;  5HXC A;  4ZI2 C;  2D0U A;  1W09 A;  2DI4 A;  2VL0 A;  4PJL A;  3CQG B;  4PW8 A;  4QAB A;  3P7I A;  1LVF A;  2WNL A;  5IHY A;  4ALX A;  2C5I T;  1J1J A;  2L3L A;  4GKJ T;  4IRE A;  3ZKR A;  2I59 A;  5BMV E;  4CI2 B;  2BYP A;  4MBQ A;  1XDO A;  5ABE A;  2WU2 A;  1QUU A;  1WR6 A;  5FL1 A;  2JRK A;  5J0Z A;  1HR0 T;  2DNX A;  3D0T A;  4OFZ A;  4LF9 T;  4IT4 A;  4IIJ E;  5KZU A;  4UIG A;  1UUR A;  5FVK A;  2UXN B;  5KDM C;  5AFM B;  1ZKE A;  2KIN B;  3I0Q A;  3OBV E;  2Z6E A;  1T98 A;  3FXE B;  4KHP T;  2WAU A;  4B6X A;  3L8R A;  3C4Z A;  4I50 E;  5AQI B;  5CFB A;  3C50 A;  3RRW A;  4BFQ A;  2VUR A;  5DAB A;  4PJJ A;  1IJ5 A;  3N5L A;  2QYW A;  3E0Z A;  3ZT5 A;  2NTY A;  1YKE B;  2H88 A;  2ODU A;  1NAF A;  2C9T A;  3PEO A;  1ZV4 X;  5FVL A;  5JVD E;  3LK4 2;  2VL8 A;  5KX5 E;  4UR9 A;  4JV5 T;  1QLB A;  5JDM A;  4GOU A;  2LKH A;  3RYC E;  4PAG A;  2CLY B;  4AKH A;  3PUV F;  4QXC B;  2XSA A;  3FZF B;  4HEA A;  5HXR A;  1FIO A;  3UQ7 A;  1DU2 A;  5CA1 E;  2BR8 A;  5L47 A;  3SH1 A;  5LMN T;  5HXE A;  4DR5 T;  4TNV A;  5IUX A;  4QXB B;  2BS4 A;  4DV2 T;  2CRB A;  2L9Q A;  5ABG A;  1N33 T;  4JEH B;  5JME A;  1V9D A;  3CPZ A;  1VCS A;  4B3R T;  4DR3 T;  4WYV A;  4JLE A;  3RH3 A;  5AQL B;  1ZOY A;  3C51 A;  2LSK A;  4PIR A;  3WTK A;  3GUA A;  4HWI B;  1OXZ A;  4X65 T;  3EAM A;  4HFC A;  4EXT A;  2ZM6 T;  3PUW F;  3C98 B;  3AEA A;  1T8B A;  4YY3 T;  3EDV A;  2A2F X;  4HQP A;  5JRE A;  3AA1 B;  4TV8 E;  1FMW A;  4HFH A;  2BKP A;  3K3Q C;  3PU8 A;  5ADX L;  3N2O A;  2LSY A;  2W66 A;  1UUS A;  4KX6 A;  3SFE A;  2KLQ A;  3RF1 A;  2HH7 A;  3FZM B;  5DJQ C;  3H3M A;  1KNP A;  2V5D A;  3WTN A;  2W62 A;  2YN6 A;  4X20 E;  3CX7 B;  2Q9Q B;  3WIP A;  2BG9 A;  3AE3 A;  3BQI A;  2YK0 A;  3UFG A;  2XYS A;  4UY2 A;  1HX1 B;  4O2A E;  4CN6 A;  2PH9 A;  5AFJ A;  4YTP A;  2HPL A;  2C0S A;  5AQQ B;  4NXM T;  4X1K E;  3JAF A;  2CCQ A;  2PJQ A;  3IBP A;  5HWX A;  1MMD A;  3OYX A;  2DHR A;  2X00 D;  1M7K A;  3GN5 A;  2BS3 A;  3OYZ A;  4ZOL E;  3QUJ A;  3AED A;  3AEC A;  