4NPPA

The glic-his10 wild-type structure in equilibrium between the open and locally-closed (lc) forms
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a pentameric ligand-gated ion channel provide a mechanism for activation.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4nppA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4nppA01
2BG9B 2XNUA 3PMZA 2WNJA 3UU5A 4UM1A 4XK9A 4BQTA 5J5IA 2PGZA 4A97A 2Y57A 5AFJA 4IREA 4TWHA 4NZBA 4B5DA 4QH4A 3TLSA 5TVCA 5L4HA 4ZRUA 4UM3S 4ZZBA 4QAAA 2BYSA 4EZ1A 4ILBA 4TWFA 2BR7A 4AFGA 5L47A 3U8KA 3RHWA 4HFCA 3EHZA 5J0ZA 4LMKA 2PH9A 3SQ9A 5AFMB 4XHEA 3UU3A 3UU4A 3RI5A 2VL0A 5HEUA 2XZ5A 3WTIA 3C84A 4FRRA 4TWDA 4UM3P 2XNTA 5SYOA 4ZJTA 3ZKRA 5IUXA 2XYSA 5AINA 2XYTA 4TNVA 2YMDA 1OEDC 4QACA 2XNVA 4IL9A 3U8NA 3JAEA 5BRXA 5LXBA 2M6BA 5HCMA 4QH5A 3TLWA 4COFA 2XQ9A 3UU6A 3UU8A 2ZJVA 4HFHA 2XQ7A 2XQ5A 3JADA 3TLTA 4HQPA 3LSVA 4ZK1A 3U8MA 5J5HA 2Y54A 4AFHA 2LM2A 2XZ6A 4UXUA 3JAFA 2BYNA 3P4WA 1UV6A 3WTLA 4D01A 2XQ6A 4HFBA 1OEDB 4Z90A 4QH1A 5FJVA 3RIAA 3C79A 2M6IA 3ZDHA 5JMEA 4NPPA 3U8LA 3RQWA 4ILAA 2LKHA 3GUAA 5BP0A 3WTMA 1UW6A 4HFIA 4Z91A 3TLUA 4ZJSA 1UX2A 5L4EA 4X5TA 5HEHA 4AFTA 4ALXA 2QC1B 2LKGA 2XQ4A 2WNLA 3WTOA 4IL4A 5HEJA 2KSRA 3T4MA 4F8HA 3U8JA 2BG9C 3P50A 3UQ7A 2UZ6A 3TLVA 5J5GA 4UM3A 4ZZCA 1I9BA 3IGQA 5CO5A 5AFMA 2YKSA 5HEOA 5KE4A 2WN9A 1OEDE 2BG9A 3PEOA 2YMEA 2W8GA 4HFDA 4TNWA 3WTKA 4BFQA 5AFKA 2BYRA 4A98A 2LLYA 2WNCA 2XQ8A 3SH1A 2Y56A 5KZUA 3EI0A 3WTNA 5AFNA 2XQ3A 4ZR6A 5HCJA 4PIRA 3RQUA 4DBMA 5HEGA 3UUBA 2BYQA 2W8FA 2WZYA 3WTHA 2YOEA 2Y58A 3SQ6A 2XQAA 4ZK4A 4HFEA 5CFBA 5AFLA 4WV9A 3RIFA 2ZJUA 5BW2A 2MAWA 4LMLA 4UY2A 2X00D 2Y7YA 4LMJA 3EAMA 2BR8A 2BYPA 3SIOA 2X00A 5J5FA 5LG3A 5AFHA 2BJ0A 3WIPA 4QABA 3WTJA 1OEDA 2C9TA 2BG9E 4ILCA 3UQ4A 3ZDGA 2YN6A
chains in the Genus database with same CATH superfamily
1HX1B 5H6QB 2WNJA 2BKNA 3UU5A 3FBZA 4IREA 1MNEA 4B5DA 5AQOB 5JDFA 2NW8A 5HXHA 2NW9A 1HNWT 4B3MT 1SHZC 3UTKA 2YINA 3AE1A 2HPJA 4LF6T 2KLQA 4B6XA 4BJMA 3P7IA 2C5KT 2CCQA 2J47A 3GA8A 1FMVA 3ZCJA 2XYTA 4IL9A 4WBNE 3RH3A 2UU9T 2HN1A 4B3ST 2CXFA 2VKHA 5AQGB 4HTEA 5EK4A 2PJQA 2KZ7B 2XTLA 1BR2A 3AE4A 4I43B 4DV2T 5LJMA 4KP3C 4CN6A 3P50A 5IWAT 2Z6EA 2V6YB 5HXEA 4ZI3C 4EZ4A 3K8PC 4JI7T 4KBMB 4L9IA 4YSXA 3P8CD 3H3MA 3BK9A 2WB5A 4UV9B 2WDVA 3PURA 5AQSB 5BW2A 4DR2T 3B57A 3AE3A 3H37A 3A8YC 3KV4A 3RRCA 2BR8A 5LG3A 2IDOB 4P0AA 4U7YA 3KVAA 5LBQB 4O8SA 3PE0A 3MACA 1UUSA 5AQFB 3FXDB 1KFYA 3ZN0B 5ADXL 5A1LA 5ABGA 3JCFA 2WP9A 2IW5B 3B5MA 4QKNA 1LVKA 3CPZA 2K5BB 2E9XB 2W62A 5HXRA 4DV6T 5JDNA 4H9OC 2V8SV 3CX6B 3ZSSA 2CBJA 1D1CA 3RYFE 4G63A 5HCMA 4G2AA 2ZJVA 2X9WA 3AA0B 4UVBB 5HWXA 4HFVA 4ILUA 1HNZT 4FJOA 2M6IA 2X67A 2BKPA 1LVFA 2KWHA 2X9YA 3L8RA 5LA6E 4Z91A 5L4EA 2NW7A 3MA9A 1QUUA 2BG9C 4IHJE 4PJNA 3NRXA 2JQ9A 4BAYB 4JI0T 2YKSA 5HEOA 2CRBA 2X0LB 2A9UA 1HCIA 3ZT5A 3AA1B 1JNRA 2KT9A 4H63H 4MLKA 5LHHB 2OA5A 2XQ3A 2MOZA 3UFEA 1IJ5A 3PUZF 1L0VA 3SQ6A 2LHNA 5DABA 4JLEA 2DLRA 2VK9A 3LDQB 2C9TA 5LGNB 4PJMA 3ZSTA 4UM1A 1IJ6A 4L5GA 2EHOC 4CZZB 4TV9E 2I0MA 2CXDA 1CHUA 5CB4E 3ANWB 4AFGA 2FJBA 1T98A 1JNZA 3CVRA 3SQ9A 2E8IA 4X64T 3N2KE 1BR4A 3OYXA 3A5XA 1XZYA 2XZ5A 3OTOT 4UIGA 4UM3P 2CMRA 3VHLA 2NOXA 3O4XE 5AQTB 4QACA 5KXJA 3AXJA 4F6RC 2K48A 4GKJT 2KXPB 2F4VT 2W00A 3HKCE 4GK5E 3WTLA 2LSGA 3IHRA 3WTMA 4DV5T 4HFIA 4BA9A 5HEHA 3ZMSB 3AEFA 4TUYE 4UM3A 4X1KE 5F8PA 2JQHA 2IC9A 5E0OA 2WU5A 2E9XC 2KINB 3CX8B 4EEDA 5AQMB 4HEAA 4U2YA 3UUMA 4YTMA 2V6XA 2BG9B 2XNUA 2Q9QA 5J5IA 2JQKA 3T1HT 5KMGP 2W2UA 3PDYA 3ONLC 2P9BA 1T72A 4J2CA 2UXNB 2OV9A 2WMNA 3O1HA 1XNQT 3F57A 3RKOA 3O1IA 1V9DA 5HAXA 3FB2A 4TNVA 1OEDC 4U33A 1VRBA 3N9LA 2ZMAA 3Q9DA 3TLTA 4JV5T 2YU1A 4U3CA 3PUAA 3RIAA 2NTXA 3GUAA 1FIOA 4AFTA 5CGMA 2H89A 3PTRB 3NBXX 3QK6A 3TLVA 1MNDA 2MTQA 4X62T 4CI2B 4K0KT 4TX5A 