3SIOA

Ac-achbp ligand binding domain (not including beta 9-10 linker) mutated to human alpha-7 nachr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVYLSFSLLDIVKADSSTNEVDLVYWEQQSWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVNSSGHVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYGGWEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 53
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3sioA00
3U8KA 5AFJA 3UU5A 3T4MA 4QH4A 4B5DA 4LMJA 2YOEA 5CO5A 2VL0A 2C9TA 4QAAA 1UX2A 2XYSA 4XHEA 3WTNA 4Z90A 4BQTA 5LXBA 5BW2A 3WTLA 4ZK1A 3C84A 3WTMA 4ZJTA 2Y58A 5CFBA 5SYOA 4QH1A 2W8FA 4ALXA 4UXUA 2XQ9A 3EI0A 3ZDGA 4BFQA 3U8JA 4UM3P 4XK9A 5AFNA 4HFBA 2BYNA 4QH5A 4DBMA 5TVCA 4PIRA 3SQ6A 2XNVA 5HEUA 4A98A 3EHZA 4ZR6A 3GUAA 4EZ1A 5J5HA 3EAMA 3ZDHA 3UQ7A 5AFMA 3UU3A 3WIPA 2BG9B 3TLUA 2XZ6A 3U8MA 3RQWA 4ZZBA 3U8LA 5HEJA 2XNUA 4IL9A 5L4HA 2BYSA 4UM3S 4AFGA 2BJ0A 3TLVA 3TLSA 5J0ZA 5HEOA 3RHWA 3UU8A 3RIAA 5J5GA 2X00D 5HCJA 3WTIA 2XZ5A 5HEHA 4IREA 2XQ8A 2Y7YA 4ZZCA 4UM1A 3PMZA 3UQ4A 2BYPA 2YN6A 3RI5A 4HFIA 4FRRA 4ILCA 3WTJA 2XQ4A 1UV6A 4HFCA 3SQ9A 2WNCA 5L47A 5LG3A 3P4WA 4WV9A 5AFHA 2Y57A 5J5IA 5AFMB 2YMDA 3IGQA 4AFTA 2ZJVA 2W8GA 3SIOA 5AFKA 2Y54A 5J5FA 4TWFA 2XNTA 3SH1A 2BR8A 3UU4A 4NPPA 2XQ5A 4X5TA 2XQ6A 4UM3A 5IUXA 2YKSA 4TNVA 4ZJSA 2XQAA 2YMEA 4ZK4A 2XQ7A 3UU6A 2WZYA 3TLTA 1I9BA 5BP0A 2ZJUA 3UUBA 5JMEA 2XQ3A 4D01A 4TWDA 3WTOA 2BR7A 2X00A 5AFLA 4HFEA 4QACA 2Y56A 4HFDA 4LMLA 4ZRUA 5KZUA 2BG9A 3P50A 4TNWA 4QABA 5FJVA 5HEGA 3LSVA 4LMKA 4AFHA 5BRXA 2WN9A 2BYRA 2XYTA 3U8NA 4Z91A 4F8HA 4HFHA 4ILBA 4UY2A 2WNJA 3RQUA 3WTKA 3TLWA 2BG9E 4COFA 3ZKRA 3C79A 2UZ6A 4ILAA 2BG9C 3JAEA 5KE4A 2BYQA 3WTHA 1UW6A 5L4EA 3RIFA 5HCMA 4NZBA 3PEOA 3JADA 3JAFA 5AINA 4A97A 2PH9A 2WNLA 4TWHA 2PGZA 2QC1B 4HQPA 4IL4A
chains in the Genus database with same CATH superfamily
