2XNTA

Acetylcholine binding protein (achbp) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Acetylcholine Binding Protein (Achbp) as Template for Hierarchical in Silico Screening Procedures to Identify Structurally Novel Ligands for the Nicotinic Receptors.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xntA00
3C84A 4QACA 2BG9A 3PMZA 4ZZCA 2XYSA 3P50A 5CFBA 3RQUA 3UU3A 4IL9A 5HCMA 4AFGA 5J5IA 3PEOA 2XQ5A 4AFHA 4ZJTA 5J5FA 2YMDA 3TLVA 3TLWA 2YKSA 4ZRUA 3LSVA 3U8KA 5AINA 5AFMB 2X00A 3C79A 4B5DA 5KZUA 2XQ7A 5L47A 5BP0A 2BYPA 3JAEA 2XZ6A 3U8JA 4TNVA 4ZJSA 3U8MA 3WTNA 2XNVA 4QAAA 3UQ7A 4QH4A 4QH1A 3WTMA 4WV9A 4QABA 1UX2A 3WIPA 2BYRA 3UU6A 3SIOA 3WTOA 3UU4A 2BG9C 3RI5A 3EI0A 5J5GA 4A97A 5LG3A 2BR8A 4DBMA 2WNLA 4HFIA 3U8LA 4F8HA 4ZZBA 2XQ9A 4UM3A 4Z90A 4FRRA 4TWHA 4LMKA 3TLSA 3IGQA 2PGZA 4UM3P 4ILAA 3RIAA 2Y58A 2W8GA 3SQ6A 5TVCA 3RHWA 5CO5A 3U8NA 4ZK1A 4Z91A 5BRXA 2XQAA 4LMJA 2XNUA 2XZ5A 5L4HA 3ZDHA 2WN9A 1UW6A 2XQ3A 5HEGA 3SQ9A 3ZKRA 2VL0A 3SH1A 3UQ4A 3TLUA 2Y7YA 2WNCA 2PH9A 3UU8A 5AFNA 2BYQA 2QC1B 4NPPA 3ZDGA 4ILBA 5SYOA 3WTLA 4COFA 5HCJA 5J5HA 2ZJVA 5FJVA 3P4WA 4PIRA 2BYNA 5IUXA 2BR7A 2YOEA 5AFKA 3EAMA 3TLTA 4HFHA 3WTHA 3WTJA 2Y54A 4TWDA 5HEUA 4UM3S 2BG9B 4BFQA 3GUAA 5AFJA 3UUBA 3T4MA 1I9BA 3RQWA 4ZK4A 3UU5A 4HFDA 4X5TA 1UV6A 4XHEA 5J0ZA 5BW2A 4IL4A 4D01A 5HEHA 4HFCA 4BQTA 5AFHA 2BG9E 2XNTA 2XYTA 4UM1A 2WZYA 4LMLA 2C9TA 4HFEA 4ILCA 3JAFA 5AFLA 5L4EA 2XQ4A 2Y56A 2XQ6A 2X00D 3RIFA 3JADA 5AFMA 3EHZA 4UY2A 2W8FA 2WNJA 4UXUA 4IREA 2BJ0A 4A98A 4ZR6A 3WTIA 4AFTA 4HFBA 5HEOA 2XQ8A 4NZBA 4TWFA 5JMEA 2BYSA 2Y57A 5KE4A 2UZ6A 4HQPA 4EZ1A 3WTKA 5LXBA 4TNWA 4QH5A 4ALXA 4XK9A 2YMEA 2YN6A 5HEJA 2ZJUA
chains in the Genus database with same CATH superfamily
3C84A 4QACA 2BG9A 3PMZA 4ZZCA 2XYSA 3P50A 5CFBA 3RQUA 3UU3A 4IL9A 5HCMA 4AFGA 5J5IA 3PEOA 2XQ5A 4AFHA 4ZJTA 5J5FA 2YMDA 3TLVA 3TLWA 2YKSA 4ZRUA 3LSVA 3U8KA 5AINA 5AFMB 2X00A 3C79A 4B5DA 5KZUA 2XQ7A 5L47A 5BP0A 2BYPA 3JAEA 2XZ6A 3U8JA 4TNVA 4ZJSA 3U8MA 3WTNA 2XNVA 4QAAA 3UQ7A 4QH4A 4QH1A 3WTMA 4WV9A 4QABA 1UX2A 3WIPA 2BYRA 3UU6A 3SIOA 3WTOA 3UU4A 2BG9C 3RI5A 3EI0A 5J5GA 4A97A 5LG3A 2BR8A 4DBMA 