1X9BA 5FY1A 3NRYA 2UUCT 2FJDA 1J1JA 2WZYA 2W8FA 5JR9B 4ZOLE 1W09A 3WTHA 4QXBB 1N32T 2IIUA 2CEAA 2MAWA 3ZMZB 4UY2A 2V26A 3UUNA 2BYPA 3UFGA 2DCFA 3AB3B 3FZKB 3MK7C 5FY7A 2VL8A 5J2TE 2D0TA 3O1JA 3NKZA 2MPKA 4JUYA 5AQRB 1W0AA 3Q5DA 5IYZE 3ZCIA 3AXJB 3TLSA 5TVCA 4PK5A 2QRXA 1I94T 2XSAA 4AIUA 4H9SE 4LMKA 5AFMB 4AKGA 3C4XA 5CJ5A 2ODUA 3EVYA 3ZKRA 3ZMTB 3R84B 5GONE 3TLWA 1AJ3A 2HH7A 5ABFA 1Y01A 3WAKA 5LGTB 2UXXB 2XAHB 2XZ6A 4UR9A 4UXUA 1XDPA 2BYNA 4IIJE 1OXZA 2ZLYA 3U78A 3AEEA 4AXPA 2RP4A 4UF0A 5JDLA 2HPLA 4DIDB 3F2EA 1MIVA 4ZS3A 4AKIA 3LBXB 2B1EA 5CA0E 5FXVA 1OWAA 4PNIA 4DVDA 2WQYA 4EYYR 1BR0A 5JDMA 3HKEE 2JJ9A 4A98A 5HYAA 5LG4A 1N36T 3EI0A 3P4QA 3D0TA 4DBMA 4ZS2A 1YW0A 2CHNA 2WBLA 4IE6A 4O4IE 5CFBA 4LMLA 2UUAT 2FJAA 2BVMA 4EYUA 4JYAT 2J62A 3DP7A 3TKLB 3UQ4A 5AQHB 3PMZA 4UV8B 4YT0A 2Y57A 2WWUA 1H7CA 4PW8A 2KMFA 4NIQA 4UM3S 3KBUA 4IE4A 1UX5A 4TWFA 2BR7A 5L47A 1VOMA 4UEMA 3ZPOA 2A3DA 4EOZB 4TWDA 4X1YE 5LGUB 1MMAA 4LF5T 4HWCA 1VCTA 3ONXA 4H9QC 3C64A 4UVCB 5LXBA 2M6BA 2IAKA 2MYSA 5FKYA 2LM2A 3ZYMA 2E2AA 4NXMT 4EXTA 1D1BA 2CXLA 1HG2A 4IL4A 3CWZB 2CA5A 2X0HA 3T4MA 3CX7B 2X66A 5J5GA 3PU8A 1I9BA 1WCRA 2HN2A 3N9NA 4PFPA 2W8GA 2UUBT 4XAXB 4DR6T 2N9DA 4YSYA 3G06A 1IBMT 2Y58A 2EHOD 4OFZA 1WYBA 2DI4A 2X00A 5AFHA 2BBHA 4LFBT 4HWIB 3MXZA 2VASA 5LHGB 4JI1T 2L8KA 5JDHA 2PGZA 4YTPA 5BMVE 3ETVA 1S35A 5EZYE 5FXWA 2CLYB 4M1PA 4DBQA 1GQEA 4ISTA 5FVKA 5C8YE 2BZBA 3ZT6A 5J0ZA 4OYJA 5FP3A 3AA7B 4QX8B 3LJCA 2LRLA 5BR8T 4NXNT 3CQGB 2XPKA 5IUXA 5AINA 3KDSE 2A2FX 2VKOA 4IDOA 3T8OA 2N1GA 5AQLB 1G73A 2XQ6A 1MIYA 3VR9A 3RQWA 1UW6A 2WMOA 4O4JE 4DR5T 3AEBA 1LRZA 1QLBA 4IE5A 2QC1B 2DNXA 3ZJ1A 4K0UA 4DV1T 3SFEA 3LFMA 5CO5A 2XAGB 2WN9A 3E22E 3PUVF 4QXCB 3I9YA 2PBIA 2OLTA 4C90A 2WDRA 1VCSA 3OJAA 4GK0E 3SH1A 3I1AA 4U2ZA 3UULA 4LFCT 1YQ4A 5JVDE 2JRKA 3KVBA 1EZ3A 4H9NC 1YKEB 3KV6A 1KNPA 4AKLA 3HKDE 4OK0A 4XK9A 1FMWA 3VKGA 5AQPB 5AFJA 3BQKA 4ZZBA 3L09A 3QB5K 4ILBA 1B7TA 4AQFA 4Q25A 2VB6A 4QWNB 2ZM0A 3HA4A 4P09A 3QOFA 2XAJB 4DR4T 5HEUA 3VRAA 2XNTA 3FZFB 3JAEA 5JDGA 4QH5A 4CXXA 3V5UA 4YJ3E 2LOPA 1ZP0A 4IGUA 2RA1A 5AQNB 1KK7A 4WW0A 1D0XA 5JMEA 4NPPA 5FXZA 1BR1A 5LXTE 3FZHB 2Y8DA 1HS7A 3CQCB 2UZ6A 2QGSA 1UURA 3RYIE 1IZNB 5JTGA 5KE4A 4H9PC 4KHPT 3MZKB 2M67A 4I0UA 2W61A 3LK3B 4LFAT 2IUBA 3OKQA 4IDNA 4PIRA 3N9OA 5EK3A 5KX5E 3O9XA 2W4XA 2VKDA 2V5CA 1US7B 1WFDA 4E7SA 4JI8T 3RPUA 3RRWA 4KI0F 5L3BB 5L3FB 5FYMA 3KV9A 2C5JA 3S4UA 4CN1A 2V1DB 1OEDA 4JI4T 2NR4A 5LB7B 4CI3B 4DV4T 2X9XA 4NZBA 2XAQB 3HR0A 1NENA 4GYSA 1YD8G 3ZEFB 4JEHB 2W66A 3MKDA 2LOSA 5KDMC 2HHHT 2N2NA 4HFCA 5ABFB 3WI3A 4B3RT 4DV3T 1R8IA 2XNVA 4COFA 3UU8A 2XQ5A 4BJNA 2VQET 5F3JA 3AE6A 5FJVA 3ZDHA 3C79A 1YKHB 3CK6A 4ILAA 5ABHA 3K3NA 3ZT7A 2JMHA 4DBRA 2CPTA 3RLFF 2ZM8A 1WRDA 4DR3T 3GN5A 3H3AA 2E5LT 4HWHA 3GMIA 4UVAB 3ABVA 2ZM6T 3AAAB 4KUMB 2Q9QB 2BG9A 4ADZA 2YMEA 4BFQA 4I50E 1HX8A 3FZMB 5FL0A 3AEAA 4WBOA 1HTJF 4X65T 4WZXA 3P4RA 2K9AA 2X51A 3ZMVB 2LSIA 4WYVA 5J5FA 3PUSA 4B3TT 2BJ0A 1T8BA 2PFVA 4AQFC 5LMNT 3ZDGA 5LOVE 5J2UE 3VRBA 5DJQC 5C2TA 2XY8B 4YXDA 4YHHT 3RIUA 4GYRA 5IHYA 5AQVB 5FXXA 2XJ7A 4ZEYA 4DV7T 2CHOA 2W63A 3JC6C 4U74A 3KBTA 3UU3A 3RI5A 1ZHCA 3C84A 4IE7A 2B76A 3ZN1B 5SYOA 4TV8E 1E7PA 4LF9T 2H3RA 3N9QA 1N33T 2IHR1 4ZK1A 2JPFA 3Q5EA 2CE7A 3SRZA 4X1IE 4HFBA 1FJGT 1HR0T 5HWYA 4LF7T 2IC6A 3EDUA 2JIWA 2Y6XA 2XQ4A 3AE8A 3N2OA 3BQIA 1FEWA 3PUWF 1QSDA 3HL6A 2L3LA 3EDVA 3L3PA 5AQUB 4AKRB 3ANWA 4ZI7E 1T7SA 2LEHA 5LYJE 2C0SA 5KZUA 1HG5A 4ZR6A 2VVNA 3OPCA 5HEGA 1U5PA 2YOEA 2K24A 2YDSA 5FY0A 3RYHE 4LMJA 3RC8A 1MMNA 3RIUC 3WIPA 3WTJA 5JRCA 2V6YA 3GN5B 4I4TE 2LHRA 4FI5A 3ZMUB 1M7KA 1WLXA 5L3GB 4XZCA 3I9WA 4EV6A 2D9DA 3U8KA 4ZHQE 4HGAA 4O4LE 3EHZA 2WDQA 3QUJA 2VL0A 4H9RC 3AVSA 2VKJA 2XHEB 3NZQA 4CI1B 4HN9A 2X68A 2LRKA 2LJLA 3FHNA 1E1HB 4HFHA 5DQVA 4HE8A 3PUGA 2PG8A 