4NPPA

The glic-his10 wild-type structure in equilibrium between the open and locally-closed (lc) forms
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Crystal structures of a pentameric ligand-gated ion channel provide a mechanism for activation.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4nppA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4nppA01
4EZ1A 3U8JA 2LM2A 4HFEA 4DBMA 1OEDB 4AFHA 5AINA 5TVCA 2XYSA 2MAWA 4LMLA 2BYRA 3U8KA 3RQWA 2BYQA 2LKGA 2BJ0A 3UU3A 5KE4A 2BYPA 4BQTA 3ZDGA 2BG9A 5HEHA 5SYOA 4LMJA 3SQ9A 4B5DA 2XQ3A 1UV6A 4ZJSA 3UU8A 5JMEA 2ZJVA 4IL4A 3TLSA 3GUAA 4QAAA 2XQ5A 2BYNA 3PMZA 2YKSA 3TLUA 3JAEA 3UUBA 2XQAA 2W8GA 3ZDHA 2BYSA 1OEDE 2PH9A 4FRRA 3P4WA 2BG9B 2LKHA 4Z91A 2YMDA 4XHEA 2BR7A 5CO5A 3EHZA 5LXBA 5AFMA 3U8LA 3JAFA 4HFIA 5BW2A 2VL0A 4WV9A 5AFJA 2PGZA 3SQ6A 2XNVA 5HEUA 3T4MA 4ZK4A 5KZUA 4QH5A 1I9BA 4ZZCA 2LLYA 3UU6A 5CFBA 5J5GA 5BRXA 2WNLA 4ZRUA 3LSVA 3P50A 3UU5A 4ILBA 2WN9A 2WNCA 3ZKRA 5AFMB 2YMEA 3U8MA 4A98A 4UM1A 3UQ4A 4QABA 4UM3A 3IGQA 2XQ8A 3WIPA 2WNJA 3JADA 3WTKA 2BG9E 4A97A 1UX2A 3WTIA 2XQ9A 4COFA 5AFNA 4HFCA 2UZ6A 4ALXA 3RIAA 4ILCA 5FJVA 3C84A 4UM3P 4PIRA 5HCJA 2Y7YA 4QACA 2XNUA 3WTOA 3UQ7A 4BFQA 2YN6A 4ILAA 1UW6A 2KSRA 4UM3S 5AFLA 4QH1A 4TWDA 2XQ7A 4HFHA 2XZ6A 5HEOA 5L47A 4ZJTA 3SIOA 3U8NA 2Y58A 3SH1A 4IL9A 4ZK1A 4LMKA 3RIFA 2QC1B 3WTLA 5HEGA 2WZYA 3TLTA 1OEDC 2XQ4A 5HCMA 4IREA 4Z90A 3RQUA 5LG3A 2ZJUA 4HQPA 3WTNA 5L4EA 4UXUA 2M6BA 3RHWA 3C79A 2C9TA 2X00D 4NZBA 3WTJA 3RI5A 5AFKA 2M6IA 5IUXA 2Y57A 4NPPA 3EAMA 4TNVA 5BP0A 4HFBA 5J5IA 5J5HA 2Y54A 2X00A 2XNTA 2XZ5A 4TNWA 4AFGA 1OEDA 4F8HA 3UU4A 2YOEA 4TWHA 4XK9A 3WTMA 2XQ6A 4ZR6A 3TLWA 4D01A 3WTHA 5J0ZA 5AFHA 3PEOA 5HEJA 4QH4A 3TLVA 4ZZBA 5J5FA 2Y56A 2XYTA 2BG9C 4HFDA 5L4HA 2BR8A 2W8FA 4AFTA 4UY2A 3EI0A 4TWFA 4X5TA
chains in the Genus database with same CATH superfamily
3U8JA 4DBMA 1OEDB 4IHJE 4QX8B 3RIUA 3KBUA 3FZKB 2W63A 3UU3A 4UVAB 2BYPA 4EYYR 4FI5A 4PNIA 1N32T 3GUAA 3P4SA 2CXFA 3ABVA 2R6GF 2BKNA 4KHZF 4DV4T 4DVDA 1T72A 4IT4A 3N2KE 5AFUL 3BQLA 4ERRA 1HG5A 2K5BB 2LOSA 3ZC0A 5KX5E 4ASKA 5H6RB 4UM3A 3IGQA 2CWOA 2YINA 2WDVA 2LOPA 3ETUA 4H9RC 1X9BA 4HFCA 3WTOA 2CHNA 1XMQT 2ES0A 2KSRA 2ODVA 3AEAA 4QH1A 2WZIA 1GQEA 3AE5A 3RGLA 2BS4A 4QXCB 5F8PA 1J5ET 1U4QA 3T8OA 2EHOA 3SFEA 3R6NA 3H3AA 2Y54A 3N9PA 3LJCA 5LGNB 2KZ7B 4V1Av 2KNDA 2X68A 1LKXA 2CXLA 2SPCA 5JR9B 3L39A 1KNZA 5FXZA 2RP4A 1UUSA 3FXDB 3RRWA 3O1JA 2MAWA 3PU8A 4A5XA 2LHRA 5HXCA 4EZHA 2DLRA 4BQTA 3SQ9A 3ONJA 3UU8A 1V9DA 3TLSA 3NVOA 4UV8B 3I1AA 3EHZA 5AQVB 1YQ4A 5EK2A 4ZI2C 4MHCA 1MMGA 4JI7T 4IE5A 2X0HA 3ONLC 4ZZCA 4ZI2D 5FY1A 4HGAA 1BR1A 5KXJA 5LJMA 4O2BE 2JQQA 1HNWT 4JEHB 3C51A 4Q25A 2CLYB 4QWNB 2ZM2A 3OVUA 4PIRA 5LP6E 4JI1T 3LDQB 3VKGA 1WFDA 2A2FX 3FHNA 3U8NA 4HWCA 4JEUB 4EXTA 3HKBE 3WTNA 1W09A 3KV6A 4B3MT 3HKDE 4NZBA 2XPKA 3IBPA 5J5IA 1HNXT 3UUNA 5FY7A 5ABEA 3WTMA 2C5JA 2MBGA 5AFHA 3FBLA 4KX6A 2C0SA 2CM0A 3FXEB 5AQSB 1Y01A 3QOFA 5TVCA 4KHPT 4EEBA 2VKHA 4E7ZA 4B3RT 5SYOA 4TV9E 3O1HA 2FUPA 4IL4A 4QAAA 1N34T 3C98B 2VVSA 2PH9A 1FIOA 1W9RA 1HR0T 2KXPB 3A8YC 3CIRA 2PG8A 5L2LA 1T8BA 2WY2A 4NIQA 2DWKA 3B13A 1IBKT 1MNDA 2V1DB 3LSVA 3RC3A 1I6ZA 5AQUB 2WZHA 2Y48B 3OBVE 5AFMB 4A98A 3RKOA 3JC6C 3RC8A 3OYXA 2W0GA 2BG9E 2XTLA 1JNRA 4YFSA 4DR3T 5FVKA 1XZYA 1UX4A 2E9XC 3JC6D 2XAGB 4U72A 2BS3A 2XUEA 1CHUA 1ZV4X 4EEDA 4ZI3C 4UM3S 5BR8T 2E9XD 3FZLB 5J2UE 5HEOA 2LSGA 2ZM6T 4ZK1A 4ZI3D 3AVSA 4JV5T 4GIWA 5AQGB 2X00D 2E5VA 2V7LA 4KMCA 5IUXA 5L3FB 1BR2A 4X66T 3KVAA 2UUAT 3AE9A 3A7MA 5DQWA 2WWUA 4IDNA 2L9QA 2Q9QB 4ZOLE 2JJ9A 1MIWA 2V7MA 4HFEA 1SE7A 4TX5A 4EV6A 3ZEFB 4LF6T 5JREA 5LGTB 2LKGA 2IIUA 2A9UA 4JI8T 3AAAB 4EZ4A 2B1EA 2JQHA 1SHZC 3AXJA 4DV1T 2LE8A 1OEDE 2YMDA 4UR9A 3CX6B 2VL0A 2UU9T 1XMOT 3LK42 5LOVE 4DR1T 4ILBA 2ZLYA 4DR6T 4X62T 