3PTR B;  2ZM0 A;  2YMD A;  4LF6 T;  4PJN A;  4PFP A;  1NEN A;  2B76 A;  3A7M A;  4L0R A;  4DR4 T;  2VVS A;  3OJA A;  4LMJ A;  5A1L A;  2FJD A;  3V5S A;  2CLY C;  3EAB A;  3K3O A;  1MND A;  2W63 A;  5LG4 A;  4UVC B;  1VCT A;  3AE1 A;  4MAL A;  2LRK A;  3T1Y T;  5LXT E;  5AQV B;  5BP0 A;  2PBI A;  5KE4 A;  3UU5 A;  5JR9 A;  2SPC A;  5AIN A;  2NP9 A;  4KHZ F;  4IDQ A;  1E1H B;  1M62 A;  4UXN B;  3PUS A;  3NBX X;  2X67 A;  2ES0 A;  3H3A A;  4BJM A;  3TLT A;  3AB3 B;  3EVY A;  3ZST A;  3K1S A;  4H63 V;  4XHE A;  4U74 A;  4WV9 A;  4V1A v;  4JBW F;  2V6X A;  3HKC E;  2QGS A;  5EZY E;  1HTJ F;  2IW5 B;  2IUB A;  2FUP A;  4TX5 A;  2OLT A;  4QHO A;  5JH7 E;  2DWG A;  3DTO A;  1OED B;  5SYO A;  4FRR A;  3BQL A;  3CVR A;  4Q25 A;  1KK7 A;  1U4Q A;  1MMG A;  2JQH A;  2JMK A;  2W67 A;  2N9D A;  4E7Z A;  2AXD S;  1T7S A;  1UGO A;  4LF8 T;  4IDO A;  2PTF A;  2MPK A;  3ZDH A;  2LEH A;  1Z0P A;  4ZI2 D;  2Q9Q C;  3B5M A;  5LHG B;  2XQ4 A;  2CHO A;  5C8Y E;  3AXJ A;  3KVB A;  4U7Y A;  3PUG A;  2W8G A;  4A97 A;  3IHR A;  4KUM B;  4YFS A;  5HXH A;  2C5J A;  3DJB A;  1N34 T;  3VKG A;  1GQE A;  3E22 E;  3P8C D;  4OYJ A;  3HI2 A;  4ZS2 A;  3RC8 A;  3VKH A;  4XK9 A;  2X00 A;  2DCF A;  1WCR A;  1D0Z A;  1WLX A;  3CWZ B;  3ANW B;  3N9N A;  4LMK A;  4U33 A;  2IHR 1;  4DO0 A;  2I6H A;  2BBJ A;  2LKG A;  2JQQ A;  5AQM B;  3KDS E;  2UUB T;  2UXC T;  2QC1 B;  1I94 T;  3KIN B;  1KNZ A;  3ZT7 A;  4WZX A;  1QSD A;  5AFL A;  5L3D B;  5HYA A;  2EHO B;  1SHZ C;  5F8P A;  5EK4 A;  2LHN A;  5JDN A;  2CXL A;  4PFO A;  2MOZ A;  4ZXL A;  3AE9 A;  2Y57 A;  3Q9D A;  3Q5E A;  2WSS V;  4OHF A;  1XWM A;  1JNZ A;  2V6Y B;  2BYR A;  3Q5D A;  4HWC A;  4UF0 B;  2WQY A;  3ZDG A;  3FZL B;  2XQ9 A;  2YME A;  5L4H A;  3KV5 A;  3ZT6 A;  5FY0 A;  5FXZ A;  4TWF A;  2A3D A;  3AVR A;  1WR0 A;  3RYI E;  1B7T A;  2W2U A;  3O1I A;  4U31 A;  4LF4 T;  1OED C;  2BS2 A;  4CXY A;  1WRD A;  3N9M A;  2K9A A;  3V5U A;  2YU1 A;  2XQ5 A;  3GA8 A;  1YXR A;  5FXX A;  4UM3 P;  4DID B;  4ISS A;  4YSX A;  3VHL A;  