3AEGA 3SFDA 5H6RB 5LMUT 4GOUA 5J1GA 3ZLIA 5LHIB 3FBLA 3N9PA 4D01A 4Z90A 5AQQB 4PJJA 4U7IA 5AFUL 1ZKEA 3MJXA 3PV0F 4ERRA 5JH7E 3WTOA 4F8HA 4DUZT 4DO0A 4QXHB 5FMNA 4X20E 1W0BA 3PUQA 3IF8B 3RF1A 2XUEA 2RPAA 2WZHA 2WU2A 2JMKA 3ZC1A 1WR0A 3QC9A 4ZK4A 2BVLA 3LK42 4PK6A 2D2SA 3SWHA 3RIFA 3RYCE 2C5IT 2ODVA 3EAMA 3DJBA 3KV5A 3CQXC 4ASKA 2WY2A 3T1YT 4ILCA 4KX6A 3ZC0A 5ETWA 2Q9QD 3C4WA 3QNUA 5L4HA 1IAPA 2V7KA 4UELA 2ACZA 2I6HA 5LJNA 2Y48B 2G0UA 4GKKT 1NEKA 1MMGA 5HXSA 2J4GA 2EHOB 2BS3A 3RGLA 4EAHA 2XYSA 3AE9A 5BRXA 3K3QC 1CUNA 4L0RA 5ABEA 1D1AA 1XNRT 3B13A 1S94A 3N2GE 3PJAA 2Y54A 4IDPA 2XM2A 2NP9A 4HWFA 2LKHA 2YDQA 2LSKA 2NTYA 2VURA 3UQ7A 1ZV4X 1YQ3A 5LCYA 2X0YA 3AE5A 3BQLA 2AE9A 1IBLT 4CN4A 4OX9T 2BDEA 3PEOA 5JRCB 2BYRA 2MBGA 1IBKT 3W15B 1XWMA 4OYKA 2VVSA 4X66T 4MBQA 4Z8XA 3J9X1 3A7MA 3EABA 4ZXLA 3E0ZA 4AQYT 3SIOA 2Q9QC 3UUXB 5AQJB 4QABA 1D0ZA 4IDQA 1Z8UA 5FL1A 2W67A 2YN6A 4I55E 2YDRA 3F31A 3AAIA 5JDQA 2UXDT 3C4ZA 3AAEB 4U72A 4CXWA 3NVOA 2WZIA 3AEDA 5TAOA 3I0OA 3K1SA 2PH9A 3LBXA 1I6ZA 3WTIA 1KNRA 2I59A 3QB5A 4ZJTA 5JQGE 2CWOA 1O3XA 2EHOA 2ES0A 3Q2MA 2XSBA 5JREA 2ACXA 4MHCA 3C50A 3C98B 4YJ2E 3K3OA 3IA3A 5M4YA 3I0QA 2E9XA 3JAFA 1OEDB 4EEBA 4PJLA 3NWIA 5BP0A 1UX2A 4ZI2C 3M3ZB 4E7ZA 3E08A 1U4QA 4ZZCA 3IGQA 5AFMA 4CQIA 4PAGA 5AFKA 5L3CB 1SUMB 3FZLB 1KNZA 5AFNA 2V5DA 1KEYA 2FUPA 3UUBA 4HFEA 2JQQA 2X9HA 4DMVA 2LT3A 2L9QA 3C51A 5JR9C 4EGWA 2WWVA 4DR7T 2PTFA 3R6NA 2H88A 4YFSA 5F5WA 4JEUB 4A56A 5LBMA 4EIWA 1DU2A 2DL1A 2KWIB 4BQTA 3AA6B 2V7LA 4AQGA 1XMQT 2DWGA 3JC6D 4ZRUA 3LK2B 5L3EB 5FVLA 2QVAA 1NWMX 2H7OA 2BYSA 3Q5WA 4EZ1A 3RKGA 4WNKA 4EZHA 4O4HE 5CA1E 2WM9A 4KMCA 4YLHA 2AXDS 2ZM2A 2DWKA 4ISSA 3OVUA 3CMLA 4KHZF 1ZOYA 4U31A 2LSJA 4AFHA 1W9RA 1UV6A 2A72A 2KNDA 2BKOA 4YSZA 4QH1A 3X1DA 3VR8A 3HKBE 5HEJA 1YXRA 4IDZA 3NZPA 2UXCT 4P0BA 2CLYC 1UX4A 4HFDA 3WTKA 1HF8A 4LF8T 2XQ8A 4O2AE 2BYQA 3SOLA 2J1DG 2WS3A 1J5WA 1M62A 4JBWF 4WV9A 2ZJUA 1SA0E 2X00D 1N34T 2QYWA 3KFWX 2Y7YA 5DQWA 2DHRA 2VWAA 4MALA 4QX7B 2BG9E 3ETUA 4TN7B 3ONJA 4GIWA 2NWBA 2V7MA 3ZYLA 4A97A 3PUXF 4TWHA 2BS2A 4QH4A 1E2AA 3V5SA 3PJAJ 1HFAA 2LSYA 2QA7A 3LG7A 2VQFT 2WCAA 3AECA 4QAAA 1UCUA 1Z0PA 4C91A 2E5VA 3UU4A 4JI5T 2CWYA 2XASB 4FRRA 4P1NA 1SE7A 2SPCA 3ESLA 2YMDA 1XMOT 4N78D 1X79A 3U8NA 3P4PA 2XM1A 3L39A 1D0YA 4PK4A 5AQKB 4HQPA 2XQ7A 3LSVA 4V1Av 3U8MA 5J5HA 5HXCA 3VU7H 3P4SA 3P4WA 2YK0A 3U8LA 1NAFA 3PUYF 5L2LA 4O2BE 4ALXA 2WNLA 4QHOA 1ZEEA 4YY3T 2H7VC 1WYCA 3N5LA 5C3JA 3U8JA 2UXBT 3SS1A 3AVRA 4AISA 2W0GA 4YHJA 3N9MA 3CIRA 2LLYA 2WNCA 2CBIA 2V7IA 5L3DB 2FBWA 3WTNA 4ZI2D 2WAUA 4MFRA 2FJEA 2XQAA 2YEVC 3GWHA 4EB6E 1WR6A 1UK5A 3DTOA 4NUUA 2K3WA 3KINB 1MIWA 5EK2A 2BBJA 5LNKA 2E9XD 3OYZA 2V7JA 4NUVA 4H63V 4IE0A 2D5UA 4AKHA 3UT5E 4TZ4C 2D0UA 4OHFA 4UF0B 3RHWA 3FXEB 4HWDA 4CXYA 2XAFB 4XHEA 3HI2A 5LP6E 3IBPA 2YU2A 5FNVE 3WAJA 2CM0A 3OBVE 4YTNA 3RC3A 1HNXT 2XQYA 2WSSV 3ZJ2A 4ANJA 2XQ9A 2XZEA 3UU6A 4LF4T 2GK9A 3JADA 1UGOA 4DNDA 3AE7A 4DR1T 3PU3A 3RX6A 4JI3T 3M65A 1XDOA 4IT4A 1J5ET 4AI6A 3TLUA 4ZJSA 2LM9A 3AE2A 4X5TA 2LE8A 4DMWA 2LKGA 5AQIB 2KSRA 4DUYT 3VKHA 5JR9A 4XBFB 4PFOA 4JI6T 1MMDA 3EUHA 4HKAA 3ZYKA 1OEDE 4DV0T 4TNWA 1Y64B 2Y56A 4JI2T 5HCJA 3IEEA 3RQUA 1KF6A 1G8XA 2IMLA 4A5XA 3Q5XA 5AFLA 4ZI3D 2R6GF 3U3IA 4UXNB 3CKDA 2BS4A 1LKXA 3J7Yq
chains in the Genus database with same CATH topology