4NXMT 2BBJA 4DBQA 1WR6A 1BR4A 4CN4A 4NXNT 5LXTE 3AEBA 1UW6A 4U31A 5AQLB 5L47A 4BA9A 1NAFA 3OYZA 2G0UA 3UTKA 4X20E 2D0UA 4ZEYA 4X1YE 4PAGA 4CXXA 3N9NA 5AFKA 2K24A 3T1HT 3EAMA 3KV4A 5LMNT 1WRDA 3R84B 3V5SA 4TNWA 4TWHA 2V6YB 4DV5T 4I43B 2V5CA 1LVFA 5AQRB 2I0MA 1QUUA 3UULA 3EUHA 3RQWA 5BMVE 4DV0T 3M65A 4ZHQE 4I4TE 4YJ2E 4YT0A 3ZDGA 1VRBA 5JMEA 2XASB 3ANWA 2WB5A 3C64A 5JDHA 2HH7A 3CPZA 3ZLIA 3AE7A 4PK6A 2Z6EA 3ZN1B 1FEWA 4UXNB 2X9WA 3PUXF 4HTEA 4AQGA 3P4PA 3N9LA 4HWHA 3AE8A 4TV8E 3AE4A 2W67A 3UU5A 1MMDA 3ZPOA 2ZM8A 1ZP0A 1KNRA 2VKOA 3SS1A 2CPTA 4LF8T 4A97A 1S94A 2V6XA 2WBLA 1IAPA 3AA0B 2CCQA 3PUZF 1H7CA 3PUVF 2YU2A 3M3ZB 2Y7YA 2BVLA 2YN6A 1LVKA 4DR2T 3VU7H 4HFHA 4U2ZA 4EOZB 3LFMA 2QGSA 3RIFA 2D2SA 1BR0A 3IF8B 3DTOA 4F6RC 2C9TA 2NW8A 2M6IA 2L8KA 1UX5A 3PV0F 2X00A 4JI0T 1NEKA 4YTPA 3TLWA 2X51A 1KF6A 2EHOB 4H9NC 4QXHB 4H63H 1X79A 4G63A 3EI0A 2OLTA 4BJNA 1D0ZA 4QKNA 2V6YA 2BYRA 5FY0A 3SWHA 1UV6A 5JH7E 4MBQA 4WBNE 3ZSTA 4OK0A 2IAKA 2YK0A 3K8PC 2X0LB 4JUYA 4CI2B 3C4XA 3JAFA 2WMOA 4YY3T 3SFDA 4EB6E 4YSXA 5FP3A 5C8YE 1WR0A 5C2TA 3QC9A 5CFBA 5F5WA 1M62A 4EAHA 3IHRA 4ILUA 4HE8A 3PURA 3QB5K 3RLFF 4FJOA 4WBOA 2IC9A 3FBZA 3WI3A 4K0KT 4CN6A 3UQ7A 5CJ5A 3ZMZB 2X9XA 3PUQA 5FNVE 4IL9A 3W15B 2WZYA 5HWYA 4N78D 3I0QA 1S35A 2HPJA 3P7IA 5DABA 3N9QA 1W0BA 3QNUA 5ABGA 3QUJA 4GKJT 1J5WA 3DJBA 3CK6A 3NBXX 5HYAA 2VASA 3ETVA 5J5FA 5L4HA 5IYZE 3B5MA 2CRBA 4PJLA 4CI3B 2MYSA 2D9DA 2V7KA 4HWFA 4LMJA 4UF0A 2MOZA 1D0XA 5FXWA 2XQ5A 2BYNA 4DUZT 2XQAA 2CMRA 2WAUA 3PJAA 2H7OA 3K3NA 4GOUA 2XHEB 1N33T 5KZUA 1Y64B 2LSKA 3P50A 4AIUA 2WN9A 3ZKRA 4J2CA 2V26A 4UM1A 2V7IA 3HKCE 3P8CD 3Q9DA 2UUCT 4AXPA 4ALXA 3ZMSB 4LF9T 4GKKT 4HFVA 2PJQA 3EVYA 1YKHB 4HEAA 3CMLA 5ETWA 2RPAA 2XAJB 1HF8A 3SH1A 1XNQT 5JDNA 4IREA 2VVNA 3FZHB 4KI0F 3OKQA 2IC6A 3NRYA 5LHIB 4L5GA 3L3PA 5HWXA 4ANJA 4DV7T 4IDPA 5L3BB 3PEOA 4UVCB 3PUYF 2CBIA 2LHNA 3GWHA 3DP7A 3RKGA 3NWIA 2X67A 1E7PA 1VCTA 3KDSE 5LA6E 3C50A 5FKYA 4U74A 2WS3A 3ZJ2A 2W4XA 3VHLA 2X0YA 2LEHA 2WDQA 3TLUA 2DI4A 3P4WA 2A3DA 5CO5A 1KFYA 4HFIA 2CWYA 4CXWA 1HCIA 3I9WA 3ZN0B 4O4LE 2WDRA 3H37A 4AI6A 3AXJB 2VQET 4YLHA 3MJXA 2FJBA 1UGOA 3NKZA 4AKGA 2H88A 4YTMA 3WIPA 5FYMA 3CWZB 3PJAJ 5KDMC 5JVDE 4X64T 5LGUB 3ZT7A 4ILCA 2MTQA 2WP9A 2KWHA 1AJ3A 1FMVA 5GONE 4WNKA 4JLEA 2JQKA 3TLTA 4OHFA 2K3WA 5KMGP 2ZJUA 3GN5A 1YW0A 3G06A 2NW7A 3RHWA 3WAJA 3HA4A 2H89A 3NRXA 3C4ZA 4IE6A 4DR5T 4XK9A 2XQ6A 2CBJA 3EABA 5C3JA 4D01A 3TLVA 4ZZBA 2W8FA 2QYWA 2LM2A 4NUVA 1YXRA 4AQFC 3BK9A 4I0UA 3CX7B 3KV9A 4IDQA 4EIWA 4ZJSA 4UEMA 5AQNB 2UXXB 2VKDA 2N2NA 2PTFA 4X65T 2W8GA 3RYHE 5ABFA 1CUNA 5H6QB 4U33A 3AE3A 4UV9B 2W2UA 3ANWB 3CX8B 2JRKA 4PW8A 2WQYA 3O9XA 1L0VA 4ZK4A 4QH5A 1ZOYA 4E7SA 4AISA 1HFAA 4P0BA 4XBFB 3NZPA 3NZQA 4OYJA 2YMEA 2WNJA 1UCUA 2XQ9A 4GYRA 1M7KA 2B76A 5AQIB 3RIAA 2M67A 4JI2T 3KINB 3IA3A 3Q5EA 4JI3T 1US7B 2Y58A 5LHGB 3VKHA 3ZT5A 4TN7B 5FXVA 4UXUA 5FMNA 1HS7A 3RYIE 1OXZA 1NENA 4EGWA 3PUSA 5J5HA 2E9XB 4TUYE 5LCYA 4AFGA 1Z0PA 4PK5A 3UU4A 3S4UA 5AQOB 4IE0A 5JDMA 2CE7A 4QX7B 4B6XA 2BG9C 2XYTA 2IW5B 4P0AA 2HHHT 5M4YA 1D1AA 2JMKA 3UFEA 2E5LT 1IBLT 3ONXA 4BJMA 5HXEA 3UUMA 5LHHB 1OWAA 2BKOA 2XQ3A 2FJDA 2JPFA 2ZJVA 4X1KE 3K3QC 2ZMAA 4GK0E 4P09A 4Z91A 4WW0A 3RRCA 3LBXA 2PGZA 3SRZA 4CN1A 2D0TA 3T4MA 2HN2A 3RYCE 3EDUA 2WMNA 5IWAT 1ZHCA 3I9YA 1WYCA 2WNCA 2VL8A 5EK3A 2X66A 2KMFA 2NOXA 5A1LA 3AB3B 3D0TA 3KVBA 5CA0E 2ACXA 3C84A 2E8IA 5HCJA 2NR4A 4L9IA 3RX6A 3WAKA 5AFLA 4PJMA 2XZ6A 4OYKA 1VOMA 3PUGA 2N9DA 2QC1B 1OEDC 2LT3A 1FMWA 4B3ST 3EDVA 3C79A 3KFWX 3A5XA 2QRXA 2VK9A 4QXBB 3MZKB 2NW9A 5AQKB 4DBRA 4XAXB 2XNTA 4PFPA 2XSAA 2XM1A 5LJNA 3JCFA 1HX1B 5J2TE 3WTHA 4IGUA 3AE6A 4KUMB 2YDQA 2IDOB 5AQQB 2E9XA 4X5TA 3N5LA 3UFGA 2WCAA 2W00A 1YD8G 4ADZA 1ZEEA 2N1GA 4O2AE 4EYUA 3ZMVB 3N2GE 2QVAA 3AA6B 3TKLB 3ZCIA 4O4JE 4AKHA 3U3IA 