2XNTA

Acetylcholine binding protein (achbp) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Acetylcholine Binding Protein (Achbp) as Template for Hierarchical in Silico Screening Procedures to Identify Structurally Novel Ligands for the Nicotinic Receptors.
pubmed doi rcsb
source organism Aplysia californica
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xntA00
3SH1A 5KE4A 4FRRA 4UY2A 2XQ9A 2W8FA 2YMDA 4ZR6A 5HEHA 3WTMA 3P50A 5JMEA 2W8GA 2Y54A 4XHEA 4ILAA 3UUBA 2WN9A 2XNTA 4QH4A 5AFKA 4EZ1A 3WTOA 3UU3A 5BW2A 4HFIA 3UU5A 5LG3A 2XQ5A 2XQ7A 2YOEA 4TWHA 3UU4A 4Z90A 4DBMA 4ZK1A 3LSVA 3IGQA 4ZK4A 5TVCA 5SYOA 2BR7A 3RQWA 4LMJA 3UQ4A 3PEOA 3JADA 2XQ6A 4ALXA 3TLSA 3TLTA 5LXBA 5J0ZA 3P4WA 2PGZA 5IUXA 4PIRA 3U8KA 5CFBA 3U8JA 5J5HA 4TWDA 4Z91A 2YMEA 5J5FA 2Y57A 4A98A 2X00A 4ZRUA 3GUAA 5AFLA 2C9TA 4AFTA 4ZZBA 5AFHA 3ZKRA 5AINA 2WNJA 5J5GA 3RI5A 4XK9A 3WTJA 2BYRA 4LMLA 4TWFA 3RHWA 3TLVA 4COFA 2YKSA 3EI0A 5L47A 2VL0A 4IL9A 2Y7YA 5HEGA 3RIFA 3WTNA 5HEOA 4ZJTA 4HQPA 4ILBA 3TLUA 2XQ8A 1UX2A 2Y56A 2WNLA 4ZJSA 5AFNA 2XYSA 5BRXA 2UZ6A 3U8LA 4HFCA 2XQ4A 2BJ0A 5CO5A 2X00D 4UXUA 1UV6A 2BYQA 4ZZCA 3UU8A 3C79A 5AFMB 4X5TA 5L4HA 5AFJA 2BYPA 5L4EA 5BP0A 3EAMA 3T4MA 5AFMA 5HEUA 4QACA 4TNVA 3WTKA 4UM1A 2WZYA 5HCMA 2YN6A 2XQAA 3JAEA 2XQ3A 3EHZA 2ZJUA 3SIOA 4IL4A 3SQ9A 4B5DA 3UQ7A 3U8NA 2BYSA 3TLWA 4AFHA 2BG9B 2Y58A 2XNVA 2PH9A 2BG9A 2WNCA 2ZJVA 4D01A 1UW6A 4QH5A 4UM3S 2BG9C 4HFHA 4NPPA 4QABA 4IREA 3WTLA 5HEJA 2XZ5A 4HFEA 4QH1A 3U8MA 4AFGA 2BR8A 3PMZA 4QAAA 1I9BA 3ZDHA 2BYNA 2XZ6A 2XNUA 3C84A 4BFQA 3UU6A 3RIAA 3SQ6A 4UM3A 4NZBA 4TNWA 4F8HA 4LMKA 4ILCA 3WIPA 4BQTA 3ZDGA 4A97A 5J5IA 4HFBA 3WTIA 4HFDA 5FJVA 2QC1B 3WTHA 4UM3P 2BG9E 4WV9A 2XYTA 3RQUA 5KZUA 3JAFA 5HCJA
chains in the Genus database with same CATH superfamily
3SH1A 5KE4A 4FRRA 4UY2A 2XQ9A 2W8FA 2YMDA 4ZR6A 5HEHA 3WTMA 3P50A 5JMEA 2W8GA 2Y54A 4XHEA 4ILAA 3UUBA 2WN9A 2XNTA 4QH4A 5AFKA 4EZ1A 3WTOA 3UU3A 5BW2A 4HFIA 3UU5A 5LG3A 2XQ5A 2XQ7A 2YOEA 4TWHA 3UU4A 4Z90A 4DBMA 4ZK1A 3LSVA 3IGQA 4ZK4A 5TVCA 5SYOA 2BR7A 3RQWA 4LMJA 3UQ4A 3PEOA 3JADA 2XQ6A 4ALXA 3TLSA 3TLTA 5LXBA 5J0ZA 3P4WA 2PGZA 5IUXA 4PIRA 3U8KA 5CFBA 