2BG9B 2XNUA 3PMZA 2WNJA 3UU5A 4UM1A 4XK9A 4BQTA 5J5IA 2PGZA 4A97A 2Y57A 5AFJA 4IREA 4TWHA 4NZBA 4B5DA 4QH4A 3TLSA 5TVCA 5L4HA 4ZRUA 4UM3S 4ZZBA 4QAAA 2BYSA 4EZ1A 4ILBA 4TWFA 2BR7A 4AFGA 5L47A 3U8KA 3RHWA 4HFCA 3EHZA 5J0ZA 4LMKA 2PH9A 3SQ9A 5AFMB 4XHEA 3UU3A 3UU4A 3RI5A 2VL0A 5HEUA 2XZ5A 3WTIA 3C84A 4FRRA 4TWDA 4UM3P 2XNTA 5SYOA 4ZJTA 3ZKRA 5IUXA 2XYSA 5AINA 2XYTA 4TNVA 2YMDA 1OEDC 4QACA 2XNVA 4IL9A 3U8NA 3JAEA 5BRXA 5LXBA 2M6BA 5HCMA 4QH5A 3TLWA 4COFA 2XQ9A 3UU6A 3UU8A 2ZJVA 4HFHA 2XQ7A 2XQ5A 3JADA 3TLTA 4HQPA 3LSVA 4ZK1A 3U8MA 5J5HA 2Y54A 4AFHA 2LM2A 2XZ6A 4UXUA 3JAFA 2BYNA 3P4WA 1UV6A 3WTLA 4D01A 2XQ6A 4HFBA 1OEDB 4Z90A 4QH1A 5FJVA 3RIAA 3C79A 2M6IA 3ZDHA 5JMEA 4NPPA 3U8LA 3RQWA 4ILAA 2LKHA 3GUAA 5BP0A 3WTMA 1UW6A 4HFIA 4Z91A 3TLUA 4ZJSA 1UX2A 5L4EA 4X5TA 5HEHA 4AFTA 4ALXA 2QC1B 2LKGA 2XQ4A 2WNLA 3WTOA 4IL4A 5HEJA 2KSRA 3T4MA 4F8HA 3U8JA 2BG9C 3P50A 3UQ7A 2UZ6A 3TLVA 5J5GA 4UM3A 4ZZCA 1I9BA 3IGQA 5CO5A 5AFMA 2YKSA 5HEOA 5KE4A 2WN9A 1OEDE 2BG9A 3PEOA 2YMEA 2W8GA 4HFDA 4TNWA 3WTKA 4BFQA 5AFKA 2BYRA 4A98A 2LLYA 2WNCA 2XQ8A 3SH1A 2Y56A 5KZUA 3EI0A 3WTNA 5AFNA 2XQ3A 4ZR6A 5HCJA 4PIRA 3RQUA 4DBMA 5HEGA 3UUBA 2BYQA 2W8FA 2WZYA 3WTHA 2YOEA 2Y58A 3SQ6A 2XQAA 4ZK4A 4HFEA 5CFBA 5AFLA 4WV9A 3RIFA 2ZJUA 5BW2A 2MAWA 4LMLA 4UY2A 2X00D 2Y7YA 4LMJA 3EAMA 2BR8A 2BYPA 3SIOA 2X00A 5J5FA 5LG3A 5AFHA 2BJ0A 3WIPA 4QABA 3WTJA 1OEDA 2C9TA 2BG9E 4ILCA 3UQ4A 3ZDGA 2YN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG9 B;  2XNU A;  3PMZ A;  2WNJ A;  3UU5 A;  4UM1 A;  4XK9 A;  4BQT A;  5J5I A;  2PGZ A;  4A97 A;  2Y57 A;  5AFJ A;  4IRE A;  4TWH A;  4NZB A;  4B5D A;  4QH4 A;  3TLS A;  5TVC A;  5L4H A;  4ZRU A;  4UM3 S;  4ZZB A;  4QAA A;  2BYS A;  4EZ1 A;  4ILB A;  4TWF A;  2BR7 A;  4AFG A;  5L47 A;  3U8K A;  3RHW A;  4HFC A;  3EHZ A;  5J0Z A;  4LMK A;  2PH9 A;  3SQ9 A;  5AFM B;  4XHE A;  3UU3 A;  3UU4 A;  3RI5 A;  2VL0 A;  5HEU A;  2XZ5 A;  3WTI A;  3C84 A;  4FRR A;  4TWD A;  4UM3 P;  2XNT A;  5SYO A;  4ZJT A;  3ZKR A;  5IUX A;  2XYS A;  5AIN A;  2XYT A;  4TNV A;  2YMD A;  1OED C;  4QAC A;  2XNV A;  4IL9 A;  3U8N A;  3JAE A;  5BRX A;  5LXB A;  2M6B A;  5HCM A;  4QH5 A;  3TLW A;  4COF A;  2XQ9 A;  3UU6 A;  3UU8 A;  2ZJV A;  4HFH A;  2XQ7 A;  2XQ5 A;  3JAD A;  3TLT A;  4HQP A;  3LSV A;  4ZK1 A;  3U8M A;  5J5H A;  2Y54 A;  4AFH A;  2LM2 A;  2XZ6 A;  4UXU A;  3JAF A;  2BYN A;  3P4W A;  1UV6 A;  3WTL A;  4D01 A;  2XQ6 A;  4HFB A;  1OED B;  4Z90 A;  4QH1 A;  5FJV A;  3RIA A;  3C79 A;  2M6I A;  3ZDH A;  5JME A;  4NPP A;  3U8L A;  3RQW A;  4ILA A;  2LKH A;  3GUA A;  5BP0 A;  3WTM A;  1UW6 A;  4HFI A;  4Z91 A;  3TLU A;  4ZJS A;  1UX2 A;  5L4E A;  4X5T A;  5HEH A;  4AFT A;  4ALX A;  2QC1 B;  2LKG A;  2XQ4 A;  2WNL A;  3WTO A;  4IL4 A;  5HEJ A;  2KSR A;  3T4M A;  4F8H A;  3U8J A;  2BG9 C;  3P50 A;  3UQ7 A;  2UZ6 A;  3TLV A;  5J5G A;  4UM3 A;  4ZZC A;  1I9B A;  3IGQ A;  5CO5 A;  5AFM A;  2YKS A;  5HEO A;  5KE4 A;  2WN9 A;  1OED E;  2BG9 A;  3PEO A;  2YME A;  2W8G A;  4HFD A;  4TNW A;  3WTK A;  4BFQ A;  5AFK A;  2BYR A;  4A98 A;  2LLY A;  2WNC A;  2XQ8 A;  3SH1 A;  2Y56 A;  5KZU A;  3EI0 A;  3WTN A;  5AFN A;  2XQ3 A;  4ZR6 A;  5HCJ A;  4PIR A;  3RQU A;  4DBM A;  5HEG A;  3UUB A;  2BYQ A;  2W8F A;  2WZY A;  3WTH A;  2YOE A;  2Y58 A;  3SQ6 A;  2XQA A;  4ZK4 A;  4HFE A;  5CFB A;  5AFL A;  4WV9 A;  3RIF A;  2ZJU A;  5BW2 A;  2MAW A;  4LML A;  4UY2 A;  2X00 D;  2Y7Y A;  4LMJ A;  3EAM A;  2BR8 A;  2BYP A;  3SIO A;  2X00 A;  5J5F A;  5LG3 A;  5AFH A;  2BJ0 A;  3WIP A;  4QAB A;  3WTJ A;  1OED A;  2C9T A;  2BG9 E;  4ILC A;  3UQ4 A;  3ZDG A;  2YN6 A; 
#chains in the Genus database with same CATH topology
 1HX1 B;  5H6Q B;  2WNJ A;  2BKN A;  3UU5 A;  3FBZ A;  4IRE A;  1MNE A;  4B5D A;  5AQO B;  5JDF A;  2NW8 A;  5HXH A;  2NW9 A;  1HNW T;  4B3M T;  1SHZ C;  3UTK A;  2YIN A;  3AE1 A;  2HPJ A;  4LF6 T;  2KLQ A;  4B6X A;  4BJM A;  3P7I A;  2C5K T;  2CCQ A;  2J47 A;  3GA8 A;  1FMV A;  3ZCJ A;  2XYT A;  4IL9 A;  4WBN E;  3RH3 A;  2UU9 T;  2HN1 A;  4B3S T;  2CXF A;  2VKH A;  5AQG B;  4HTE A;  5EK4 A;  2PJQ A;  2KZ7 B;  2XTL A;  1BR2 A;  3AE4 A;  4I43 B;  4DV2 T;  5LJM A;  4KP3 C;  4CN6 A;  3P50 A;  5IWA T;  2Z6E A;  2V6Y B;  5HXE A;  4ZI3 C;  4EZ4 A;  3K8P