3AE1A 3N2OA 1E2AA 2C5IT 1EZ3A 2AXDS 4IIJE 4CZZB 3ZDHA 2BR7A 5AQMB 4UF0B 2J1DG 2CEAA 5DQVA 2VKJA 4AKRB 1D1CA 2XAFB 5EK4A 3UU6A 2PBIA 2DWGA 2GK9A 3AEGA 3ZYMA 5L3GB 3WTIA 5L3EB 3MACA 2IMLA 3ESLA 3OTOT 2WU5A 4CQIA 4QACA 1XNRT 3ZCJA 5HAXA 2XM2A 2WM9A 5JR9C 2K9AA 3MK7C 5ABHA 2I59A 2ACZA 2XQ4A 3HR0A 5LG3A 1MNEA 2BVMA 2V7JA 4HQPA 4AQYT 5L3DB 2M6BA 1LRZA 5JDFA 5BP0A 3AEEA 4ZXLA 4F8HA 4JYAT 2YOEA 1DU2A 2H3RA 2LSYA 3ZMTB 1B7TA 1XDOA 4JI4T 1QLBA 3E0ZA 1XDPA 3PE0A 2HPLA 4C91A 4AFHA 4DR7T 1KEYA 2BYQA 4LFBT 2BJ0A 4JBWF 3J9X1 3BQIA 5JRCA 2BG9A 4NUUA 3J7Yq 3FB2A 3AAIA 4MALA 5JDQA 2DNXA 1R8IA 2IHR1 1I94T 2CLYC 4LF4T 4FRRA 3AEDA 2VWAA 5LXBA 5BW2A 4WV9A 2OV9A 5HEUA 3Q2MA 5HXSA 5J5GA 4LF7T 3AAEB 2D5UA 1E1HB 4YHHT 3HL6A 1UX2A 1G8XA 2CA5A 5FVLA 3FZFB 3QK6A 3CKDA 2MPKA 2W62A 3KV5A 3VR9A 3PTRB 4K0UA 2J4GA 1KK7A 4BFQA 2LSJA 2BKPA 1WCRA 2XQ7A 2UUBT 1Z8UA 5J1GA 1W0AA 4YTNA 3RQUA 4U3CA 4P1NA 3U78A 1D0YA 1HG2A 1IBMT 2Y57A 5CB4E 4DR4T 3GN5B 1OEDA 4IE4A 3PUWF 2RA1A 5HEJA 5TAOA 2BR8A 3RPUA 4ZS3A 4MLKA 5AINA 2P9BA 4QHOA 1IJ5A 2DHRA 4HN9A 4I50E 4IDZA 4H9PC 5KE4A 2C5KT 4ISSA 4WYVA 2X9HA 3ZYKA 1T7SA 4CI1B 1MIYA 3JAEA 3UUBA 4UIGA 2BYSA 4DV2T 1ZKEA 4H63V 3U8LA 1O3XA 2HN1A 3PDYA 4GYSA 5IHYA 2IUBA 5F3JA 5BRXA 5ABFB 2WNLA 5CA1E 3F57A 4DO0A 3UUXB 4DNDA 2DL1A 5AQPB 3UQ4A 2BZBA 1MMNA 4GK5E 4KBMB 4COFA 5AFNA 1WLXA 3B57A 4UM3P 1J1JA 4LFAT 3RH3A 3OJAA 2VB6A 1QSDA 4ZJTA 2Q9QC 1JNZA 2KT9A 5HEGA 2NP9A 3K3OA 5FXXA 2OA5A 5LBQB 1HX8A 4JI6T 3CVRA 2Q9QD 3ZSSA 4XZCA 5ADXL 2KLQA 5JR9A 4TNVA 2KWIB 2UXCT 5JQGE 1UURA 3AA7B 4AKLA 4A56A 4ZR6A 4OFZA 4DV3T 4WZXA 1HTJF 4QH4A 4OX9T 5AQFB 1XWMA 2PFVA 3PU3A 2XYSA 2H7VC 4H9OC 3HI2A 4PJJA 1D1BA 1YQ3A 3LG7A 2XQYA 4DV6T 5HEHA 3AECA 4B5DA 5L3CB 2DCFA 4O8SA 2WWVA 2YKSA 3P4RA 5HXRA 2CHOA 5LYJE 3O4XE 2BBHA 2QA7A 3BQKA 2XNVA 5HXHA 5FL0A 1I9BA 4ZRUA 4HWIB 4UVBB 5LNKA 3MA9A 3QB5A 3LBXB 2XZEA 2J62A 3JADA 2K48A 2XSBA 5LMUT 2AE9A 2XAHB 2UZ6A 2LRLA 3FZMB 4AKIA 2WU2A 3C4WA 3T1YT 3HKEE 2XNUA 3VRAA 3CQGB 4X1IE 2YDRA 4CXYA 3N9MA 3F31A 2UXNB 4PK4A 2FBWA 4Z90A 2JIWA 1VCSA 3VRBA 5L4EA 4IE7A 4H9SE 1FJGT 3RI5A 5JDLA 3Q5WA 5LB7B 3RIUC 4U7YA 5J0ZA 2JQ9A 4AFTA 5LBMA 1HNZT 4YSYA 4KP3C 1KNPA 4H9QC 4TWFA 3AEFA 4EZ1A 1IJ6A 2VQFT 4Z8XA 3RF1A 2UXDT 2YU1A 3N9OA 4DMWA 5CGMA 2ODUA 3IEEA 3SOLA 3I0OA 5AQJB 3PMZA 5FL1A 5AFMA 4IDOA 2J47A 4ZI7E 1NWMX 3PUAA 2VURA 3MKDA 2LRKA 4U2YA 2LLYA 3P4QA 2BDEA 2L3LA 2A72A 4JI5T 1IZNB 4QABA 4PJNA 1YKEB 4C90A 1U5PA 2LSIA 4ISTA 5EZYE 4YHJA 2FJEA 5FJVA 4YSZA 3VR8A 5JDGA 3KBTA 5LG4A 2EHOC 4TWDA 4LFCT 3WTLA 5HCMA 2XY8B 1UK5A 2EHOD 5JTGA 4MFRA 3UT5E 3WTJA 1MIVA 4O4HE 4DIDB 2NWBA 2Q9QA 3L8RA 2XZ5A 2XAQB 2W61A 3K1SA 3OPCA 4DMVA 3X1DA 1WYBA 2Y56A 3V5UA 2NTYA 3ZC1A 4LMLA 1N36T 2NTXA 3U8KA 3CQCB 3LK2B 4BAYB 2W66A 5E0OA 3Q5DA 3E08A 3E22E 2V8SV 5JRCB 2BG9B 2LKHA 4XHEA 2KINB 4YJ3E 2E2AA 5AQHB 1T98A 2BS2A 5AFJA 3CQXC 3SQ6A 1SUMB 3AA1B 3O1IA 2FJAA 4M1PA 3AVRA 2LM9A 1SA0E 3U8MA 2LJLA 4HWDA 2I6HA 2XQ8A 4L0RA 3WTKA 4YXDA 3F2EA 3GA8A 5AQTB 3RYFE 4AQFA 2YEVC 2ZM0A 2CXDA 2WSSV 3ZMUB 3H3MA 4G2AA 2X9YA 2Y8DA 3LK3B 4U7IA 3GMIA 3L09A 4DUYT 4ILAA 2XJ7A 2YDSA 2V5DA 4O4IE 3SIOA 1G73A 2F4VT 4LMKA 2Y6XA 4UELA 1MMAA 2JMHA 4TZ4C 4PFOA 4HKAA 3ZT6A 4ZS2A 3AE2A 4I55E 4NPPA 5DJQC 4HFBA 2UXBT 4B3TT 3ZYLA 3MXZA 3ZJ1A 4HFDA 4LF5T 4UY2A 3Q5XA
chains in the Genus database with same CATH topology