2MYS A;  2CWO A;  4NUV A;  5LHH B;  4U72 A;  1SUM B;  3UQ4 A;  3CX8 B;  1CUN A;  3ZYM A;  3DP7 A;  3WTH A;  2H7O A;  2WWU A;  2NR4 A;  4PNI A;  3FBZ A;  4NXN T;  3U8M A;  3M3Z B;  5HEU A;  4GK5 E;  4H9N C;  3HKD E;  5AFU L;  5ABH A;  3SIO A;  2LE8 A;  3FZK B;  4BAY B;  3J7Y q;  1G8X A;  4EGW A;  1UV6 A;  3E08 A;  3WAK A;  2J1D G;  2X0H A;  4LFB T;  4HFB A;  2UXX B;  5HEO A;  3ZCI A;  2UUC T;  2WP9 A;  2N2N A;  2WMN A;  5F3J A;  3Q2M A;  5LP6 E;  3QK6 A;  5JQG E;  3UUN A;  2LM9 A;  2I0M A;  3SRZ A;  4U2Z A;  1HNW T;  5ETW A;  1LKX A;  2QRX A;  3M65 A;  4M1P A;  2EHO C;  5F5W A;  3AE6 A;  4U2Y A;  1VOM A;  3UTK A;  4QKN A;  4YTM A;  3N9L A;  2WNC A;  5L3E B;  3U78 A;  3HR0 A;  5IYZ E;  2W00 A;  4IE6 A;  4OYK A;  3IGQ A;  2VQE T;  3C84 A;  2X0L B;  4P1N A;  3HKE E;  3LG7 A;  3I1A A;  4DBQ A;  2CXF A;  2Y8D A;  4DND A;  1HFA A;  5J5H A;  4WBN E;  5KMG P;  3CK6 A;  1N36 T;  4ANJ A;  4EZH A;  2HPJ A;  1Y64 B;  4YXD A;  2LHR A;  1KFY A;  1EZ3 A;  4B3M T;  5KXJ A;  3ABV A;  5AQU B;  4QH5 A;  1YQ4 A;  3R6N A;  2VB6 A;  1D0X A;  4IDZ A;  2E9X A;  2M6I A;  2DL1 A;  3CKD A;  3ZSS A;  3AE8 A;  3QC9 A;  5CJ5 A;  4DR7 T;  2BYS A;  5JDF A;  3RKG A;  5GON E;  3VRB A;  2G0U A;  2BG9 B;  3RGL A;  5HEH A;  3VRA A;  1D1A A;  3KV9 A;  1UK5 A;  1Z8U A;  3LBX A;  3S4U A;  5JDL A;  5AQO B;  2VVN A;  2XQ8 A;  4CXW A;  1Y01 A;  2FBW A;  3OKQ A;  5HCM A;  4KBM B;  3O9X A;  1HCI A;  2B1E A;  2W8F A;  2V8S V;  3WTM A;  3BK9 A;  2WN9 A;  2MAW A;  4KI0 F;  3OPC A;  2W0G A;  3GN5 B;  4DV1 T;  4H9Q C;  2R6G F;  3KVA A;  4U7I A;  2Q9Q D;  2JJ9 A;  3LFM A;  1BR0 A;  4TZ4 C;  2CXD A;  4PJM A;  3UU6 A;  3NZQ A;  4EAH A;  4HWH A;  2YU2 A;  2X9H A;  3NWI A;  5LCY A;  4WBO A;  4UVA B;  5LXB A;  3KV6 A;  2X9Y A;  5J5F A;  3P4R A;  5AQF B;  1J5E T;  2XTL A;  3SQ6 A;  3TLV A;  4UM3 A;  2V7J A;  2BG9 E;  2W61 A;  5LB7 B;  2PFV A;  4YLH A;  2Y7Y A;  4O2B E;  2KWI B;  5TAO A;  3JAD A;  4LML A;  4ZS3 A;  2K24 A;  5H6R B;  3N9Q A;  5JR9 B;  4H9O C;  2CE7 A;  2UUA T;  3N9O A;  1BR1 A;  