3U8JA 5J5HA 4TWDA 4Z91A 2YMEA 5J5FA 2Y57A 4A98A 2X00A 4ZRUA 3GUAA 5AFLA 2C9TA 4AFTA 4ZZBA 5AFHA 3ZKRA 5AINA 2WNJA 5J5GA 3RI5A 4XK9A 3WTJA 2BYRA 4LMLA 4TWFA 3RHWA 3TLVA 4COFA 2YKSA 3EI0A 5L47A 2VL0A 4IL9A 2Y7YA 5HEGA 3RIFA 3WTNA 5HEOA 4ZJTA 4HQPA 4ILBA 3TLUA 2XQ8A 1UX2A 2Y56A 2WNLA 4ZJSA 5AFNA 2XYSA 5BRXA 2UZ6A 3U8LA 4HFCA 2XQ4A 2BJ0A 5CO5A 2X00D 4UXUA 1UV6A 2BYQA 4ZZCA 3UU8A 3C79A 5AFMB 4X5TA 5L4HA 5AFJA 2BYPA 5L4EA 5BP0A 3EAMA 3T4MA 5AFMA 5HEUA 4QACA 4TNVA 3WTKA 4UM1A 2WZYA 5HCMA 2YN6A 2XQAA 3JAEA 2XQ3A 3EHZA 2ZJUA 3SIOA 4IL4A 3SQ9A 4B5DA 3UQ7A 3U8NA 2BYSA 3TLWA 4AFHA 2BG9B 2Y58A 2XNVA 2PH9A 2BG9A 2WNCA 2ZJVA 4D01A 1UW6A 4QH5A 4UM3S 2BG9C 4HFHA 4NPPA 4QABA 4IREA 3WTLA 5HEJA 2XZ5A 4HFEA 4QH1A 3U8MA 4AFGA 2BR8A 3PMZA 4QAAA 1I9BA 3ZDHA 2BYNA 2XZ6A 2XNUA 3C84A 4BFQA 3UU6A 3RIAA 3SQ6A 4UM3A 4NZBA 4TNWA 4F8HA 4LMKA 4ILCA 3WIPA 4BQTA 3ZDGA 4A97A 5J5IA 4HFBA 3WTIA 4HFDA 5FJVA 2QC1B 3WTHA 4UM3P 2BG9E 4WV9A 2XYTA 3RQUA 5KZUA 3JAFA 5HCJA
chains in the Genus database with same CATH topology
3SH1A 5KE4A 4FRRA 4UY2A 2XQ9A 2W8FA 2YMDA 4ZR6A 5HEHA 3WTMA 3P50A 5JMEA 2W8GA 2Y54A 4XHEA 4ILAA 3UUBA 2WN9A 2XNTA 4QH4A 5AFKA 4EZ1A 3WTOA 3UU3A 5BW2A 4HFIA 3UU5A 5LG3A 2XQ5A 2XQ7A 2YOEA 4TWHA 3UU4A 4Z90A 4DBMA 4ZK1A 3LSVA 3IGQA 4ZK4A 5TVCA 5SYOA 2BR7A 3RQWA 4LMJA 3UQ4A 3PEOA 3JADA 2XQ6A 4ALXA 3TLSA 3TLTA 5LXBA 5J0ZA 3P4WA 2PGZA 5IUXA 4PIRA 3U8KA 5CFBA 3U8JA 5J5HA 4TWDA 4Z91A 2YMEA 5J5FA 2Y57A 4A98A 2X00A 4ZRUA 3GUAA 5AFLA 2C9TA 4AFTA 4ZZBA 5AFHA 3ZKRA 5AINA 2WNJA 5J5GA 3RI5A 4XK9A 3WTJA 2BYRA 4LMLA 4TWFA 3RHWA 3TLVA 4COFA 2YKSA 3EI0A 5L47A 2VL0A 4IL9A 2Y7YA 5HEGA 3RIFA 3WTNA 5HEOA 4ZJTA 4HQPA 4ILBA 3TLUA 2XQ8A 1UX2A 2Y56A 2WNLA 4ZJSA 5AFNA 2XYSA 5BRXA 2UZ6A 3U8LA 4HFCA 2XQ4A 2BJ0A 5CO5A 2X00D 4UXUA 1UV6A 2BYQA 4ZZCA 3UU8A 3C79A 5AFMB 4X5TA 5L4HA 5AFJA 2BYPA 5L4EA 5BP0A 3EAMA 3T4MA 5AFMA 5HEUA 4QACA 4TNVA 3WTKA 4UM1A 2WZYA 5HCMA 2YN6A 2XQAA 3JAEA 2XQ3A 3EHZA 2ZJUA 3SIOA 4IL4A 3SQ9A 4B5DA 3UQ7A 3U8NA 2BYSA 3TLWA 4AFHA 2BG9B 2Y58A 2XNVA 2PH9A 2BG9A 2WNCA 2ZJVA 4D01A 1UW6A 4QH5A 4UM3S 2BG9C 4HFHA 4NPPA 4QABA 4IREA 3WTLA 5HEJA 2XZ5A 4HFEA 4QH1A 3U8MA 4AFGA 2BR8A 3PMZA 4QAAA 