4EZ1A 3U8JA 2LM2A 4HFEA 4DBMA 1OEDB 4AFHA 5AINA 5TVCA 2XYSA 2MAWA 4LMLA 2BYRA 3U8KA 3RQWA 2BYQA 2LKGA 2BJ0A 3UU3A 5KE4A 2BYPA 4BQTA 3ZDGA 2BG9A 5HEHA 5SYOA 4LMJA 3SQ9A 4B5DA 2XQ3A 1UV6A 4ZJSA 3UU8A 5JMEA 2ZJVA 4IL4A 3TLSA 3GUAA 4QAAA 2XQ5A 2BYNA 3PMZA 2YKSA 3TLUA 3JAEA 3UUBA 2XQAA 2W8GA 3ZDHA 2BYSA 1OEDE 2PH9A 4FRRA 3P4WA 2BG9B 2LKHA 4Z91A 2YMDA 4XHEA 2BR7A 5CO5A 3EHZA 5LXBA 5AFMA 3U8LA 3JAFA 4HFIA 5BW2A 2VL0A 4WV9A 5AFJA 2PGZA 3SQ6A 2XNVA 5HEUA 3T4MA 4ZK4A 5KZUA 4QH5A 1I9BA 4ZZCA 2LLYA 3UU6A 5CFBA 5J5GA 5BRXA 2WNLA 4ZRUA 3LSVA 3P50A 3UU5A 4ILBA 2WN9A 2WNCA 3ZKRA 5AFMB 2YMEA 3U8MA 4A98A 4UM1A 3UQ4A 4QABA 4UM3A 3IGQA 2XQ8A 3WIPA 2WNJA 3JADA 3WTKA 2BG9E 4A97A 1UX2A 3WTIA 2XQ9A 4COFA 5AFNA 4HFCA 2UZ6A 4ALXA 3RIAA 4ILCA 5FJVA 3C84A 4UM3P 4PIRA 5HCJA 2Y7YA 4QACA 2XNUA 3WTOA 3UQ7A 4BFQA 2YN6A 4ILAA 1UW6A 2KSRA 4UM3S 5AFLA 4QH1A 4TWDA 2XQ7A 4HFHA 2XZ6A 5HEOA 5L47A 4ZJTA 3SIOA 3U8NA 2Y58A 3SH1A 4IL9A 4ZK1A 4LMKA 3RIFA 2QC1B 3WTLA 5HEGA 2WZYA 3TLTA 1OEDC 2XQ4A 5HCMA 4IREA 4Z90A 3RQUA 5LG3A 2ZJUA 4HQPA 3WTNA 5L4EA 4UXUA 2M6BA 3RHWA 3C79A 2C9TA 2X00D 4NZBA 3WTJA 3RI5A 5AFKA 2M6IA 5IUXA 2Y57A 4NPPA 3EAMA 4TNVA 5BP0A 4HFBA 5J5IA 5J5HA 2Y54A 2X00A 2XNTA 2XZ5A 4TNWA 4AFGA 1OEDA 4F8HA 3UU4A 2YOEA 4TWHA 4XK9A 3WTMA 2XQ6A 4ZR6A 3TLWA 4D01A 3WTHA 5J0ZA 5AFHA 3PEOA 5HEJA 4QH4A 3TLVA 4ZZBA 5J5FA 2Y56A 2XYTA 2BG9C 4HFDA 5L4HA 2BR8A 2W8FA 4AFTA 4UY2A 3EI0A 4TWFA 4X5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZ1 A;  3U8J A;  2LM2 A;  4HFE A;  4DBM A;  1OED B;  4AFH A;  5AIN A;  5TVC A;  2XYS A;  2MAW A;  4LML A;  2BYR A;  3U8K A;  3RQW A;  2BYQ A;  2LKG A;  2BJ0 A;  3UU3 A;  5KE4 A;  2BYP A;  4BQT A;  3ZDG A;  2BG9 A;  5HEH A;  5SYO A;  4LMJ A;  3SQ9 A;  4B5D A;  2XQ3 A;  1UV6 A;  4ZJS A;  3UU8 A;  5JME A;  2ZJV A;  4IL4 A;  3TLS A;  3GUA A;  4QAA A;  2XQ5 A;  2BYN A;  3PMZ A;  2YKS A;  3TLU A;  3JAE A;  3UUB A;  2XQA A;  2W8G A;  3ZDH A;  2BYS A;  1OED E;  2PH9 A;  4FRR A;  3P4W A;  2BG9 B;  2LKH A;  4Z91 A;  2YMD A;  4XHE A;  2BR7 A;  5CO5 A;  3EHZ A;  5LXB A;  5AFM A;  3U8L A;  3JAF A;  4HFI A;  5BW2 A;  2VL0 A;  4WV9 A;  5AFJ A;  2PGZ A;  3SQ6 A;  2XNV A;  5HEU A;  3T4M A;  4ZK4 A;  5KZU A;  4QH5 A;  1I9B A;  4ZZC A;  2LLY A;  3UU6 A;  5CFB A;  5J5G A;  5BRX A;  2WNL A;  4ZRU A;  3LSV A;  3P50 A;  3UU5 A;  4ILB A;  2WN9 A;  2WNC A;  3ZKR A;  5AFM B;  2YME A;  3U8M A;  4A98 A;  4UM1 A;  3UQ4 A;  4QAB A;  4UM3 A;  3IGQ A;  2XQ8 A;  3WIP A;  2WNJ A;  3JAD A;  3WTK A;  2BG9 E;  4A97 A;  1UX2 A;  3WTI A;  2XQ9 A;  4COF A;  5AFN A;  4HFC A;  2UZ6 A;  4ALX A;  3RIA A;  4ILC A;  5FJV A;  3C84 A;  4UM3 P;  4PIR A;  5HCJ A;  2Y7Y A;  4QAC A;  2XNU A;  3WTO A;  3UQ7 A;  4BFQ A;  2YN6 A;  4ILA A;  1UW6 A;  2KSR A;  4UM3 S;  5AFL A;  4QH1 A;  4TWD A;  2XQ7 A;  4HFH A;  2XZ6 A;  5HEO A;  5L47 A;  4ZJT A;  3SIO A;  3U8N A;  2Y58 A;  3SH1 A;  4IL9 A;  4ZK1 A;  4LMK A;  3RIF A;  2QC1 B;  3WTL A;  5HEG A;  2WZY A;  3TLT A;  1OED C;  2XQ4 A;  5HCM A;  4IRE A;  4Z90 A;  3RQU A;  5LG3 A;  2ZJU A;  4HQP A;  3WTN A;  5L4E A;  4UXU A;  2M6B A;  3RHW A;  3C79 A;  2C9T A;  2X00 D;  4NZB A;  3WTJ A;  3RI5 A;  5AFK A;  2M6I A;  5IUX A;  2Y57 A;  4NPP A;  3EAM A;  4TNV A;  5BP0 A;  4HFB A;  5J5I A;  5J5H A;  2Y54 A;  2X00 A;  2XNT A;  2XZ5 A;  4TNW A;  4AFG A;  1OED A;  4F8H A;  3UU4 A;  2YOE A;  4TWH A;  4XK9 A;  3WTM A;  2XQ6 A;  4ZR6 A;  3TLW A;  4D01 A;  3WTH A;  5J0Z A;  5AFH A;  3PEO A;  5HEJ A;  4QH4 A;  3TLV A;  4ZZB A;  5J5F A;  2Y56 A;  2XYT A;  2BG9 C;  4HFD A;  5L4H A;  2BR8 A;  2W8F A;  4AFT A;  4UY2 A;  3EI0 A;  4TWF A;  4X5T A; 
#chains in the Genus database with same CATH topology