3U8KA 5AFJA 3UU5A 3T4MA 4QH4A 4B5DA 4LMJA 2YOEA 5CO5A 2VL0A 2C9TA 4QAAA 1UX2A 2XYSA 4XHEA 3WTNA 4Z90A 4BQTA 5LXBA 5BW2A 3WTLA 4ZK1A 3C84A 3WTMA 4ZJTA 2Y58A 5CFBA 5SYOA 4QH1A 2W8FA 4ALXA 4UXUA 2XQ9A 3EI0A 3ZDGA 4BFQA 3U8JA 4UM3P 4XK9A 5AFNA 4HFBA 2BYNA 4QH5A 4DBMA 5TVCA 4PIRA 3SQ6A 2XNVA 5HEUA 4A98A 3EHZA 4ZR6A 3GUAA 4EZ1A 5J5HA 3EAMA 3ZDHA 3UQ7A 5AFMA 3UU3A 3WIPA 2BG9B 3TLUA 2XZ6A 3U8MA 3RQWA 4ZZBA 3U8LA 5HEJA 2XNUA 4IL9A 5L4HA 2BYSA 4UM3S 4AFGA 2BJ0A 3TLVA 3TLSA 5J0ZA 5HEOA 3RHWA 3UU8A 3RIAA 5J5GA 2X00D 5HCJA 3WTIA 2XZ5A 5HEHA 4IREA 2XQ8A 2Y7YA 4ZZCA 4UM1A 3PMZA 3UQ4A 2BYPA 2YN6A 3RI5A 4HFIA 4FRRA 4ILCA 3WTJA 2XQ4A 1UV6A 4HFCA 3SQ9A 2WNCA 5L47A 5LG3A 3P4WA 4WV9A 5AFHA 2Y57A 5J5IA 5AFMB 2YMDA 3IGQA 4AFTA 2ZJVA 2W8GA 3SIOA 5AFKA 2Y54A 5J5FA 4TWFA 2XNTA 3SH1A 2BR8A 3UU4A 4NPPA 2XQ5A 4X5TA 2XQ6A 4UM3A 5IUXA 2YKSA 4TNVA 4ZJSA 2XQAA 2YMEA 4ZK4A 2XQ7A 3UU6A 2WZYA 3TLTA 1I9BA 5BP0A 2ZJUA 3UUBA 5JMEA 2XQ3A 4D01A 4TWDA 3WTOA 2BR7A 2X00A 5AFLA 4HFEA 4QACA 2Y56A 4HFDA 4LMLA 4ZRUA 5KZUA 2BG9A 3P50A 4TNWA 4QABA 5FJVA 5HEGA 3LSVA 4LMKA 4AFHA 5BRXA 2WN9A 2BYRA 2XYTA 3U8NA 4Z91A 4F8HA 4HFHA 4ILBA 4UY2A 2WNJA 3RQUA 3WTKA 3TLWA 2BG9E 4COFA 3ZKRA 3C79A 2UZ6A 4ILAA 2BG9C 3JAEA 5KE4A 2BYQA 3WTHA 1UW6A 5L4EA 3RIFA 5HCMA 4NZBA 3PEOA 3JADA 3JAFA 5AINA 4A97A 2PH9A 2WNLA 4TWHA 2PGZA 2QC1B 4HQPA 4IL4A
chains in the Genus database with same CATH topology
3U8KA 5AFJA 3UU5A 3T4MA 4QH4A 4B5DA 4LMJA 2YOEA 5CO5A 2VL0A 2C9TA 4QAAA 1UX2A 2XYSA 4XHEA 3WTNA 4Z90A 4BQTA 5LXBA 5BW2A 3WTLA 4ZK1A 3C84A 3WTMA 4ZJTA 2Y58A 5CFBA 5SYOA 4QH1A 2W8FA 4ALXA 4UXUA 2XQ9A 3EI0A 3ZDGA 4BFQA 3U8JA 4UM3P 4XK9A 5AFNA 4HFBA 2BYNA 4QH5A 4DBMA 5TVCA 4PIRA 3SQ6A 2XNVA 5HEUA 4A98A 3EHZA 4ZR6A 3GUAA 4EZ1A 5J5HA 3EAMA 3ZDHA 3UQ7A 5AFMA 3UU3A 3WIPA 2BG9B 3TLUA 2XZ6A 3U8MA 3RQWA 4ZZBA 3U8LA 5HEJA 2XNUA 4IL9A 5L4HA 2BYSA 4UM3S 4AFGA 2BJ0A 3TLVA 3TLSA 5J0ZA 5HEOA 3RHWA 3UU8A 3RIAA 5J5GA 2X00D 5HCJA 3WTIA 2XZ5A 5HEHA 4IREA 2XQ8A 2Y7YA 4ZZCA 4UM1A 3PMZA 3UQ4A 2BYPA 2YN6A 3RI5A 4HFIA 4FRRA 4ILCA 3WTJA 2XQ4A 1UV6A 4HFCA 3SQ9A 2WNCA 5L47A 5LG3A 3P4WA 4WV9A 5AFHA 2Y57A 5J5IA 5AFMB 2YMDA 3IGQA 4AFTA 2ZJVA 2W8GA 3SIOA 5AFKA 2Y54A 5J5FA 4TWFA 2XNTA 3SH1A 2BR8A 3UU4A 4NPPA 2XQ5A 4X5TA 2XQ6A 4UM3A 5IUXA 2YKSA 4TNVA 4ZJSA 2XQAA 