1I9BA 3ZDHA 2BYNA 2XZ6A 2XNUA 3C84A 4BFQA 3UU6A 3RIAA 3SQ6A 4UM3A 4NZBA 4TNWA 4F8HA 4LMKA 4ILCA 3WIPA 4BQTA 3ZDGA 4A97A 5J5IA 4HFBA 3WTIA 4HFDA 5FJVA 2QC1B 3WTHA 4UM3P 2BG9E 4WV9A 2XYTA 3RQUA 5KZUA 3JAFA 5HCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH1 A;  5KE4 A;  4FRR A;  4UY2 A;  2XQ9 A;  2W8F A;  2YMD A;  4ZR6 A;  5HEH A;  3WTM A;  3P50 A;  5JME A;  2W8G A;  2Y54 A;  4XHE A;  4ILA A;  3UUB A;  2WN9 A;  2XNT A;  4QH4 A;  5AFK A;  4EZ1 A;  3WTO A;  3UU3 A;  5BW2 A;  4HFI A;  3UU5 A;  5LG3 A;  2XQ5 A;  2XQ7 A;  2YOE A;  4TWH A;  3UU4 A;  4Z90 A;  4DBM A;  4ZK1 A;  3LSV A;  3IGQ A;  4ZK4 A;  5TVC A;  5SYO A;  2BR7 A;  3RQW A;  4LMJ A;  3UQ4 A;  3PEO A;  3JAD A;  2XQ6 A;  4ALX A;  3TLS A;  3TLT A;  5LXB A;  5J0Z A;  3P4W A;  2PGZ A;  5IUX A;  4PIR A;  3U8K A;  5CFB A;  3U8J A;  5J5H A;  4TWD A;  4Z91 A;  2YME A;  5J5F A;  2Y57 A;  4A98 A;  2X00 A;  4ZRU A;  3GUA A;  5AFL A;  2C9T A;  4AFT A;  4ZZB A;  5AFH A;  3ZKR A;  5AIN A;  2WNJ A;  5J5G A;  3RI5 A;  4XK9 A;  3WTJ A;  2BYR A;  4LML A;  4TWF A;  3RHW A;  3TLV A;  4COF A;  2YKS A;  3EI0 A;  5L47 A;  2VL0 A;  4IL9 A;  2Y7Y A;  5HEG A;  3RIF A;  3WTN A;  5HEO A;  4ZJT A;  4HQP A;  4ILB A;  3TLU A;  2XQ8 A;  1UX2 A;  2Y56 A;  2WNL A;  4ZJS A;  5AFN A;  2XYS A;  5BRX A;  2UZ6 A;  3U8L A;  4HFC A;  2XQ4 A;  2BJ0 A;  5CO5 A;  2X00 D;  4UXU A;  1UV6 A;  2BYQ A;  4ZZC A;  3UU8 A;  3C79 A;  5AFM B;  4X5T A;  5L4H A;  5AFJ A;  2BYP A;  5L4E A;  5BP0 A;  3EAM A;  3T4M A;  5AFM A;  5HEU A;  4QAC A;  4TNV A;  3WTK A;  4UM1 A;  2WZY A;  5HCM A;  2YN6 A;  2XQA A;  3JAE A;  2XQ3 A;  3EHZ A;  2ZJU A;  3SIO A;  4IL4 A;  3SQ9 A;  4B5D A;  3UQ7 A;  3U8N A;  2BYS A;  3TLW A;  4AFH A;  2BG9 B;  2Y58 A;  2XNV A;  2PH9 A;  2BG9 A;  2WNC A;  2ZJV A;  4D01 A;  1UW6 A;  4QH5 A;  4UM3 S;  2BG9 C;  4HFH A;  4NPP A;  4QAB A;  4IRE A;  3WTL A;  5HEJ A;  2XZ5 A;  4HFE A;  4QH1 A;  3U8M A;  4AFG A;  2BR8 A;  3PMZ A;  4QAA A;  1I9B A;  3ZDH A;  2BYN A;  2XZ6 A;  2XNU A;  3C84 A;  4BFQ A;  3UU6 A;  3RIA A;  3SQ6 A;  4UM3 A;  4NZB A;  4TNW A;  4F8H A;  4LMK A;  4ILC A;  3WIP A;  4BQT A;  3ZDG A;  4A97 A;  5J5I A;  4HFB A;  3WTI A;  4HFD A;  5FJV A;  2QC1 B;  3WTH A;  4UM3 P;  2BG9 E;  4WV9 A;  2XYT A;  3RQU A;  5KZU A;  3JAF A;  5HCJ A; 