 3U8J A;  4DBM A;  1OED B;  4IHJ E;  4QX8 B;  3RIU A;  3KBU A;  3FZK B;  2W63 A;  3UU3 A;  4UVA B;  2BYP A;  4EYY R;  4FI5 A;  4PNI A;  1N32 T;  3GUA A;  3P4S A;  2CXF A;  3ABV A;  2R6G F;  2BKN A;  4KHZ F;  4DV4 T;  4DVD A;  1T72 A;  4IT4 A;  3N2K E;  5AFU L;  3BQL A;  4ERR A;  1HG5 A;  2K5B B;  2LOS A;  3ZC0 A;  5KX5 E;  4ASK A;  5H6R B;  4UM3 A;  3IGQ A;  2CWO A;  2YIN A;  2WDV A;  2LOP A;  3ETU A;  4H9R C;  1X9B A;  4HFC A;  3WTO A;  2CHN A;  1XMQ T;  2ES0 A;  2KSR A;  2ODV A;  3AEA A;  4QH1 A;  2WZI A;  1GQE A;  3AE5 A;  3RGL A;  2BS4 A;  4QXC B;  5F8P A;  1J5E T;  1U4Q A;  3T8O A;  2EHO A;  3SFE A;  3R6N A;  3H3A A;  2Y54 A;  3N9P A;  3LJC A;  5LGN B;  2KZ7 B;  4V1A v;  2KND A;  2X68 A;  1LKX A;  2CXL A;  2SPC A;  5JR9 B;  3L39 A;  1KNZ A;  5FXZ A;  2RP4 A;  1UUS A;  3FXD B;  3RRW A;  3O1J A;  2MAW A;  3PU8 A;  4A5X A;  2LHR A;  5HXC A;  4EZH A;  2DLR A;  4BQT A;  3SQ9 A;  3ONJ A;  3UU8 A;  1V9D A;  3TLS A;  3NVO A;  4UV8 B;  3I1A A;  3EHZ A;  5AQV B;  1YQ4 A;  5EK2 A;  4ZI2 C;  4MHC A;  1MMG A;  4JI7 T;  4IE5 A;  2X0H A;  3ONL C;  4ZZC A;  4ZI2 D;  5FY1 A;  4HGA A;  1BR1 A;  5KXJ A;  5LJM A;  4O2B E;  2JQQ A;  1HNW T;  4JEH B;  3C51 A;  4Q25 A;  2CLY B;  4QWN B;  2ZM2 A;  3OVU A;  4PIR A;  5LP6 E;  4JI1 T;  3LDQ B;  3VKG A;  1WFD A;  2A2F X;  3FHN A;  3U8N A;  4HWC A;  4JEU B;  4EXT A;  3HKB E;  3WTN A;  1W09 A;  3KV6 A;  4B3M T;  3HKD E;  4NZB A;  2XPK A;  3IBP A;  5J5I A;  1HNX T;  3UUN A;  5FY7 A;  5ABE A;  3WTM A;  2C5J A;  2MBG A;  5AFH A;  3FBL A;  4KX6 A;  2C0S A;  2CM0 A;  3FXE B;  5AQS B;  1Y01 A;  3QOF A;  5TVC A;  4KHP T;  4EEB A;  2VKH A;  4E7Z A;  4B3R T;  5SYO A;  4TV9 E;  3O1H A;  2FUP A;  4IL4 A;  4QAA A;  1N34 T;  3C98 B;  2VVS A;  2PH9 A;  1FIO A;  1W9R A;  1HR0 T;  2KXP B;  3A8Y C;  3CIR A;  2PG8 A;  5L2L A;  1T8B A;  2WY2 A;  4NIQ A;  2DWK A;  3B13 A;  1IBK T;  1MND A;  2V1D B;  3LSV A;  3RC3 A;  1I6Z A;  5AQU B;  2WZH A;  2Y48 B;  3OBV E;  5AFM B;  4A98 A;  3RKO A;  3JC6 C;  3RC8 A;  3OYX A;  2W0G A;  2BG9 E;  2XTL A;  1JNR A;  4YFS A;  4DR3 T;  5FVK A;  1XZY A;  1UX4 A;  2E9X C;  3JC6 D;  2XAG B;  4U72 A;  2BS3 A;  2XUE A;  1CHU A;  1ZV4 X;  4EED A;  4ZI3 C;  4UM3 S;  5BR8 T;  2E9X D;  3FZL B;  5J2U E;  5HEO A;  2LSG A;  2ZM6 T;  4ZK1 A;  4ZI3 D;  3AVS A;  4JV5 T;  4GIW A;  5AQG B;  2X00 D;  2E5V A;  2V7L A;  4KMC A;  5IUX A;  5L3F B;  1BR2 A;  4X66 T;  3KVA A;  2UUA T;  3AE9 A;  3A7M A;  5DQW A;  2WWU A;  4IDN A;  2L9Q A;  2Q9Q B;  4ZOL E;  2JJ9 A;  1MIW A;  2V7M A;  4HFE A;  1SE7 A;  4TX5 A;  4EV6 A;  3ZEF B;  4LF6 T;  5JRE A;  5LGT B;  2LKG A;  2IIU A;  2A9U A;  4JI8 T;  3AAA B;  4EZ4 A;  2B1E A;  2JQH A;  1SHZ C;  3AXJ A;  4DV1 T;  2LE8 A;  1OED E;  2YMD A;  4UR9 A;  3CX6 B;  2VL0 A;  2UU9 T;  1XMO T;  3LK4 2;  5LOV E;  4DR1 T;  4ILB A;  2ZLY A;  4DR6 T;  4X62 T;  4NXM T;  2BBJ A;  4DBQ A;  1WR6 A;  1BR4 A;  4CN4 A;  4NXN T;  5LXT E;  3AEB A;  1UW6 A;  4U31 A;  5AQL B;  5L47 A;  4BA9 A;  1NAF A;  3OYZ A;  2G0U A;  3UTK A;  4X20 E;  2D0U A;  4ZEY A;  4X1Y E;  4PAG A;  4CXX A;  3N9N A;  5AFK A;  2K24 A;  3T1H T;  3EAM A;  3KV4 A;  5LMN T;  1WRD A;  3R84 B;  3V5S A;  4TNW A;  4TWH A;  2V6Y B;  4DV5 T;  4I43 B;  2V5C A;  1LVF A;  5AQR B;  2I0M A;  1QUU A;  3UUL A;  3EUH A;  3RQW A;  5BMV E;  4DV0 T;  3M65 A;  4ZHQ E;  4I4T E;  4YJ2 E;  4YT0 A;  3ZDG A;  1VRB A;  5JME A;  2XAS B;  3ANW A;  2WB5 A;  3C64 A;  5JDH A;  2HH7 A;  3CPZ A;  3ZLI A;  3AE7 A;  4PK6 A;  2Z6E A;  3ZN1 B;  1FEW A;  4UXN B;  2X9W A;  3PUX F;  4HTE A;  4AQG A;  3P4P A;  3N9L A;  4HWH A;  3AE8 A;  4TV8 E;  3AE4 A;  2W67 A;  3UU5 A;  1MMD A;  3ZPO A;  2ZM8 A;  1ZP0 A;  1KNR A;  2VKO A;  3SS1 A;  2CPT A;  4LF8 T;  4A97 A;  1S94 A;  2V6X A;  2WBL A;  1IAP A;  3AA0 B;  2CCQ A;  3PUZ F;  1H7C A;  3PUV F;  2YU2 A;  3M3Z B;  2Y7Y A;  2BVL A;  2YN6 A;  1LVK A;  4DR2 T;  3VU7 H;  4HFH A;  4U2Z A;  4EOZ B;  3LFM A;  2QGS A;  3RIF A;  2D2S A;  1BR0 A;  3IF8 B;  3DTO A;  4F6R C;  2C9T A;  2NW8 A;  2M6I A;  2L8K A;  1UX5 A;  3PV0 F;  2X00 A;  4JI0 T;  1NEK A;  4YTP A;  3TLW A;  2X51 A;  1KF6 A;  2EHO B;  4H9N C;  4QXH B;  4H63 H;  1X79 A;  4G63 A;  3EI0 A;  2OLT A;  4BJN A;  1D0Z A;  4QKN A;  2V6Y A;  2BYR A;  5FY0 A;  3SWH A;  1UV6 A;  5JH7 E;  4MBQ A;  4WBN E;  3ZST A;  4OK0 A;  2IAK A;  2YK0 A;  3K8P C;  