C;  4JI7 T;  4KBM B;  4L9I A;  4YSX A;  3P8C D;  3H3M A;  3BK9 A;  2WB5 A;  4UV9 B;  2WDV A;  3PUR A;  5AQS B;  5BW2 A;  4DR2 T;  3B57 A;  3AE3 A;  3H37 A;  3A8Y C;  3KV4 A;  3RRC A;  2BR8 A;  5LG3 A;  2IDO B;  4P0A A;  4U7Y A;  3KVA A;  5LBQ B;  4O8S A;  3PE0 A;  3MAC A;  1UUS A;  5AQF B;  3FXD B;  1KFY A;  3ZN0 B;  5ADX L;  5A1L A;  5ABG A;  3JCF A;  2WP9 A;  2IW5 B;  3B5M A;  4QKN A;  1LVK A;  3CPZ A;  2K5B B;  2E9X B;  2W62 A;  5HXR A;  4DV6 T;  5JDN A;  4H9O C;  2V8S V;  3CX6 B;  3ZSS A;  2CBJ A;  1D1C A;  3RYF E;  4G63 A;  5HCM A;  4G2A A;  2ZJV A;  2X9W A;  3AA0 B;  4UVB B;  5HWX A;  4HFV A;  4ILU A;  1HNZ T;  4FJO A;  2M6I A;  2X67 A;  2BKP A;  1LVF A;  2KWH A;  2X9Y A;  3L8R A;  5LA6 E;  4Z91 A;  5L4E A;  2NW7 A;  3MA9 A;  1QUU A;  2BG9 C;  4IHJ E;  4PJN A;  3NRX A;  2JQ9 A;  4BAY B;  4JI0 T;  2YKS A;  5HEO A;  2CRB A;  2X0L B;  2A9U A;  1HCI A;  3ZT5 A;  3AA1 B;  1JNR A;  2KT9 A;  4H63 H;  4MLK A;  5LHH B;  2OA5 A;  2XQ3 A;  2MOZ A;  3UFE A;  1IJ5 A;  3PUZ F;  1L0V A;  3SQ6 A;  2LHN A;  5DAB A;  4JLE A;  2DLR A;  2VK9 A;  3LDQ B;  2C9T A;  5LGN B;  4PJM A;  3ZST A;  4UM1 A;  1IJ6 A;  4L5G A;  2EHO C;  4CZZ B;  4TV9 E;  2I0M A;  2CXD A;  1CHU A;  5CB4 E;  3ANW B;  4AFG A;  2FJB A;  1T98 A;  1JNZ A;  3CVR A;  3SQ9 A;  2E8I A;  4X64 T;  3N2K E;  1BR4 A;  3OYX A;  3A5X A;  1XZY A;  2XZ5 A;  3OTO T;  4UIG A;  4UM3 P;  2CMR A;  3VHL A;  2NOX A;  3O4X E;  5AQT B;  4QAC A;  5KXJ A;  3AXJ A;  4F6R C;  2K48 A;  4GKJ T;  2KXP B;  2F4V T;  2W00 A;  3HKC E;  4GK5 E;  3WTL A;  2LSG A;  3IHR A;  3WTM A;  4DV5 T;  4HFI A;  4BA9 A;  5HEH A;  3ZMS B;  3AEF A;  4TUY E;  4UM3 A;  4X1K E;  5F8P A;  2JQH A;  2IC9 A;  5E0O A;  2WU5 A;  2E9X C;  2KIN B;  3CX8 B;  4EED A;  5AQM B;  4HEA A;  4U2Y A;  3UUM A;  4YTM A;  2V6X A;  2BG9 B;  2XNU A;  2Q9Q A;  5J5I A;  2JQK A;  3T1H T;  5KMG P;  2W2U A;  3PDY A;  3ONL C;  2P9B A;  1T72 A;  4J2C A;  2UXN B;  2OV9 A;  2WMN A;  3O1H A;  1XNQ T;  3F57 A;  3RKO A;  3O1I A;  1V9D A;  5HAX A;  3FB2 A;  4TNV A;  1OED C;  4U33 A;  1VRB A;  3N9L A;  2ZMA A;  3Q9D A;  3TLT A;  4JV5 T;  2YU1 A;  4U3C A;  3PUA A;  3RIA A;  2NTX A;  3GUA A;  1FIO A;  4AFT A;  5CGM A;  2H89 A;  3PTR B;  3NBX X;  3QK6 A;  3TLV A;  1MND A;  2MTQ A;  4X62 T;  4CI2 B;  4K0K T;  4TX5 A;  1X9B A;  5FY1 A;  3NRY A;  2UUC T;  2FJD A;  1J1J A;  2WZY A;  2W8F A;  5JR9 B;  4ZOL E;  1W09 A;  3WTH A;  4QXB B;  1N32 T;  2IIU A;  2CEA A;  2MAW A;  3ZMZ B;  4UY2 A;  2V26 A;  3UUN A;  2BYP A;  3UFG A;  2DCF A;  3AB3 B;  3FZK B;  3MK7 C;  5FY7 A;  2VL8 A;  5J2T E;  2D0T A;  3O1J A;  3NKZ A;  2MPK A;  4JUY A;  5AQR B;  1W0A A;  3Q5D A;  5IYZ E;  3ZCI A;  3AXJ B;  3TLS A;  5TVC A;  4PK5 A;  2QRX A;  1I94 T;  2XSA A;  4AIU A;  4H9S E;  4LMK A;  5AFM B;  4AKG A;  3C4X A;  5CJ5 A;  2ODU A;  3EVY A;  3ZKR A;  3ZMT B;  3R84 B;  5GON E;  3TLW A;  1AJ3 A;  2HH7 A;  5ABF A;  1Y01 A;  3WAK A;  5LGT B;  2UXX B;  2XAH B;  2XZ6 A;  4UR9 A;  4UXU A;  1XDP A;  2BYN A;  4IIJ E;  1OXZ A;  2ZLY A;  3U78 A;  3AEE A;  4AXP A;  2RP4 A;  4UF0 A;  5JDL A;  2HPL A;  4DID B;  3F2E A;  1MIV A;  4ZS3 A;  4AKI A;  3LBX B;  2B1E A;  5CA0 E;  5FXV A;  1OWA A;  4PNI A;  4DVD A;  2WQY A;  4EYY R;  1BR0 A;  5JDM A;  3HKE E;  2JJ9 A;  4A98 A;  5HYA A;  5LG4 A;  1N36 T;  3EI0 A;  3P4Q A;  3D0T A;  4DBM A;  4ZS2 A;  1YW0 A;  2CHN A;  2WBL A;  4IE6 A;  4O4I E;  5CFB A;  4LML A;  2UUA T;  2FJA A;  2BVM A;  4EYU A;  4JYA T;  2J62 A;  3DP7 A;  3TKL B;  3UQ4 A;  5AQH B;  3PMZ A;  4UV8 B;  4YT0 A;  2Y57 A;  2WWU A;  1H7C A;  4PW8 A;  2KMF A;  4NIQ A;  4UM3 S;  3KBU A;  4IE4 A;  1UX5 A;  4TWF A;  2BR7 A;  5L47 A;  1VOM A;  4UEM A;  3ZPO A;  2A3D A;  4EOZ B;  4TWD A;  4X1Y E;  5LGU B;  1MMA A;  4LF5 T;  4HWC A;  1VCT A;  