2RA1 A;  1MIY A;  3AE5 A;  4H9R C;  1MIV A;  3OTO T;  3ETV A;  3PUZ F;  3ONJ A;  3QNU A;  3P50 A;  5LOV E;  1E2A A;  2KMF A;  4AFH A;  2E5L T;  5LBQ B;  2YOE A;  2QA7 A;  3Q5X A;  3AAE B;  4E7S A;  5E0O A;  2FJA A;  3TLS A;  2NTX A;  4YHJ A;  3RHW A;  4HFV A;  3AE2 A;  3JC6 C;  4O4J E;  4TN7 B;  3KV4 A;  1HG2 A;  3ZPO A;  1YKH B;  3LK3 B;  5AQT B;  2WB5 A;  5ABF A;  3C79 A;  2CEA A;  2KWH A;  3RC3 A;  4DV5 T;  3AA7 B;  2BBH A;  3O1H A;  2HN2 A;  2IIU A;  4I43 B;  2BG9 C;  3U8N A;  4JI3 T;  1YD8 G;  4DUZ T;  2ZM2 A;  4YJ3 E;  4CN1 A;  1J5W A;  3ZJ2 A;  3AXJ B;  1IAP A;  2WDR A;  3KFW X;  4QAA A;  2X51 A;  5EK2 A;  4GYR A;  4AQF C;  3UUM A;  4O4I E;  5J5G A;  3CQC B;  3ZEF B;  4IE7 A;  5L3F B;  1FJG T;  4QX8 B;  5AQP B;  1IBM T;  3PUR A;  4EB6 E;  2RP4 A;  2VKJ A;  4ERR A;  3LK2 B;  3T4M A;  5CA0 E;  2CMR A;  1N32 T;  3ZC0 A;  4CZZ B;  2M67 A;  4X5T A;  3A5X A;  3NRY A;  4JYA T;  4QXH B;  1WYB A;  4B3S T;  1ZHC A;  2Q9Q A;  1UX4 A;  5JRC B;  4ILA A;  5CO5 A;  2J4G A;  4LFA T;  3PE0 A;  4IGU A;  2Y6X A;  3O4X E;  2H3R A;  3VR8 A;  5L2L A;  3SQ9 A;  4K0U A;  1R8I A;  1IBL T;  2N1G A;  3N9P A;  3K8P C;  3AAA B;  5FMN A;  3ESL A;  5FXV A;  3OVU A;  2XAJ B;  5FNV E;  1HS7 A;  3QB5 A;  5JR9 C;  2E2A A;  5LGT B;  4EED A;  5J1G A;  3PJA J;  5LNK A;  2XNT A;  1VRB A;  3U8L A;  3HA4 A;  5LMU T;  2P9B A;  2WBL A;  3ZN1 B;  4JI8 T;  5L3C B;  4O4L E;  3B57 A;  3RIF A;  5LA6 E;  2Y54 A;  1BR2 A;  1KF6 A;  2OV9 A;  2WMO A;  4IDP A;  3G06 A;  2BZB A;  1T72 A;  1MMN A;  2NW7 A;  2C5K T;  2EHO D;  4H9S E;  4ZHQ E;  4DMW A;  5AQN B;  2X9W A;  3C4W A;  2UXB T;  4HFE A;  2V7M A;  1E7P A;  2YEV C;  2BKO A;  2KZ7 B;  3AEE A;  4X62 T;  1OWA A;  4AQG A;  3P4P A;  1U5P A;  4Z8X A;  2GK9 A;  5AQR B;  5AQH B;  4ASK A;  2DLR A;  4DR1 T;  3ZYL A;  3ZJ1 A;  3C64 A;  2LSJ A;  4O8S A;  2BVM A;  2IAK A;  2LOP A;  1CHU A;  2XAF B;  4X1Y E;  3FXD B;  3AE7 A;  4CI1 B;  3VU7 H;  4TUY E;  4DV4 T;  2XZ5 A;  1OED A;  4DR6 T;  2WZH A;  3BQK A;  2LRL A;  3QB5 K;  4JI5 T;  4A56 A;  1MNE