2WNLA 4HFIA 3U8LA 4F8HA 4ZZBA 2XQ9A 4UM3A 4Z90A 4FRRA 4TWHA 4LMKA 3TLSA 3IGQA 2PGZA 4UM3P 4ILAA 3RIAA 2Y58A 2W8GA 3SQ6A 5TVCA 3RHWA 5CO5A 3U8NA 4ZK1A 4Z91A 5BRXA 2XQAA 4LMJA 2XNUA 2XZ5A 5L4HA 3ZDHA 2WN9A 1UW6A 2XQ3A 5HEGA 3SQ9A 3ZKRA 2VL0A 3SH1A 3UQ4A 3TLUA 2Y7YA 2WNCA 2PH9A 3UU8A 5AFNA 2BYQA 2QC1B 4NPPA 3ZDGA 4ILBA 5SYOA 3WTLA 4COFA 5HCJA 5J5HA 2ZJVA 5FJVA 3P4WA 4PIRA 2BYNA 5IUXA 2BR7A 2YOEA 5AFKA 3EAMA 3TLTA 4HFHA 3WTHA 3WTJA 2Y54A 4TWDA 5HEUA 4UM3S 2BG9B 4BFQA 3GUAA 5AFJA 3UUBA 3T4MA 1I9BA 3RQWA 4ZK4A 3UU5A 4HFDA 4X5TA 1UV6A 4XHEA 5J0ZA 5BW2A 4IL4A 4D01A 5HEHA 4HFCA 4BQTA 5AFHA 2BG9E 2XNTA 2XYTA 4UM1A 2WZYA 4LMLA 2C9TA 4HFEA 4ILCA 3JAFA 5AFLA 5L4EA 2XQ4A 2Y56A 2XQ6A 2X00D 3RIFA 3JADA 5AFMA 3EHZA 4UY2A 2W8FA 2WNJA 4UXUA 4IREA 2BJ0A 4A98A 4ZR6A 3WTIA 4AFTA 4HFBA 5HEOA 2XQ8A 4NZBA 4TWFA 5JMEA 2BYSA 2Y57A 5KE4A 2UZ6A 4HQPA 4EZ1A 3WTKA 5LXBA 4TNWA 4QH5A 4ALXA 4XK9A 2YMEA 2YN6A 5HEJA 2ZJUA
chains in the Genus database with same CATH topology
3C84A 4QACA 2BG9A 3PMZA 4ZZCA 2XYSA 3P50A 5CFBA 3RQUA 3UU3A 4IL9A 5HCMA 4AFGA 5J5IA 3PEOA 2XQ5A 4AFHA 4ZJTA 5J5FA 2YMDA 3TLVA 3TLWA 2YKSA 4ZRUA 3LSVA 3U8KA 5AINA 5AFMB 2X00A 3C79A 4B5DA 5KZUA 2XQ7A 5L47A 5BP0A 2BYPA 3JAEA 2XZ6A 3U8JA 4TNVA 4ZJSA 3U8MA 3WTNA 2XNVA 4QAAA 3UQ7A 4QH4A 4QH1A 3WTMA 4WV9A 4QABA 1UX2A 3WIPA 2BYRA 3UU6A 3SIOA 3WTOA 3UU4A 2BG9C 3RI5A 3EI0A 5J5GA 4A97A 5LG3A 2BR8A 4DBMA 2WNLA 4HFIA 3U8LA 4F8HA 4ZZBA 2XQ9A 4UM3A 4Z90A 4FRRA 4TWHA 4LMKA 3TLSA 3IGQA 2PGZA 4UM3P 4ILAA 3RIAA 2Y58A 2W8GA 3SQ6A 5TVCA 3RHWA 5CO5A 3U8NA 4ZK1A 4Z91A 5BRXA 2XQAA 4LMJA 2XNUA 2XZ5A 5L4HA 3ZDHA 2WN9A 1UW6A 2XQ3A 5HEGA 3SQ9A 3ZKRA 2VL0A 3SH1A 3UQ4A 3TLUA 2Y7YA 2WNCA 2PH9A 3UU8A 5AFNA 2BYQA 2QC1B 4NPPA 3ZDGA 4ILBA 5SYOA 3WTLA 4COFA 5HCJA 5J5HA 2ZJVA 5FJVA 3P4WA 4PIRA 2BYNA 5IUXA 2BR7A 2YOEA 5AFKA 3EAMA 3TLTA 4HFHA 3WTHA 3WTJA 2Y54A 4TWDA 5HEUA 4UM3S 2BG9B 4BFQA 3GUAA 5AFJA 3UUBA 3T4MA 1I9BA 3RQWA 4ZK4A 3UU5A 4HFDA 4X5TA 1UV6A 4XHEA 5J0ZA 5BW2A 4IL4A 4D01A 5HEHA 4HFCA 4BQTA 5AFHA 2BG9E 2XNTA 2XYTA 4UM1A 2WZYA 4LMLA 2C9TA 4HFEA 4ILCA 3JAFA 5AFLA 5L4EA 2XQ4A 2Y56A 2XQ6A 2X00D 3RIFA 3JADA 5AFMA 3EHZA 4UY2A 2W8FA 2WNJA 