3ONX A;  4H9Q C;  3C64 A;  4UVC B;  5LXB A;  2M6B A;  2IAK A;  2MYS A;  5FKY A;  2LM2 A;  3ZYM A;  2E2A A;  4NXM T;  4EXT A;  1D1B A;  2CXL A;  1HG2 A;  4IL4 A;  3CWZ B;  2CA5 A;  2X0H A;  3T4M A;  3CX7 B;  2X66 A;  5J5G A;  3PU8 A;  1I9B A;  1WCR A;  2HN2 A;  3N9N A;  4PFP A;  2W8G A;  2UUB T;  4XAX B;  4DR6 T;  2N9D A;  4YSY A;  3G06 A;  1IBM T;  2Y58 A;  2EHO D;  4OFZ A;  1WYB A;  2DI4 A;  2X00 A;  5AFH A;  2BBH A;  4LFB T;  4HWI B;  3MXZ A;  2VAS A;  5LHG B;  4JI1 T;  2L8K A;  5JDH A;  2PGZ A;  4YTP A;  5BMV E;  3ETV A;  1S35 A;  5EZY E;  5FXW A;  2CLY B;  4M1P A;  4DBQ A;  1GQE A;  4IST A;  5FVK A;  5C8Y E;  2BZB A;  3ZT6 A;  5J0Z A;  4OYJ A;  5FP3 A;  3AA7 B;  4QX8 B;  3LJC A;  2LRL A;  5BR8 T;  4NXN T;  3CQG B;  2XPK A;  5IUX A;  5AIN A;  3KDS E;  2A2F X;  2VKO A;  4IDO A;  3T8O A;  2N1G A;  5AQL B;  1G73 A;  2XQ6 A;  1MIY A;  3VR9 A;  3RQW A;  1UW6 A;  2WMO A;  4O4J E;  4DR5 T;  3AEB A;  1LRZ A;  1QLB A;  4IE5 A;  2QC1 B;  2DNX A;  3ZJ1 A;  4K0U A;  4DV1 T;  3SFE A;  3LFM A;  5CO5 A;  2XAG B;  2WN9 A;  3E22 E;  3PUV F;  4QXC B;  3I9Y A;  2PBI A;  2OLT A;  4C90 A;  2WDR A;  1VCS A;  3OJA A;  4GK0 E;  3SH1 A;  3I1A A;  4U2Z A;  3UUL A;  4LFC T;  1YQ4 A;  5JVD E;  2JRK A;  3KVB A;  1EZ3 A;  4H9N C;  1YKE B;  3KV6 A;  1KNP A;  4AKL A;  3HKD E;  4OK0 A;  4XK9 A;  1FMW A;  3VKG A;  5AQP B;  5AFJ A;  3BQK A;  4ZZB A;  3L09 A;  3QB5 K;  4ILB A;  1B7T A;  4AQF A;  4Q25 A;  2VB6 A;  4QWN B;  2ZM0 A;  3HA4 A;  4P09 A;  3QOF A;  2XAJ B;  4DR4 T;  5HEU A;  3VRA A;  2XNT A;  3FZF B;  3JAE A;  5JDG A;  4QH5 A;  4CXX A;  3V5U A;  4YJ3 E;  2LOP A;  1ZP0 A;  4IGU A;  2RA1 A;  5AQN B;  1KK7 A;  4WW0 A;  1D0X A;  5JME A;  4NPP A;  5FXZ A;  1BR1 A;  5LXT E;  3FZH B;  2Y8D A;  1HS7 A;  3CQC B;  2UZ6 A;  2QGS A;  1UUR A;  3RYI E;  1IZN B;  5JTG A;  5KE4 A;  4H9P C;  4KHP T;  3MZK B;  2M67 A;  4I0U A;  2W61 A;  3LK3 B;  4LFA T;  2IUB A;  3OKQ A;  4IDN A;  4PIR A;  3N9O A;  5EK3 A;  5KX5 E;  3O9X A;  2W4X A;  2VKD A;  2V5C A;  1US7 B;  1WFD A;  4E7S A;  4JI8 T;  3RPU A;  3RRW A;  4KI0 F;  5L3B B;  5L3F B;  5FYM A;  3KV9 A;  2C5J A;  3S4U A;  4CN1 A;  2V1D B;  1OED A;  4JI4 T;  2NR4 A;  5LB7 B;  4CI3 B;  4DV4 T;  2X9X A;  4NZB A;  2XAQ B;  3HR0 A;  1NEN A;  4GYS A;  1YD8 G;  3ZEF B;  4JEH B;  2W66 A;  3MKD A;  2LOS A;  5KDM C;  2HHH T;  2N2N A;  4HFC A;  5ABF B;  3WI3 A;  4B3R T;  4DV3 T;  1R8I A;  2XNV A;  4COF A;  3UU8 A;  2XQ5 A;  4BJN A;  2VQE T;  5F3J A;  3AE6 A;  5FJV A;  3ZDH A;  3C79 A;  1YKH B;  3CK6 A;  4ILA A;  5ABH A;  3K3N A;  3ZT7 A;  2JMH A;  4DBR A;  2CPT A;  3RLF F;  2ZM8 A;  1WRD A;  4DR3 T;  3GN5 A;  3H3A A;  2E5L T;  4HWH A;  3GMI A;  4UVA B;  3ABV A;  2ZM6 T;  3AAA B;  4KUM B;  2Q9Q B;  2BG9 A;  4ADZ A;  2YME A;  4BFQ A;  4I50 E;  1HX8 A;  3FZM B;  5FL0 A;  3AEA A;  4WBO A;  1HTJ F;  4X65 T;  4WZX A;  3P4R A;  2K9A A;  2X51 A;  3ZMV B;  2LSI A;  4WYV A;  5J5F A;  3PUS A;  4B3T T;  2BJ0 A;  1T8B A;  2PFV A;  4AQF C;  5LMN T;  3ZDG A;  5LOV E;  5J2U E;  3VRB A;  5DJQ C;  5C2T A;  2XY8 B;  4YXD A;  4YHH T;  3RIU A;  4GYR A;  5IHY A;  5AQV B;  5FXX A;  2XJ7 A;  4ZEY A;  4DV7 T;  2CHO A;  2W63 A;  3JC6 C;  4U74 A;  3KBT A;  3UU3 A;  3RI5 A;  1ZHC A;  3C84 A;  4IE7 A;  2B76 A;  3ZN1 B;  5SYO A;  4TV8 E;  1E7P A;  4LF9 T;  2H3R A;  3N9Q A;  1N33 T;  2IHR 1;  4ZK1 A;  2JPF A;  3Q5E A;  2CE7 A;  3SRZ A;  4X1I E;  4HFB A;  1FJG T;  1HR0 T;  5HWY A;  4LF7 T;  2IC6 A;  3EDU A;  2JIW A;  2Y6X A;  2XQ4 A;  3AE8 A;  3N2O A;  3BQI A;  1FEW A;  3PUW F;  1QSD A;  3HL6 A;  2L3L A;  3EDV A;  3L3P A;  5AQU B;  4AKR B;  3ANW A;  4ZI7 E;  1T7S A;  2LEH A;  5LYJ E;  2C0S A;  5KZU A;  1HG5 A;  4ZR6 A;  2VVN A;  3OPC A;  5HEG A;  1U5P A;  2YOE A;  2K24 A;  2YDS A;  5FY0 A;  3RYH