A;  4XBF B;  4NUU A;  1SE7 A;  3UUB A;  3CX6 B;  5AFN A;  3PUX F;  1O3X A;  3UU8 A;  2NWB A;  2XY8 B;  2LLY A;  2VK9 A;  3PV0 F;  3WI3 A;  1S35 A;  1HF8 A;  5JTG A;  2K3W A;  3SWH A;  2IC9 A;  5FY7 A;  4GKK T;  2CHN A;  4X66 T;  3U3I A;  3T1H T;  2YDQ A;  1ZP0 A;  1FMV A;  5JDG A;  4HWF A;  5HXS A;  2XAS B;  4HGA A;  5C3J A;  4B5D A;  1HG5 A;  4UEM A;  2NW9 A;  4N78 D;  2ODV A;  4I4T E;  2D5U A;  5H6Q B;  3WTO A;  4OK0 A;  2H89 A;  4IE0 A;  3RI5 A;  4X64 T;  2FJE A;  3CQX C;  4XZC A;  2K48 A;  3ZCJ A;  1ZEE A;  3ZC1 A;  3MKD A;  4EYY R;  1D1B A;  5LYJ E;  2VKO A;  4Z90 A;  2K5B B;  4O4H E;  3MA9 A;  5BR8 T;  4Z91 A;  3L09 A;  3ZMV B;  4PK5 A;  2XNV A;  1XZY A;  1W0A A;  4G2A A;  4L9I A;  2VAS A;  4WNK A;  2KXP B;  2E9X B;  2A72 A;  4A98 A;  1UCU A;  2XUE A;  3PDY A;  4HE8 A;  3IF8 B;  2XQ7 A;  3RIU C;  2KSR A;  3AEG A;  3UFE A;  3AEB A;  4C91 A;  5L3G B;  3HKB E;  4QWN B;  5AQJ B;  3RYF E;  2UZ6 A;  3JC6 D;  1XMO T;  4TWD A;  3P4S A;  1BR4 A;  3KBU A;  4PK4 A;  2V7I A;  2FJB A;  4BJN A;  4ZI3 D;  5AFK A;  4ZR6 A;  4A5X A;  5FKY A;  5AQS B;  4H63 H;  3WAJ A;  3CML A;  3C4X A;  1JNR A;  4ILU A;  2JIW A;  1H7C A;  4DBM A;  3UU4 A;  3SS1 A;  2NW8 A;  3AE4 A;  3N2K E;  4ZI7 E;  4CI3 B;  2BDE A;  2V1D B;  4LF5 T;  5AQG B;  4P0A A;  3UU3 A;  4COF A;  2X9X A;  3NVO A;  4NPP A;  5AQK B;  3MAC A;  2D9D A;  3ZMZ B;  2WNJ A;  5LG3 A;  4G63 A;  4JI2 T;  2XSB A;  4EZ4 A;  2E5V A;  2BVL A;  4ILB A;  4P09 A;  5HWY A;  1MMA A;  2VKH A;  2AE9 A;  4ZZC A;  4MHC A;  3GMI A;  3KBT A;  4HKA A;  5LGN B;  4UV8 B;  3EDU A;  1G73 A;  2A9U A;  2ZM8 A;  3TLW A;  3FHN A;  3B13 A;  4DVD A;  1S94 A;  3PUY F;  2CPT A;  4YJ2 E;  2LJL A;  4EV6 A;  5FXW A;  2JQK A;  4X1I E;  3Q5W A;  3K3N A;  2OA5 A;  2E9X C;  3O1J A;  5ABF B;  2XYT A;  2ACX A;  2NOX A;  4AKI A;  2MBG A;  4UVB B;  5AFM A; 
#chains in the Genus database with same CATH homology