2YMEA 4ZK4A 2XQ7A 3UU6A 2WZYA 3TLTA 1I9BA 5BP0A 2ZJUA 3UUBA 5JMEA 2XQ3A 4D01A 4TWDA 3WTOA 2BR7A 2X00A 5AFLA 4HFEA 4QACA 2Y56A 4HFDA 4LMLA 4ZRUA 5KZUA 2BG9A 3P50A 4TNWA 4QABA 5FJVA 5HEGA 3LSVA 4LMKA 4AFHA 5BRXA 2WN9A 2BYRA 2XYTA 3U8NA 4Z91A 4F8HA 4HFHA 4ILBA 4UY2A 2WNJA 3RQUA 3WTKA 3TLWA 2BG9E 4COFA 3ZKRA 3C79A 2UZ6A 4ILAA 2BG9C 3JAEA 5KE4A 2BYQA 3WTHA 1UW6A 5L4EA 3RIFA 5HCMA 4NZBA 3PEOA 3JADA 3JAFA 5AINA 4A97A 2PH9A 2WNLA 4TWHA 2PGZA 2QC1B 4HQPA 4IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8K A;  5AFJ A;  3UU5 A;  3T4M A;  4QH4 A;  4B5D A;  4LMJ A;  2YOE A;  5CO5 A;  2VL0 A;  2C9T A;  4QAA A;  1UX2 A;  2XYS A;  4XHE A;  3WTN A;  4Z90 A;  4BQT A;  5LXB A;  5BW2 A;  3WTL A;  4ZK1 A;  3C84 A;  3WTM A;  4ZJT A;  2Y58 A;  5CFB A;  5SYO A;  4QH1 A;  2W8F A;  4ALX A;  4UXU A;  2XQ9 A;  3EI0 A;  3ZDG A;  4BFQ A;  3U8J A;  4UM3 P;  4XK9 A;  5AFN A;  4HFB A;  2BYN A;  4QH5 A;  4DBM A;  5TVC A;  4PIR A;  3SQ6 A;  2XNV A;  5HEU A;  4A98 A;  3EHZ A;  4ZR6 A;  3GUA A;  4EZ1 A;  5J5H A;  3EAM A;  3ZDH A;  3UQ7 A;  5AFM A;  3UU3 A;  3WIP A;  2BG9 B;  3TLU A;  2XZ6 A;  3U8M A;  3RQW A;  4ZZB A;  3U8L A;  5HEJ A;  2XNU A;  4IL9 A;  5L4H A;  2BYS A;  4UM3 S;  4AFG A;  2BJ0 A;  3TLV A;  3TLS A;  5J0Z A;  5HEO A;  3RHW A;  3UU8 A;  3RIA A;  5J5G A;  2X00 D;  5HCJ A;  3WTI A;  2XZ5 A;  5HEH A;  4IRE A;  2XQ8 A;  2Y7Y A;  4ZZC A;  4UM1 A;  3PMZ A;  3UQ4 A;  2BYP A;  2YN6 A;  3RI5 A;  4HFI A;  4FRR A;  4ILC A;  3WTJ A;  2XQ4 A;  1UV6 A;  4HFC A;  3SQ9 A;  2WNC A;  5L47 A;  5LG3 A;  3P4W A;  4WV9 A;  5AFH A;  2Y57 A;  5J5I A;  5AFM B;  2YMD A;  3IGQ A;  4AFT A;  2ZJV A;  2W8G A;  3SIO A;  5AFK A;  2Y54 A;  5J5F A;  4TWF A;  2XNT A;  3SH1 A;  2BR8 A;  3UU4 A;  4NPP A;  2XQ5 A;  4X5T A;  2XQ6 A;  4UM3 A;  5IUX A;  2YKS A;  4TNV A;  4ZJS A;  2XQA A;  2YME A;  4ZK4 A;  2XQ7 A;  3UU6 A;  2WZY A;  3TLT A;  1I9B A;  5BP0 A;  2ZJU A;  3UUB A;  5JME A;  2XQ3 A;  4D01 A;  4TWD A;  3WTO A;  2BR7 A;  2X00 A;  5AFL A;  4HFE A;  4QAC A;  2Y56 A;  4HFD A;  4LML A;  4ZRU A;  