2X0L B;  4JUY A;  4CI2 B;  3C4X A;  3JAF A;  2WMO A;  4YY3 T;  3SFD A;  4EB6 E;  4YSX A;  5FP3 A;  5C8Y E;  1WR0 A;  5C2T A;  3QC9 A;  5CFB A;  5F5W A;  1M62 A;  4EAH A;  3IHR A;  4ILU A;  4HE8 A;  3PUR A;  3QB5 K;  3RLF F;  4FJO A;  4WBO A;  2IC9 A;  3FBZ A;  3WI3 A;  4K0K T;  4CN6 A;  3UQ7 A;  5CJ5 A;  3ZMZ B;  2X9X A;  3PUQ A;  5FNV E;  4IL9 A;  3W15 B;  2WZY A;  5HWY A;  4N78 D;  3I0Q A;  1S35 A;  2HPJ A;  3P7I A;  5DAB A;  3N9Q A;  1W0B A;  3QNU A;  5ABG A;  3QUJ A;  4GKJ T;  1J5W A;  3DJB A;  3CK6 A;  3NBX X;  5HYA A;  2VAS A;  3ETV A;  5J5F A;  5L4H A;  5IYZ E;  3B5M A;  2CRB A;  4PJL A;  4CI3 B;  2MYS A;  2D9D A;  2V7K A;  4HWF A;  4LMJ A;  4UF0 A;  2MOZ A;  1D0X A;  5FXW A;  2XQ5 A;  2BYN A;  4DUZ T;  2XQA A;  2CMR A;  2WAU A;  3PJA A;  2H7O A;  3K3N A;  4GOU A;  2XHE B;  1N33 T;  5KZU A;  1Y64 B;  2LSK A;  3P50 A;  4AIU A;  2WN9 A;  3ZKR A;  4J2C A;  2V26 A;  4UM1 A;  2V7I A;  3HKC E;  3P8C D;  3Q9D A;  2UUC T;  4AXP A;  4ALX A;  3ZMS B;  4LF9 T;  4GKK T;  4HFV A;  2PJQ A;  3EVY A;  1YKH B;  4HEA A;  3CML A;  5ETW A;  2RPA A;  2XAJ B;  1HF8 A;  3SH1 A;  1XNQ T;  5JDN A;  4IRE A;  2VVN A;  3FZH B;  4KI0 F;  3OKQ A;  2IC6 A;  3NRY A;  5LHI B;  4L5G A;  3L3P A;  5HWX A;  4ANJ A;  4DV7 T;  4IDP A;  5L3B B;  3PEO A;  4UVC B;  3PUY F;  2CBI A;  2LHN A;  3GWH A;  3DP7 A;  3RKG A;  3NWI A;  2X67 A;  1E7P A;  1VCT A;  3KDS E;  5LA6 E;  3C50 A;  5FKY A;  4U74 A;  2WS3 A;  3ZJ2 A;  2W4X A;  3VHL A;  2X0Y A;  2LEH A;  2WDQ A;  3TLU A;  2DI4 A;  3P4W A;  2A3D A;  5CO5 A;  1KFY A;  4HFI A;  2CWY A;  4CXW A;  1HCI A;  3I9W A;  3ZN0 B;  4O4L E;  2WDR A;  3H37 A;  4AI6 A;  3AXJ B;  2VQE T;  4YLH A;  3MJX A;  2FJB A;  1UGO A;  3NKZ A;  4AKG A;  2H88 A;  4YTM A;  3WIP A;  5FYM A;  3CWZ B;  3PJA J;  5KDM C;  5JVD E;  4X64 T;  5LGU B;  3ZT7 A;  4ILC A;  2MTQ A;  2WP9 A;  2KWH A;  1AJ3 A;  1FMV A;  5GON E;  4WNK A;  4JLE A;  2JQK A;  3TLT A;  4OHF A;  2K3W A;  5KMG P;  2ZJU A;  3GN5 A;  1YW0 A;  3G06 A;  2NW7 A;  3RHW A;  3WAJ A;  3HA4 A;  2H89 A;  3NRX A;  3C4Z A;  4IE6 A;  4DR5 T;  4XK9 A;  2XQ6 A;  2CBJ A;  3EAB A;  5C3J A;  4D01 A;  3TLV A;  4ZZB A;  2W8F A;  2QYW A;  2LM2 A;  4NUV A;  1YXR A;  4AQF C;  3BK9 A;  4I0U A;  3CX7 B;  3KV9 A;  4IDQ A;  4EIW A;  4ZJS A;  4UEM A;  5AQN B;  2UXX B;  2VKD A;  2N2N A;  2PTF A;  4X65 T;  2W8G A;  3RYH E;  5ABF A;  1CUN A;  5H6Q B;  4U33 A;  3AE3 A;  4UV9 B;  2W2U A;  3ANW B;  3CX8 B;  2JRK A;  4PW8 A;  2WQY A;  3O9X A;  1L0V A;  4ZK4 A;  4QH5 A;  1ZOY A;  4E7S A;  4AIS A;  1HFA A;  4P0B A;  4XBF B;  3NZP A;  3NZQ A;  4OYJ A;  2YME A;  2WNJ A;  1UCU A;  2XQ9 A;  4GYR A;  1M7K A;  2B76 A;  5AQI B;  3RIA A;  2M67 A;  4JI2 T;  3KIN B;  3IA3 A;  3Q5E A;  4JI3 T;  1US7 B;  2Y58 A;  5LHG B;  3VKH A;  3ZT5 A;  4TN7 B;  5FXV A;  4UXU A;  5FMN A;  1HS7 A;  3RYI E;  1OXZ A;  1NEN A;  4EGW A;  3PUS A;  5J5H A;  2E9X B;  4TUY E;  5LCY A;  4AFG A;  1Z0P A;  4PK5 A;  3UU4 A;  3S4U A;  5AQO B;  4IE0 A;  5JDM A;  2CE7 A;  4QX7 B;  4B6X A;  2BG9 C;  2XYT A;  2IW5 B;  4P0A A;  2HHH T;  5M4Y A;  1D1A A;  2JMK A;  3UFE A;  2E5L T;  1IBL T;  3ONX A;  4BJM A;  5HXE A;  3UUM A;  5LHH B;  1OWA A;  2BKO A;  2XQ3 A;  2FJD A;  2JPF A;  2ZJV A;  4X1K E;  3K3Q C;  2ZMA A;  4GK0 E;  4P09 A;  4Z91 A;  4WW0 A;  3RRC A;  3LBX A;  2PGZ A;  3SRZ A;  4CN1 A;  2D0T A;  3T4M A;  2HN2 A;  3RYC E;  3EDU A;  2WMN A;  5IWA T;  1ZHC A;  3I9Y A;  1WYC A;  2WNC A;  2VL8 A;  5EK3 A;  2X66 A;  2KMF A;  2NOX A;  5A1L A;  3AB3 B;  3D0T A;  3KVB A;  5CA0 E;  2ACX A;  3C84 A;  2E8I A;  5HCJ A;  2NR4 A;  4L9I A;  3RX6 A;  3WAK A;  5AFL A;  4PJM A;  2XZ6 A;  4OYK A;  1VOM A;  3PUG A;  2N9D A;  2QC1 B;  1OED C;  2LT3 A;  1FMW A;  4B3S T;  3EDV A;  3C79 A;  3KFW X;  3A5X A;  2QRX A;  