 4FRR A;  2XQA A;  3WTO A;  2VL0 A;  3UU4 A;  1UV6 A;  4X5T A;  2X00 D;  4QAB A;  4TNV A;  3RI5 A;  5IUX A;  5AFH A;  3RIA A;  4HFB A;  2BYS A;  2WNL A;  4ZRU A;  5HEO A;  4ZK4 A;  2BYR A;  2XNU A;  5JME A;  4TNW A;  2BG9 B;  1UW6 A;  4ILA A;  4ALX A;  2YMD A;  5CO5 A;  3P50 A;  5HEH A;  5HEJ A;  3RQW A;  3ZDG A;  4IRE A;  3ZKR A;  3JAE A;  4Z90 A;  5L4E A;  2BYP A;  3ZDH A;  4IL4 A;  4AFH A;  5J5I A;  3UU3 A;  1I9B A;  5BW2 A;  1UX2 A;  2YOE A;  2XQ3 A;  4LMJ A;  4COF A;  3SQ9 A;  2XQ9 A;  4Z91 A;  4NPP A;  2XQ4 A;  2WZY A;  5L4H A;  2YME A;  2XQ8 A;  5J0Z A;  2XNV A;  3EI0 A;  2XZ5 A;  4PIR A;  1OED A;  3TLS A;  4AFG A;  3WTK A;  3GUA A;  5KZU A;  2WNJ A;  2W8G A;  3EAM A;  4HFC A;  3RHW A;  5HCM A;  5LG3 A;  4TWF A;  4HFI A;  4BQT A;  4A97 A;  5AFM B;  2W8F A;  1OED E;  3WTM A;  4HQP A;  4A98 A;  2Y58 A;  5HEG A;  2WN9 A;  4QAC A;  2MAW A;  4IL9 A;  4ILB A;  4HFH A;  1OED C;  2ZJU A;  2XNT A;  2XQ7 A;  3U8L A;  5CFB A;  2KSR A;  5FJV A;  3C79 A;  3UUB A;  4BFQ A;  5AFN A;  4HFD A;  4TWH A;  4F8H A;  2M6B A;  4ZZC A;  4ZJS A;  3UU8 A;  5J5F A;  5BP0 A;  3RIF A;  5KE4 A;  3UU5 A;  2WNC A;  4ZZB A;  3UU6 A;  3EHZ A;  2LLY A;  2Y56 A;  2Y54 A;  4EZ1 A;  2XQ5 A;  5AIN A;  4XK9 A;  4QH4 A;  3WTJ A;  4QH1 A;  2X00 A;  2BG9 C;  3TLU A;  4UM3 P;  2UZ6 A;  3U8N A;  3WTL A;  3IGQ A;  3C84 A;  2BYQ A;  4LMK A;  2YKS A;  4QAA A;  3WTN A;  4TWD A;  3TLW A;  5LXB A;  2YN6 A;  3P4W A;  3TLT A;  2C9T A;  3U8K A;  4NZB A;  3PEO A;  5BRX A;  4ZJT A;  4XHE A;  3U8J A;  4WV9 A;  2LM2 A;  2LKG A;  3UQ4 A;  2BG9 A;  5J5G A;  3WIP A;  3WTI A;  2BYN A;  2ZJV A;  4UM1 A;  2XQ6 A;  4UM3 S;  5J5H A;  4D01 A;  4HFE A;  2XYS A;  2XZ6 A;  4UY2 A;  3SQ6 A;  4UXU A;  3TLV A;  4ZK1 A;  4UM3 A;  2PH9 A;  3WTH A;  3LSV A;  2BG9 E;  2LKH A;  4B5D A;  5AFJ A;  3PMZ A;  3U8M A;  2Y7Y A;  2QC1 B;  5HEU A;  4AFT A;  2XYT A;  5AFK A;  2PGZ A;  3JAD A;  4LML A;  3RQU A;  4ZR6 A;  2BJ0 A;  5AFL A;  3JAF A;  3UQ7 A;  4QH5 A;  4ILC A;  3SIO A;  3T4M A;  1OED B;  5HCJ A;  5TVC A;  5SYO A;  4DBM A;  2BR8 A;  2BR7 A;  2M6I A;  5L47 A;  3SH1 A;  5AFM A;  2Y57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...