4UXUA 4IREA 2BJ0A 4A98A 4ZR6A 3WTIA 4AFTA 4HFBA 5HEOA 2XQ8A 4NZBA 4TWFA 5JMEA 2BYSA 2Y57A 5KE4A 2UZ6A 4HQPA 4EZ1A 3WTKA 5LXBA 4TNWA 4QH5A 4ALXA 4XK9A 2YMEA 2YN6A 5HEJA 2ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C84 A;  4QAC A;  2BG9 A;  3PMZ A;  4ZZC A;  2XYS A;  3P50 A;  5CFB A;  3RQU A;  3UU3 A;  4IL9 A;  5HCM A;  4AFG A;  5J5I A;  3PEO A;  2XQ5 A;  4AFH A;  4ZJT A;  5J5F A;  2YMD A;  3TLV A;  3TLW A;  2YKS A;  4ZRU A;  3LSV A;  3U8K A;  5AIN A;  5AFM B;  2X00 A;  3C79 A;  4B5D A;  5KZU A;  2XQ7 A;  5L47 A;  5BP0 A;  2BYP A;  3JAE A;  2XZ6 A;  3U8J A;  4TNV A;  4ZJS A;  3U8M A;  3WTN A;  2XNV A;  4QAA A;  3UQ7 A;  4QH4 A;  4QH1 A;  3WTM A;  4WV9 A;  4QAB A;  1UX2 A;  3WIP A;  2BYR A;  3UU6 A;  3SIO A;  3WTO A;  3UU4 A;  2BG9 C;  3RI5 A;  3EI0 A;  5J5G A;  4A97 A;  5LG3 A;  2BR8 A;  4DBM A;  2WNL A;  4HFI A;  3U8L A;  4F8H A;  4ZZB A;  2XQ9 A;  4UM3 A;  4Z90 A;  4FRR A;  4TWH A;  4LMK A;  3TLS A;  3IGQ A;  2PGZ A;  4UM3 P;  4ILA A;  3RIA A;  2Y58 A;  2W8G A;  3SQ6 A;  5TVC A;  3RHW A;  5CO5 A;  3U8N A;  4ZK1 A;  4Z91 A;  5BRX A;  2XQA A;  4LMJ A;  2XNU A;  2XZ5 A;  5L4H A;  3ZDH A;  2WN9 A;  1UW6 A;  2XQ3 A;  5HEG A;  3SQ9 A;  3ZKR A;  2VL0 A;  3SH1 A;  3UQ4 A;  3TLU A;  2Y7Y A;  2WNC A;  2PH9 A;  3UU8 A;  5AFN A;  2BYQ A;  2QC1 B;  4NPP A;  3ZDG A;  4ILB A;  5SYO A;  3WTL A;  4COF A;  5HCJ A;  5J5H A;  2ZJV A;  5FJV A;  3P4W A;  4PIR A;  2BYN A;  5IUX A;  2BR7 A;  2YOE A;  5AFK A;  3EAM A;  3TLT A;  4HFH A;  3WTH A;  3WTJ A;  2Y54 A;  4TWD A;  5HEU A;  4UM3 S;  2BG9 B;  4BFQ A;  3GUA A;  5AFJ A;  3UUB A;  3T4M A;  1I9B A;  3RQW A;  4ZK4 A;  3UU5 A;  4HFD A;  4X5T A;  1UV6 A;  4XHE A;  5J0Z A;  5BW2 A;  4IL4 A;  4D01 A;  5HEH A;  4HFC A;  4BQT A;  5AFH A;  2BG9 E;  2XNT A;  2XYT A;  4UM1 A;  2WZY A;  4LML A;  2C9T A;  4HFE A;  4ILC A;  3JAF A;  5AFL A;  5L4E A;  2XQ4 A;  2Y56 A;  2XQ6 A;  2X00 D;  3RIF A;  3JAD A;  5AFM A;  3EHZ A;  4UY2 A;  2W8F A;  2WNJ A;  4UXU A;  4IRE A;  2BJ0 A;  4A98 A;  4ZR6 A;  3WTI A;  4AFT A;  4HFB A;  5HEO A;  2XQ8 A;  4NZB A;  4TWF A;  5JME A;  2BYS A;  2Y57 A;  5KE4 A;  2UZ6 A;  4HQP A;  4EZ1 A;  3WTK A;  5LXB A;  4TNW A;  4QH5 A;  4ALX A;  4XK9 A;  2YME A;  2YN6 A;  5HEJ A;  2ZJU A; 