2VK9 A;  4QXB B;  3MZK B;  2NW9 A;  5AQK B;  4DBR A;  4XAX B;  2XNT A;  4PFP A;  2XSA A;  2XM1 A;  5LJN A;  3JCF A;  1HX1 B;  5J2T E;  3WTH A;  4IGU A;  3AE6 A;  4KUM B;  2YDQ A;  2IDO B;  5AQQ B;  2E9X A;  4X5T A;  3N5L A;  3UFG A;  2WCA A;  2W00 A;  1YD8 G;  4ADZ A;  1ZEE A;  2N1G A;  4O2A E;  4EYU A;  3ZMV B;  3N2G E;  2QVA A;  3AA6 B;  3TKL B;  3ZCI A;  4O4J E;  4AKH A;  3U3I A;  3AE1 A;  3N2O A;  1E2A A;  2C5I T;  1EZ3 A;  2AXD S;  4IIJ E;  4CZZ B;  3ZDH A;  2BR7 A;  5AQM B;  4UF0 B;  2J1D G;  2CEA A;  5DQV A;  2VKJ A;  4AKR B;  1D1C A;  2XAF B;  5EK4 A;  3UU6 A;  2PBI A;  2DWG A;  2GK9 A;  3AEG A;  3ZYM A;  5L3G B;  3WTI A;  5L3E B;  3MAC A;  2IML A;  3ESL A;  3OTO T;  2WU5 A;  4CQI A;  4QAC A;  1XNR T;  3ZCJ A;  5HAX A;  2XM2 A;  2WM9 A;  5JR9 C;  2K9A A;  3MK7 C;  5ABH A;  2I59 A;  2ACZ A;  2XQ4 A;  3HR0 A;  5LG3 A;  1MNE A;  2BVM A;  2V7J A;  4HQP A;  4AQY T;  5L3D B;  2M6B A;  1LRZ A;  5JDF A;  5BP0 A;  3AEE A;  4ZXL A;  4F8H A;  4JYA T;  2YOE A;  1DU2 A;  2H3R A;  2LSY A;  3ZMT B;  1B7T A;  1XDO A;  4JI4 T;  1QLB A;  3E0Z A;  1XDP A;  3PE0 A;  2HPL A;  4C91 A;  4AFH A;  4DR7 T;  1KEY A;  2BYQ A;  4LFB T;  2BJ0 A;  4JBW F;  3J9X 1;  3BQI A;  5JRC A;  2BG9 A;  4NUU A;  3J7Y q;  3FB2 A;  3AAI A;  4MAL A;  5JDQ A;  2DNX A;  1R8I A;  2IHR 1;  1I94 T;  2CLY C;  4LF4 T;  4FRR A;  3AED A;  2VWA A;  5LXB A;  5BW2 A;  4WV9 A;  2OV9 A;  5HEU A;  3Q2M A;  5HXS A;  5J5G A;  4LF7 T;  3AAE B;  2D5U A;  1E1H B;  4YHH T;  3HL6 A;  1UX2 A;  1G8X A;  2CA5 A;  5FVL A;  3FZF B;  3QK6 A;  3CKD A;  2MPK A;  2W62 A;  3KV5 A;  3VR9 A;  3PTR B;  4K0U A;  2J4G A;  1KK7 A;  4BFQ A;  2LSJ A;  2BKP A;  1WCR A;  2XQ7 A;  2UUB T;  1Z8U A;  5J1G A;  1W0A A;  4YTN A;  3RQU A;  4U3C A;  4P1N A;  3U78 A;  1D0Y A;  1HG2 A;  1IBM T;  2Y57 A;  5CB4 E;  4DR4 T;  3GN5 B;  1OED A;  4IE4 A;  3PUW F;  2RA1 A;  5HEJ A;  5TAO A;  2BR8 A;  3RPU A;  4ZS3 A;  4MLK A;  5AIN A;  2P9B A;  4QHO A;  1IJ5 A;  2DHR A;  4HN9 A;  4I50 E;  4IDZ A;  4H9P C;  5KE4 A;  2C5K T;  4ISS A;  4WYV A;  2X9H A;  3ZYK A;  1T7S A;  4CI1 B;  1MIY A;  3JAE A;  3UUB A;  4UIG A;  2BYS A;  4DV2 T;  1ZKE A;  4H63 V;  3U8L A;  1O3X A;  2HN1 A;  3PDY A;  4GYS A;  5IHY A;  2IUB A;  5F3J A;  5BRX A;  5ABF B;  2WNL A;  5CA1 E;  3F57 A;  4DO0 A;  3UUX B;  4DND A;  2DL1 A;  5AQP B;  3UQ4 A;  2BZB A;  1MMN A;  4GK5 E;  4KBM B;  4COF A;  5AFN A;  1WLX A;  3B57 A;  4UM3 P;  1J1J A;  4LFA T;  3RH3 A;  3OJA A;  2VB6 A;  1QSD A;  4ZJT A;  2Q9Q C;  1JNZ A;  2KT9 A;  5HEG A;  2NP9 A;  3K3O A;  5FXX A;  2OA5 A;  5LBQ B;  1HX8 A;  4JI6 T;  3CVR A;  2Q9Q D;  3ZSS A;  4XZC A;  5ADX L;  2KLQ A;  5JR9 A;  4TNV A;  2KWI B;  2UXC T;  5JQG E;  1UUR A;  3AA7 B;  4AKL A;  4A56 A;  4ZR6 A;  4OFZ A;  4DV3 T;  4WZX A;  1HTJ F;  4QH4 A;  4OX9 T;  5AQF B;  1XWM A;  2PFV A;  3PU3 A;  2XYS A;  2H7V C;  4H9O C;  3HI2 A;  4PJJ A;  1D1B A;  1YQ3 A;  3LG7 A;  2XQY A;  4DV6 T;  5HEH A;  3AEC A;  4B5D A;  5L3C B;  2DCF A;  4O8S A;  2WWV A;  2YKS A;  3P4R A;  5HXR A;  2CHO A;  5LYJ E;  3O4X E;  2BBH A;  2QA7 A;  3BQK A;  2XNV A;  5HXH A;  5FL0 A;  1I9B A;  4ZRU A;  4HWI B;  4UVB B;  5LNK A;  3MA9 A;  3QB5 A;  3LBX B;  2XZE A;  2J62 A;  3JAD A;  2K48 A;  2XSB A;  5LMU T;  2AE9 A;  2XAH B;  2UZ6 A;  2LRL A;  3FZM B;  4AKI A;  2WU2 A;  3C4W A;  3T1Y T;  3HKE E;  2XNU A;  3VRA A;  3CQG B;  4X1I E;  2YDR A;  4CXY A;  3N9M A;  3F31 A;  2UXN B;  4PK4 A;  2FBW A;  4Z90 A;  2JIW A;  1VCS A;  3VRB A;  5L4E A;  4IE7 A;  4H9S E;  1FJG T;  3RI5 A;  5JDL A;  3Q5W A;  5LB7 B;  3RIU C;  4U7Y A;  5J0Z A;  2JQ9 A;  4AFT A;  5LBM A;  1HNZ T;  4YSY A;  4KP3 C;  1KNP A;  4H9Q C;  4TWF A;  3AEF A;  4EZ1 A;  1IJ6 A;  2VQF T;  4Z8X A;  3RF1 A;  2UXD T;  2YU1 A;  3N9O A;  4DMW A;  5CGM