#chains in the Genus database with same CATH topology
 3SH1 A;  5KE4 A;  4FRR A;  4UY2 A;  2XQ9 A;  2W8F A;  2YMD A;  4ZR6 A;  5HEH A;  3WTM A;  3P50 A;  5JME A;  2W8G A;  2Y54 A;  4XHE A;  4ILA A;  3UUB A;  2WN9 A;  2XNT A;  4QH4 A;  5AFK A;  4EZ1 A;  3WTO A;  3UU3 A;  5BW2 A;  4HFI A;  3UU5 A;  5LG3 A;  2XQ5 A;  2XQ7 A;  2YOE A;  4TWH A;  3UU4 A;  4Z90 A;  4DBM A;  4ZK1 A;  3LSV A;  3IGQ A;  4ZK4 A;  5TVC A;  5SYO A;  2BR7 A;  3RQW A;  4LMJ A;  3UQ4 A;  3PEO A;  3JAD A;  2XQ6 A;  4ALX A;  3TLS A;  3TLT A;  5LXB A;  5J0Z A;  3P4W A;  2PGZ A;  5IUX A;  4PIR A;  3U8K A;  5CFB A;  3U8J A;  5J5H A;  4TWD A;  4Z91 A;  2YME A;  5J5F A;  2Y57 A;  4A98 A;  2X00 A;  4ZRU A;  3GUA A;  5AFL A;  2C9T A;  4AFT A;  4ZZB A;  5AFH A;  3ZKR A;  5AIN A;  2WNJ A;  5J5G A;  3RI5 A;  4XK9 A;  3WTJ A;  2BYR A;  4LML A;  4TWF A;  3RHW A;  3TLV A;  4COF A;  2YKS A;  3EI0 A;  5L47 A;  2VL0 A;  4IL9 A;  2Y7Y A;  5HEG A;  3RIF A;  3WTN A;  5HEO A;  4ZJT A;  4HQP A;  4ILB A;  3TLU A;  2XQ8 A;  1UX2 A;  2Y56 A;  2WNL A;  4ZJS A;  5AFN A;  2XYS A;  5BRX A;  2UZ6 A;  3U8L A;  4HFC A;  2XQ4 A;  2BJ0 A;  5CO5 A;  2X00 D;  4UXU A;  1UV6 A;  2BYQ A;  4ZZC A;  3UU8 A;  3C79 A;  5AFM B;  4X5T A;  5L4H A;  5AFJ A;  2BYP A;  5L4E A;  5BP0 A;  3EAM A;  3T4M A;  5AFM A;  5HEU A;  4QAC A;  4TNV A;  3WTK A;  4UM1 A;  2WZY A;  5HCM A;  2YN6 A;  2XQA A;  3JAE A;  2XQ3 A;  3EHZ A;  2ZJU A;  3SIO A;  4IL4 A;  3SQ9 A;  4B5D A;  3UQ7 A;  3U8N A;  2BYS A;  3TLW A;  4AFH A;  2BG9 B;  2Y58 A;  2XNV A;  2PH9 A;  2BG9 A;  2WNC A;  2ZJV A;  4D01 A;  1UW6 A;  4QH5 A;  4UM3 S;  2BG9 C;  4HFH A;  4NPP A;  4QAB A;  4IRE A;  3WTL A;  5HEJ A;  2XZ5 A;  4HFE A;  4QH1 A;  3U8M A;  4AFG A;  2BR8 A;  3PMZ A;  4QAA A;  1I9B A;  3ZDH A;  2BYN A;  2XZ6 A;  2XNU A;  3C84 A;  4BFQ A;  3UU6 A;  3RIA A;  3SQ6 A;  4UM3 A;  4NZB A;  4TNW A;  4F8H A;  4LMK A;  4ILC A;  3WIP A;  4BQT A;  3ZDG A;  4A97 A;  5J5I A;  4HFB A;  3WTI A;  4HFD A;  5FJV A;  2QC1 B;  3WTH A;  4UM3 P;  2BG9 E;  4WV9 A;  2XYT A;  3RQU A;  5KZU A;  3JAF A;  5HCJ A; 