E;  4LMJ A;  3RC8 A;  1MMN A;  3RIU C;  3WIP A;  3WTJ A;  5JRC A;  2V6Y A;  3GN5 B;  4I4T E;  2LHR A;  4FI5 A;  3ZMU B;  1M7K A;  1WLX A;  5L3G B;  4XZC A;  3I9W A;  4EV6 A;  2D9D A;  3U8K A;  4ZHQ E;  4HGA A;  4O4L E;  3EHZ A;  2WDQ A;  3QUJ A;  2VL0 A;  4H9R C;  3AVS A;  2VKJ A;  2XHE B;  3NZQ A;  4CI1 B;  4HN9 A;  2X68 A;  2LRK A;  2LJL A;  3FHN A;  1E1H B;  4HFH A;  5DQV A;  4HE8 A;  3PUG A;  2PG8 A;  3AEG A;  3SFD A;  5H6R B;  5LMU T;  4GOU A;  5J1G A;  3ZLI A;  5LHI B;  3FBL A;  3N9P A;  4D01 A;  4Z90 A;  5AQQ B;  4PJJ A;  4U7I A;  5AFU L;  1ZKE A;  3MJX A;  3PV0 F;  4ERR A;  5JH7 E;  3WTO A;  4F8H A;  4DUZ T;  4DO0 A;  4QXH B;  5FMN A;  4X20 E;  1W0B A;  3PUQ A;  3IF8 B;  3RF1 A;  2XUE A;  2RPA A;  2WZH A;  2WU2 A;  2JMK A;  3ZC1 A;  1WR0 A;  3QC9 A;  4ZK4 A;  2BVL A;  3LK4 2;  4PK6 A;  2D2S A;  3SWH A;  3RIF A;  3RYC E;  2C5I T;  2ODV A;  3EAM A;  3DJB A;  3KV5 A;  3CQX C;  4ASK A;  2WY2 A;  3T1Y T;  4ILC A;  4KX6 A;  3ZC0 A;  5ETW A;  2Q9Q D;  3C4W A;  3QNU A;  5L4H A;  1IAP A;  2V7K A;  4UEL A;  2ACZ A;  2I6H A;  5LJN A;  2Y48 B;  2G0U A;  4GKK T;  1NEK A;  1MMG A;  5HXS A;  2J4G A;  2EHO B;  2BS3 A;  3RGL A;  4EAH A;  2XYS A;  3AE9 A;  5BRX A;  3K3Q C;  1CUN A;  4L0R A;  5ABE A;  1D1A A;  1XNR T;  3B13 A;  1S94 A;  3N2G E;  3PJA A;  2Y54 A;  4IDP A;  2XM2 A;  2NP9 A;  4HWF A;  2LKH A;  2YDQ A;  2LSK A;  2NTY A;  2VUR A;  3UQ7 A;  1ZV4 X;  1YQ3 A;  5LCY A;  2X0Y A;  3AE5 A;  3BQL A;  2AE9 A;  1IBL T;  4CN4 A;  4OX9 T;  2BDE A;  3PEO A;  5JRC B;  2BYR A;  2MBG A;  1IBK T;  3W15 B;  1XWM A;  4OYK A;  2VVS A;  4X66 T;  4MBQ A;  4Z8X A;  3J9X 1;  3A7M A;  3EAB A;  4ZXL A;  3E0Z A;  4AQY T;  3SIO A;  2Q9Q C;  3UUX B;  5AQJ B;  4QAB A;  1D0Z A;  4IDQ A;  1Z8U A;  5FL1 A;  2W67 A;  2YN6 A;  4I55 E;  2YDR A;  3F31 A;  3AAI A;  5JDQ A;  2UXD T;  3C4Z A;  3AAE B;  4U72 A;  4CXW A;  3NVO A;  2WZI A;  3AED A;  5TAO A;  3I0O A;  3K1S A;  2PH9 A;  3LBX A;  1I6Z A;  3WTI A;  1KNR A;  2I59 A;  3QB5 A;  4ZJT A;  5JQG E;  2CWO A;  1O3X A;  2EHO A;  2ES0 A;  3Q2M A;  2XSB A;  5JRE A;  2ACX A;  4MHC A;  3C50 A;  3C98 B;  4YJ2 E;  3K3O A;  3IA3 A;  5M4Y A;  3I0Q A;  2E9X A;  3JAF A;  1OED B;  4EEB A;  4PJL A;  3NWI A;  5BP0 A;  1UX2 A;  4ZI2 C;  3M3Z B;  4E7Z A;  3E08 A;  1U4Q A;  4ZZC A;  3IGQ A;  5AFM A;  4CQI A;  4PAG A;  5AFK A;  5L3C B;  1SUM B;  3FZL B;  1KNZ A;  5AFN A;  2V5D A;  1KEY A;  2FUP A;  3UUB A;  4HFE A;  2JQQ A;  2X9H A;  4DMV A;  2LT3 A;  2L9Q A;  3C51 A;  5JR9 C;  4EGW A;  2WWV A;  4DR7 T;  2PTF A;  3R6N A;  2H88 A;  4YFS A;  5F5W A;  4JEU B;  4A56 A;  5LBM A;  4EIW A;  1DU2 A;  2DL1 A;  2KWI B;  4BQT A;  3AA6 B;  2V7L A;  4AQG A;  1XMQ T;  2DWG A;  3JC6 D;  4ZRU A;  3LK2 B;  5L3E B;  5FVL A;  2QVA A;  1NWM X;  2H7O A;  2BYS A;  3Q5W A;  4EZ1 A;  3RKG A;  4WNK A;  4EZH A;  4O4H E;  5CA1 E;  2WM9 A;  4KMC A;  4YLH A;  2AXD S;  2ZM2 A;  2DWK A;  4ISS A;  3OVU A;  3CML A;  4KHZ F;  1ZOY A;  4U31 A;  2LSJ A;  4AFH A;  1W9R A;  1UV6 A;  2A72 A;  2KND A;  2BKO A;  4YSZ A;  4QH1 A;  3X1D A;  3VR8 A;  3HKB E;  5HEJ A;  1YXR A;  4IDZ A;  3NZP A;  2UXC T;  4P0B A;  2CLY C;  1UX4 A;  4HFD A;  3WTK A;  1HF8 A;  4LF8 T;  2XQ8 A;  4O2A E;  2BYQ A;  3SOL A;  2J1D G;  2WS3 A;  1J5W A;  1M62 A;  4JBW F;  4WV9 A;  2ZJU A;  1SA0 E;  2X00 D;  1N34 T;  2QYW A;  3KFW X;  2Y7Y A;  5DQW A;  2DHR A;  2VWA A;  4MAL A;  4QX7 B;  2BG9 E;  3ETU A;  4TN7 B;  3ONJ A;  4GIW A;  2NWB A;  2V7M A;  3ZYL A;  4A97 A;  3PUX F;  4TWH A;  2BS2 A;  4QH4 A;  1E2A A;  3V5S A;  3PJA J;  1HFA A;  2LSY A;  2QA7 A;  3LG7 A;  2VQF T;  2WCA A;  3AEC A;  4QAA A;  1UCU A;  1Z0P A;  4C91 A;  2E5V A;  3UU4 A;  4JI5 T;  2CWY A;  2XAS B;  4FRR A;  4P1N A;  1SE7 A;  2SPC A;  3ESL A;  2YMD A;  1XMO T;  