5KZU A;  2BG9 A;  3P50 A;  4TNW A;  4QAB A;  5FJV A;  5HEG A;  3LSV A;  4LMK A;  4AFH A;  5BRX A;  2WN9 A;  2BYR A;  2XYT A;  3U8N A;  4Z91 A;  4F8H A;  4HFH A;  4ILB A;  4UY2 A;  2WNJ A;  3RQU A;  3WTK A;  3TLW A;  2BG9 E;  4COF A;  3ZKR A;  3C79 A;  2UZ6 A;  4ILA A;  2BG9 C;  3JAE A;  5KE4 A;  2BYQ A;  3WTH A;  1UW6 A;  5L4E A;  3RIF A;  5HCM A;  4NZB A;  3PEO A;  3JAD A;  3JAF A;  5AIN A;  4A97 A;  2PH9 A;  2WNL A;  4TWH A;  2PGZ A;  2QC1 B;  4HQP A;  4IL4 A; 
#chains in the Genus database with same CATH topology
 3U8K A;  5AFJ A;  3UU5 A;  3T4M A;  4QH4 A;  4B5D A;  4LMJ A;  2YOE A;  5CO5 A;  2VL0 A;  2C9T A;  4QAA A;  1UX2 A;  2XYS A;  4XHE A;  3WTN A;  4Z90 A;  4BQT A;  5LXB A;  5BW2 A;  3WTL A;  4ZK1 A;  3C84 A;  3WTM A;  4ZJT A;  2Y58 A;  5CFB A;  5SYO A;  4QH1 A;  2W8F A;  4ALX A;  4UXU A;  2XQ9 A;  3EI0 A;  3ZDG A;  4BFQ A;  3U8J A;  4UM3 P;  4XK9 A;  5AFN A;  4HFB A;  2BYN A;  4QH5 A;  4DBM A;  5TVC A;  4PIR A;  3SQ6 A;  2XNV A;  5HEU A;  4A98 A;  3EHZ A;  4ZR6 A;  3GUA A;  4EZ1 A;  5J5H A;  3EAM A;  3ZDH A;  3UQ7 A;  5AFM A;  3UU3 A;  3WIP A;  2BG9 B;  3TLU A;  2XZ6 A;  3U8M A;  3RQW A;  4ZZB A;  3U8L A;  5HEJ A;  2XNU A;  4IL9 A;  5L4H A;  2BYS A;  4UM3 S;  4AFG A;  2BJ0 A;  3TLV A;  3TLS A;  5J0Z A;  5HEO A;  3RHW A;  3UU8 A;  3RIA A;  5J5G A;  2X00 D;  5HCJ A;  3WTI A;  2XZ5 A;  5HEH A;  4IRE A;  2XQ8 A;  2Y7Y A;  4ZZC A;  4UM1 A;  3PMZ A;  3UQ4 A;  2BYP A;  2YN6 A;  3RI5 A;  4HFI A;  4FRR A;  4ILC A;  3WTJ A;  2XQ4 A;  1UV6 A;  4HFC A;  3SQ9 A;  2WNC A;  5L47 A;  5LG3 A;  3P4W A;  4WV9 A;  5AFH A;  2Y57 A;  5J5I A;  5AFM B;  2YMD A;  3IGQ A;  4AFT A;  2ZJV A;  2W8G A;  3SIO A;  5AFK A;  2Y54 A;  5J5F A;  4TWF A;  2XNT A;  3SH1 A;  2BR8 A;  3UU4 A;  4NPP A;  2XQ5 A;  4X5T A;  2XQ6 A;  4UM3 A;  5IUX A;  2YKS A;  4TNV A;  4ZJS A;  2XQA A;  2YME A;  4ZK4 A;  2XQ7 A;  3UU6 A;  2WZY A;  3TLT A;  1I9B A;  5BP0 A;  2ZJU A;  3UUB A;  5JME A;  2XQ3 A;  4D01 A;  4TWD A;  3WTO A;  2BR7 A;  2X00 A;  5AFL A;  4HFE A;  4QAC A;  2Y56 A;  4HFD A;  