#chains in the Genus database with same CATH topology
 3C84 A;  4QAC A;  2BG9 A;  3PMZ A;  4ZZC A;  2XYS A;  3P50 A;  5CFB A;  3RQU A;  3UU3 A;  4IL9 A;  5HCM A;  4AFG A;  5J5I A;  3PEO A;  2XQ5 A;  4AFH A;  4ZJT A;  5J5F A;  2YMD A;  3TLV A;  3TLW A;  2YKS A;  4ZRU A;  3LSV A;  3U8K A;  5AIN A;  5AFM B;  2X00 A;  3C79 A;  4B5D A;  5KZU A;  2XQ7 A;  5L47 A;  5BP0 A;  2BYP A;  3JAE A;  2XZ6 A;  3U8J A;  4TNV A;  4ZJS A;  3U8M A;  3WTN A;  2XNV A;  4QAA A;  3UQ7 A;  4QH4 A;  4QH1 A;  3WTM A;  4WV9 A;  4QAB A;  1UX2 A;  3WIP A;  2BYR A;  3UU6 A;  3SIO A;  3WTO A;  3UU4 A;  2BG9 C;  3RI5 A;  3EI0 A;  5J5G A;  4A97 A;  5LG3 A;  2BR8 A;  4DBM A;  2WNL A;  4HFI A;  3U8L A;  4F8H A;  4ZZB A;  2XQ9 A;  4UM3 A;  4Z90 A;  4FRR A;  4TWH A;  4LMK A;  3TLS A;  3IGQ A;  2PGZ A;  4UM3 P;  4ILA A;  3RIA A;  2Y58 A;  2W8G A;  3SQ6 A;  5TVC A;  3RHW A;  5CO5 A;  3U8N A;  4ZK1 A;  4Z91 A;  5BRX A;  2XQA A;  4LMJ A;  2XNU A;  2XZ5 A;  5L4H A;  3ZDH A;  2WN9 A;  1UW6 A;  2XQ3 A;  5HEG A;  3SQ9 A;  3ZKR A;  2VL0 A;  3SH1 A;  3UQ4 A;  3TLU A;  2Y7Y A;  2WNC A;  2PH9 A;  3UU8 A;  5AFN A;  2BYQ A;  2QC1 B;  4NPP A;  3ZDG A;  4ILB A;  5SYO A;  3WTL A;  4COF A;  5HCJ A;  5J5H A;  2ZJV A;  5FJV A;  3P4W A;  4PIR A;  2BYN A;  5IUX A;  2BR7 A;  2YOE A;  5AFK A;  3EAM A;  3TLT A;  4HFH A;  3WTH A;  3WTJ A;  2Y54 A;  4TWD A;  5HEU A;  4UM3 S;  2BG9 B;  4BFQ A;  3GUA A;  5AFJ A;  3UUB A;  3T4M A;  1I9B A;  3RQW A;  4ZK4 A;  3UU5 A;  4HFD A;  4X5T A;  1UV6 A;  4XHE A;  5J0Z A;  5BW2 A;  4IL4 A;  4D01 A;  5HEH A;  4HFC A;  4BQT A;  5AFH A;  2BG9 E;  2XNT A;  2XYT A;  4UM1 A;  2WZY A;  4LML A;  2C9T A;  4HFE A;  4ILC A;  3JAF A;  5AFL A;  5L4E A;  2XQ4 A;  2Y56 A;  2XQ6 A;  2X00 D;  3RIF A;  3JAD A;  5AFM A;  3EHZ A;  4UY2 A;  2W8F A;  2WNJ A;  4UXU A;  4IRE A;  2BJ0 A;  4A98 A;  4ZR6 A;  3WTI A;  4AFT A;  4HFB A;  5HEO A;  2XQ8 A;  4NZB A;  4TWF A;  5JME A;  2BYS A;  2Y57 A;  5KE4 A;  2UZ6 A;  4HQP A;  4EZ1 A;  3WTK A;  5LXB A;  4TNW A;  4QH5 A;  4ALX A;  4XK9 A;  2YME A;  2YN6 A;  5HEJ A;  2ZJU A; 