A;  2ODU A;  3IEE A;  3SOL A;  3I0O A;  5AQJ B;  3PMZ A;  5FL1 A;  5AFM A;  4IDO A;  2J47 A;  4ZI7 E;  1NWM X;  3PUA A;  2VUR A;  3MKD A;  2LRK A;  4U2Y A;  2LLY A;  3P4Q A;  2BDE A;  2L3L A;  2A72 A;  4JI5 T;  1IZN B;  4QAB A;  4PJN A;  1YKE B;  4C90 A;  1U5P A;  2LSI A;  4IST A;  5EZY E;  4YHJ A;  2FJE A;  5FJV A;  4YSZ A;  3VR8 A;  5JDG A;  3KBT A;  5LG4 A;  2EHO C;  4TWD A;  4LFC T;  3WTL A;  5HCM A;  2XY8 B;  1UK5 A;  2EHO D;  5JTG A;  4MFR A;  3UT5 E;  3WTJ A;  1MIV A;  4O4H E;  4DID B;  2NWB A;  2Q9Q A;  3L8R A;  2XZ5 A;  2XAQ B;  2W61 A;  3K1S A;  3OPC A;  4DMV A;  3X1D A;  1WYB A;  2Y56 A;  3V5U A;  2NTY A;  3ZC1 A;  4LML A;  1N36 T;  2NTX A;  3U8K A;  3CQC B;  3LK2 B;  4BAY B;  2W66 A;  5E0O A;  3Q5D A;  3E08 A;  3E22 E;  2V8S V;  5JRC B;  2BG9 B;  2LKH A;  4XHE A;  2KIN B;  4YJ3 E;  2E2A A;  5AQH B;  1T98 A;  2BS2 A;  5AFJ A;  3CQX C;  3SQ6 A;  1SUM B;  3AA1 B;  3O1I A;  2FJA A;  4M1P A;  3AVR A;  2LM9 A;  1SA0 E;  3U8M A;  2LJL A;  4HWD A;  2I6H A;  2XQ8 A;  4L0R A;  3WTK A;  4YXD A;  3F2E A;  3GA8 A;  5AQT B;  3RYF E;  4AQF A;  2YEV C;  2ZM0 A;  2CXD A;  2WSS V;  3ZMU B;  3H3M A;  4G2A A;  2X9Y A;  2Y8D A;  3LK3 B;  4U7I A;  3GMI A;  3L09 A;  4DUY T;  4ILA A;  2XJ7 A;  2YDS A;  2V5D A;  4O4I E;  3SIO A;  1G73 A;  2F4V T;  4LMK A;  2Y6X A;  4UEL A;  1MMA A;  2JMH A;  4TZ4 C;  4PFO A;  4HKA A;  3ZT6 A;  4ZS2 A;  3AE2 A;  4I55 E;  4NPP A;  5DJQ C;  4HFB A;  2UXB T;  4B3T T;  3ZYL A;  3MXZ A;  3ZJ1 A;  4HFD A;  4LF5 T;  4UY2 A;  3Q5X A; 
#chains in the Genus database with same CATH homology
 4EZ1 A;  3U8J A;  2LM2 A;  4HFE A;  4DBM A;  1OED B;  4AFH A;  5AIN A;  5TVC A;  2XYS A;  2MAW A;  4LML A;  2BYR A;  3U8K A;  3RQW A;  2BYQ A;  2LKG A;  2BJ0 A;  3UU3 A;  5KE4 A;  2BYP A;  4BQT A;  3ZDG A;  2BG9 A;  5HEH A;  5SYO A;  4LMJ A;  3SQ9 A;  4B5D A;  2XQ3 A;  1UV6 A;  4ZJS A;  3UU8 A;  5JME A;  2ZJV A;  4IL4 A;  3TLS A;  3GUA A;  4QAA A;  2XQ5 A;  2BYN A;  3PMZ A;  2YKS A;  3TLU A;  3JAE A;  3UUB A;  2XQA A;  2W8G A;  3ZDH A;  2BYS A;  1OED E;  2PH9 A;  4FRR A;  3P4W A;  2BG9 B;  2LKH A;  4Z91 A;  2YMD A;  4XHE A;  2BR7 A;  5CO5 A;  3EHZ A;  5LXB A;  5AFM A;  3U8L A;  3JAF A;  4HFI A;  5BW2 A;  2VL0 A;  4WV9 A;  5AFJ A;  2PGZ A;  3SQ6 A;  2XNV A;  5HEU A;  3T4M A;  4ZK4 A;  5KZU A;  4QH5 A;  1I9B A;  4ZZC A;  2LLY A;  3UU6 A;  5CFB A;  5J5G A;  5BRX A;  2WNL A;  4ZRU A;  3LSV A;  3P50 A;  3UU5 A;  4ILB A;  2WN9 A;  2WNC A;  3ZKR A;  5AFM B;  2YME A;  3U8M A;  4A98 A;  4UM1 A;  3UQ4 A;  4QAB A;  4UM3 A;  3IGQ A;  2XQ8 A;  3WIP A;  2WNJ A;  3JAD A;  3WTK A;  2BG9 E;  4A97 A;  1UX2 A;  3WTI A;  2XQ9 A;  4COF A;  5AFN A;  4HFC A;  2UZ6 A;  4ALX A;  3RIA A;  4ILC A;  5FJV A;  3C84 A;  4UM3 P;  4PIR A;  5HCJ A;  2Y7Y A;  4QAC A;  2XNU A;  3WTO A;  3UQ7 A;  4BFQ A;  2YN6 A;  4ILA A;  1UW6 A;  2KSR A;  4UM3 S;  5AFL A;  4QH1 A;  4TWD A;  2XQ7 A;  4HFH A;  2XZ6 A;  5HEO A;  5L47 A;  4ZJT A;  3SIO A;  3U8N A;  2Y58 A;  3SH1 A;  4IL9 A;  4ZK1 A;  4LMK A;  3RIF A;  2QC1 B;  3WTL A;  5HEG A;  2WZY A;  3TLT A;  1OED C;  2XQ4 A;  5HCM A;  4IRE A;  4Z90 A;  3RQU A;  5LG3 A;  2ZJU A;  4HQP A;  3WTN A;  5L4E A;  4UXU A;  2M6B A;  3RHW A;  3C79 A;  2C9T A;  2X00 D;  4NZB A;  3WTJ A;  3RI5 A;  5AFK A;  2M6I A;  5IUX A;  2Y57 A;  4NPP A;  3EAM A;  4TNV A;  5BP0 A;  4HFB A;  5J5I A;  5J5H A;  2Y54 A;  2X00 A;  2XNT A;  2XZ5 A;  4TNW A;  4AFG A;  1OED A;  4F8H A;  3UU4 A;  2YOE A;  4TWH A;  4XK9 A;  3WTM A;  2XQ6 A;  4ZR6 A;  3TLW A;  4D01 A;  3WTH A;  5J0Z A;  5AFH A;  3PEO A;  5HEJ A;  4QH4 A;  3TLV A;  4ZZB A;  5J5F A;  2Y56 A;  2XYT A;  2BG9 C;  4HFD A;  5L4H A;  2BR8 A;  2W8F A;  4AFT A;  4UY2 A;  3EI0 A;  4TWF A;  4X5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...