#chains in the Genus database with same CATH homology
 3SH1 A;  5KE4 A;  4FRR A;  4UY2 A;  2XQ9 A;  2W8F A;  2YMD A;  4ZR6 A;  5HEH A;  3WTM A;  3P50 A;  5JME A;  2W8G A;  2Y54 A;  4XHE A;  4ILA A;  3UUB A;  2WN9 A;  2XNT A;  4QH4 A;  5AFK A;  4EZ1 A;  3WTO A;  3UU3 A;  5BW2 A;  4HFI A;  3UU5 A;  5LG3 A;  2XQ5 A;  2XQ7 A;  2YOE A;  4TWH A;  3UU4 A;  4Z90 A;  4DBM A;  4ZK1 A;  3LSV A;  3IGQ A;  4ZK4 A;  5TVC A;  5SYO A;  2BR7 A;  3RQW A;  4LMJ A;  3UQ4 A;  3PEO A;  3JAD A;  2XQ6 A;  4ALX A;  3TLS A;  3TLT A;  5LXB A;  5J0Z A;  3P4W A;  2PGZ A;  5IUX A;  4PIR A;  3U8K A;  5CFB A;  3U8J A;  5J5H A;  4TWD A;  4Z91 A;  2YME A;  5J5F A;  2Y57 A;  4A98 A;  2X00 A;  4ZRU A;  3GUA A;  5AFL A;  2C9T A;  4AFT A;  4ZZB A;  5AFH A;  3ZKR A;  5AIN A;  2WNJ A;  5J5G A;  3RI5 A;  4XK9 A;  3WTJ A;  2BYR A;  4LML A;  4TWF A;  3RHW A;  3TLV A;  4COF A;  2YKS A;  3EI0 A;  5L47 A;  2VL0 A;  4IL9 A;  2Y7Y A;  5HEG A;  3RIF A;  3WTN A;  5HEO A;  4ZJT A;  4HQP A;  4ILB A;  3TLU A;  2XQ8 A;  1UX2 A;  2Y56 A;  2WNL A;  4ZJS A;  5AFN A;  2XYS A;  5BRX A;  2UZ6 A;  3U8L A;  4HFC A;  2XQ4 A;  2BJ0 A;  5CO5 A;  2X00 D;  4UXU A;  1UV6 A;  2BYQ A;  4ZZC A;  3UU8 A;  3C79 A;  5AFM B;  4X5T A;  5L4H A;  5AFJ A;  2BYP A;  5L4E A;  5BP0 A;  3EAM A;  3T4M A;  5AFM A;  5HEU A;  4QAC A;  4TNV A;  3WTK A;  4UM1 A;  2WZY A;  5HCM A;  2YN6 A;  2XQA A;  3JAE A;  2XQ3 A;  3EHZ A;  2ZJU A;  3SIO A;  4IL4 A;  3SQ9 A;  4B5D A;  3UQ7 A;  3U8N A;  2BYS A;  3TLW A;  4AFH A;  2BG9 B;  2Y58 A;  2XNV A;  2PH9 A;  2BG9 A;  2WNC A;  2ZJV A;  4D01 A;  1UW6 A;  4QH5 A;  4UM3 S;  2BG9 C;  4HFH A;  4NPP A;  4QAB A;  4IRE A;  3WTL A;  5HEJ A;  2XZ5 A;  4HFE A;  4QH1 A;  3U8M A;  4AFG A;  2BR8 A;  3PMZ A;  4QAA A;  1I9B A;  3ZDH A;  2BYN A;  2XZ6 A;  2XNU A;  3C84 A;  4BFQ A;  3UU6 A;  3RIA A;  3SQ6 A;  4UM3 A;  4NZB A;  4TNW A;  4F8H A;  4LMK A;  4ILC A;  3WIP A;  4BQT A;  3ZDG A;  4A97 A;  5J5I A;  4HFB A;  3WTI A;  4HFD A;  5FJV A;  2QC1 B;  3WTH A;  4UM3 P;  2BG9 E;  4WV9 A;  2XYT A;  3RQU A;  5KZU A;  3JAF A;  5HCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...