#chains in the Genus database with same CATH homology
 3C84 A;  4QAC A;  2BG9 A;  3PMZ A;  4ZZC A;  2XYS A;  3P50 A;  5CFB A;  3RQU A;  3UU3 A;  4IL9 A;  5HCM A;  4AFG A;  5J5I A;  3PEO A;  2XQ5 A;  4AFH A;  4ZJT A;  5J5F A;  2YMD A;  3TLV A;  3TLW A;  2YKS A;  4ZRU A;  3LSV A;  3U8K A;  5AIN A;  5AFM B;  2X00 A;  3C79 A;  4B5D A;  5KZU A;  2XQ7 A;  5L47 A;  5BP0 A;  2BYP A;  3JAE A;  2XZ6 A;  3U8J A;  4TNV A;  4ZJS A;  3U8M A;  3WTN A;  2XNV A;  4QAA A;  3UQ7 A;  4QH4 A;  4QH1 A;  3WTM A;  4WV9 A;  4QAB A;  1UX2 A;  3WIP A;  2BYR A;  3UU6 A;  3SIO A;  3WTO A;  3UU4 A;  2BG9 C;  3RI5 A;  3EI0 A;  5J5G A;  4A97 A;  5LG3 A;  2BR8 A;  4DBM A;  2WNL A;  4HFI A;  3U8L A;  4F8H A;  4ZZB A;  2XQ9 A;  4UM3 A;  4Z90 A;  4FRR A;  4TWH A;  4LMK A;  3TLS A;  3IGQ A;  2PGZ A;  4UM3 P;  4ILA A;  3RIA A;  2Y58 A;  2W8G A;  3SQ6 A;  5TVC A;  3RHW A;  5CO5 A;  3U8N A;  4ZK1 A;  4Z91 A;  5BRX A;  2XQA A;  4LMJ A;  2XNU A;  2XZ5 A;  5L4H A;  3ZDH A;  2WN9 A;  1UW6 A;  2XQ3 A;  5HEG A;  3SQ9 A;  3ZKR A;  2VL0 A;  3SH1 A;  3UQ4 A;  3TLU A;  2Y7Y A;  2WNC A;  2PH9 A;  3UU8 A;  5AFN A;  2BYQ A;  2QC1 B;  4NPP A;  3ZDG A;  4ILB A;  5SYO A;  3WTL A;  4COF A;  5HCJ A;  5J5H A;  2ZJV A;  5FJV A;  3P4W A;  4PIR A;  2BYN A;  5IUX A;  2BR7 A;  2YOE A;  5AFK A;  3EAM A;  3TLT A;  4HFH A;  3WTH A;  3WTJ A;  2Y54 A;  4TWD A;  5HEU A;  4UM3 S;  2BG9 B;  4BFQ A;  3GUA A;  5AFJ A;  3UUB A;  3T4M A;  1I9B A;  3RQW A;  4ZK4 A;  3UU5 A;  4HFD A;  4X5T A;  1UV6 A;  4XHE A;  5J0Z A;  5BW2 A;  4IL4 A;  4D01 A;  5HEH A;  4HFC A;  4BQT A;  5AFH A;  2BG9 E;  2XNT A;  2XYT A;  4UM1 A;  2WZY A;  4LML A;  2C9T A;  4HFE A;  4ILC A;  3JAF A;  5AFL A;  5L4E A;  2XQ4 A;  2Y56 A;  2XQ6 A;  2X00 D;  3RIF A;  3JAD A;  5AFM A;  3EHZ A;  4UY2 A;  2W8F A;  2WNJ A;  4UXU A;  4IRE A;  2BJ0 A;  4A98 A;  4ZR6 A;  3WTI A;  4AFT A;  4HFB A;  5HEO A;  2XQ8 A;  4NZB A;  4TWF A;  5JME A;  2BYS A;  2Y57 A;  5KE4 A;  2UZ6 A;  4HQP A;  4EZ1 A;  3WTK A;  5LXB A;  4TNW A;  4QH5 A;  4ALX A;  4XK9 A;  2YME A;  2YN6 A;  5HEJ A;  2ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...