4N78 D;  1X79 A;  3U8N A;  3P4P A;  2XM1 A;  3L39 A;  1D0Y A;  4PK4 A;  5AQK B;  4HQP A;  2XQ7 A;  3LSV A;  4V1A v;  3U8M A;  5J5H A;  5HXC A;  3VU7 H;  3P4S A;  3P4W A;  2YK0 A;  3U8L A;  1NAF A;  3PUY F;  5L2L A;  4O2B E;  4ALX A;  2WNL A;  4QHO A;  1ZEE A;  4YY3 T;  2H7V C;  1WYC A;  3N5L A;  5C3J A;  3U8J A;  2UXB T;  3SS1 A;  3AVR A;  4AIS A;  2W0G A;  4YHJ A;  3N9M A;  3CIR A;  2LLY A;  2WNC A;  2CBI A;  2V7I A;  5L3D B;  2FBW A;  3WTN A;  4ZI2 D;  2WAU A;  4MFR A;  2FJE A;  2XQA A;  2YEV C;  3GWH A;  4EB6 E;  1WR6 A;  1UK5 A;  3DTO A;  4NUU A;  2K3W A;  3KIN B;  1MIW A;  5EK2 A;  2BBJ A;  5LNK A;  2E9X D;  3OYZ A;  2V7J A;  4NUV A;  4H63 V;  4IE0 A;  2D5U A;  4AKH A;  3UT5 E;  4TZ4 C;  2D0U A;  4OHF A;  4UF0 B;  3RHW A;  3FXE B;  4HWD A;  4CXY A;  2XAF B;  4XHE A;  3HI2 A;  5LP6 E;  3IBP A;  2YU2 A;  5FNV E;  3WAJ A;  2CM0 A;  3OBV E;  4YTN A;  3RC3 A;  1HNX T;  2XQY A;  2WSS V;  3ZJ2 A;  4ANJ A;  2XQ9 A;  2XZE A;  3UU6 A;  4LF4 T;  2GK9 A;  3JAD A;  1UGO A;  4DND A;  3AE7 A;  4DR1 T;  3PU3 A;  3RX6 A;  4JI3 T;  3M65 A;  1XDO A;  4IT4 A;  1J5E T;  4AI6 A;  3TLU A;  4ZJS A;  2LM9 A;  3AE2 A;  4X5T A;  2LE8 A;  4DMW A;  2LKG A;  5AQI B;  2KSR A;  4DUY T;  3VKH A;  5JR9 A;  4XBF B;  4PFO A;  4JI6 T;  1MMD A;  3EUH A;  4HKA A;  3ZYK A;  1OED E;  4DV0 T;  4TNW A;  1Y64 B;  2Y56 A;  4JI2 T;  5HCJ A;  3IEE A;  3RQU A;  1KF6 A;  1G8X A;  2IML A;  4A5X A;  3Q5X A;  5AFL A;  4ZI3 D;  2R6G F;  3U3I A;  4UXN B;  3CKD A;  2BS4 A;  1LKX A;  3J7Y q; 
#chains in the Genus database with same CATH homology
 2BG9 B;  2XNU A;  3PMZ A;  2WNJ A;  3UU5 A;  4UM1 A;  4XK9 A;  4BQT A;  5J5I A;  2PGZ A;  4A97 A;  2Y57 A;  5AFJ A;  4IRE A;  4TWH A;  4NZB A;  4B5D A;  4QH4 A;  3TLS A;  5TVC A;  5L4H A;  4ZRU A;  4UM3 S;  4ZZB A;  4QAA A;  2BYS A;  4EZ1 A;  4ILB A;  4TWF A;  2BR7 A;  4AFG A;  5L47 A;  3U8K A;  3RHW A;  4HFC A;  3EHZ A;  5J0Z A;  4LMK A;  2PH9 A;  3SQ9 A;  5AFM B;  4XHE A;  3UU3 A;  3UU4 A;  3RI5 A;  2VL0 A;  5HEU A;  2XZ5 A;  3WTI A;  3C84 A;  4FRR A;  4TWD A;  4UM3 P;  2XNT A;  5SYO A;  4ZJT A;  3ZKR A;  5IUX A;  2XYS A;  5AIN A;  2XYT A;  4TNV A;  2YMD A;  1OED C;  4QAC A;  2XNV A;  4IL9 A;  3U8N A;  3JAE A;  5BRX A;  5LXB A;  2M6B A;  5HCM A;  4QH5 A;  3TLW A;  4COF A;  2XQ9 A;  3UU6 A;  3UU8 A;  2ZJV A;  4HFH A;  2XQ7 A;  2XQ5 A;  3JAD A;  3TLT A;  4HQP A;  3LSV A;  4ZK1 A;  3U8M A;  5J5H A;  2Y54 A;  4AFH A;  2LM2 A;  2XZ6 A;  4UXU A;  3JAF A;  2BYN A;  3P4W A;  1UV6 A;  3WTL A;  4D01 A;  2XQ6 A;  4HFB A;  1OED B;  4Z90 A;  4QH1 A;  5FJV A;  3RIA A;  3C79 A;  2M6I A;  3ZDH A;  5JME A;  4NPP A;  3U8L A;  3RQW A;  4ILA A;  2LKH A;  3GUA A;  5BP0 A;  3WTM A;  1UW6 A;  4HFI A;  4Z91 A;  3TLU A;  4ZJS A;  1UX2 A;  5L4E A;  4X5T A;  5HEH A;  4AFT A;  4ALX A;  2QC1 B;  2LKG A;  2XQ4 A;  2WNL A;  3WTO A;  4IL4 A;  5HEJ A;  2KSR A;  3T4M A;  4F8H A;  3U8J A;  2BG9 C;  3P50 A;  3UQ7 A;  2UZ6 A;  3TLV A;  5J5G A;  4UM3 A;  4ZZC A;  1I9B A;  3IGQ A;  5CO5 A;  5AFM A;  2YKS A;  5HEO A;  5KE4 A;  2WN9 A;  1OED E;  2BG9 A;  3PEO A;  2YME A;  2W8G A;  4HFD A;  4TNW A;  3WTK A;  4BFQ A;  5AFK A;  2BYR A;  4A98 A;  2LLY A;  2WNC A;  2XQ8 A;  3SH1 A;  2Y56 A;  5KZU A;  3EI0 A;  3WTN A;  5AFN A;  2XQ3 A;  4ZR6 A;  5HCJ A;  4PIR A;  3RQU A;  4DBM A;  5HEG A;  3UUB A;  2BYQ A;  2W8F A;  2WZY A;  3WTH A;  2YOE A;  2Y58 A;  3SQ6 A;  2XQA A;  4ZK4 A;  4HFE A;  5CFB A;  5AFL A;  4WV9 A;  3RIF A;  2ZJU A;  5BW2 A;  2MAW A;  4LML A;  4UY2 A;  2X00 D;  2Y7Y A;  4LMJ A;  3EAM A;  2BR8 A;  2BYP A;  3SIO A;  2X00 A;  5J5F A;  5LG3 A;  5AFH A;  2BJ0 A;  3WIP A;  4QAB A;  3WTJ A;  1OED A;  2C9T A;  2BG9 E;  4ILC A;  3UQ4 A;  3ZDG A;  2YN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...