4LML A;  4ZRU A;  5KZU A;  2BG9 A;  3P50 A;  4TNW A;  4QAB A;  5FJV A;  5HEG A;  3LSV A;  4LMK A;  4AFH A;  5BRX A;  2WN9 A;  2BYR A;  2XYT A;  3U8N A;  4Z91 A;  4F8H A;  4HFH A;  4ILB A;  4UY2 A;  2WNJ A;  3RQU A;  3WTK A;  3TLW A;  2BG9 E;  4COF A;  3ZKR A;  3C79 A;  2UZ6 A;  4ILA A;  2BG9 C;  3JAE A;  5KE4 A;  2BYQ A;  3WTH A;  1UW6 A;  5L4E A;  3RIF A;  5HCM A;  4NZB A;  3PEO A;  3JAD A;  3JAF A;  5AIN A;  4A97 A;  2PH9 A;  2WNL A;  4TWH A;  2PGZ A;  2QC1 B;  4HQP A;  4IL4 A; 
#chains in the Genus database with same CATH homology
 3U8K A;  5AFJ A;  3UU5 A;  3T4M A;  4QH4 A;  4B5D A;  4LMJ A;  2YOE A;  5CO5 A;  2VL0 A;  2C9T A;  4QAA A;  1UX2 A;  2XYS A;  4XHE A;  3WTN A;  4Z90 A;  4BQT A;  5LXB A;  5BW2 A;  3WTL A;  4ZK1 A;  3C84 A;  3WTM A;  4ZJT A;  2Y58 A;  5CFB A;  5SYO A;  4QH1 A;  2W8F A;  4ALX A;  4UXU A;  2XQ9 A;  3EI0 A;  3ZDG A;  4BFQ A;  3U8J A;  4UM3 P;  4XK9 A;  5AFN A;  4HFB A;  2BYN A;  4QH5 A;  4DBM A;  5TVC A;  4PIR A;  3SQ6 A;  2XNV A;  5HEU A;  4A98 A;  3EHZ A;  4ZR6 A;  3GUA A;  4EZ1 A;  5J5H A;  3EAM A;  3ZDH A;  3UQ7 A;  5AFM A;  3UU3 A;  3WIP A;  2BG9 B;  3TLU A;  2XZ6 A;  3U8M A;  3RQW A;  4ZZB A;  3U8L A;  5HEJ A;  2XNU A;  4IL9 A;  5L4H A;  2BYS A;  4UM3 S;  4AFG A;  2BJ0 A;  3TLV A;  3TLS A;  5J0Z A;  5HEO A;  3RHW A;  3UU8 A;  3RIA A;  5J5G A;  2X00 D;  5HCJ A;  3WTI A;  2XZ5 A;  5HEH A;  4IRE A;  2XQ8 A;  2Y7Y A;  4ZZC A;  4UM1 A;  3PMZ A;  3UQ4 A;  2BYP A;  2YN6 A;  3RI5 A;  4HFI A;  4FRR A;  4ILC A;  3WTJ A;  2XQ4 A;  1UV6 A;  4HFC A;  3SQ9 A;  2WNC A;  5L47 A;  5LG3 A;  3P4W A;  4WV9 A;  5AFH A;  2Y57 A;  5J5I A;  5AFM B;  2YMD A;  3IGQ A;  4AFT A;  2ZJV A;  2W8G A;  3SIO A;  5AFK A;  2Y54 A;  5J5F A;  4TWF A;  2XNT A;  3SH1 A;  2BR8 A;  3UU4 A;  4NPP A;  2XQ5 A;  4X5T A;  2XQ6 A;  4UM3 A;  5IUX A;  2YKS A;  4TNV A;  4ZJS A;  2XQA A;  2YME A;  4ZK4 A;  2XQ7 A;  3UU6 A;  2WZY A;  3TLT A;  1I9B A;  5BP0 A;  2ZJU A;  3UUB A;  5JME A;  2XQ3 A;  4D01 A;  4TWD A;  3WTO A;  2BR7 A;  2X00 A;  5AFL A;  4HFE A;  4QAC A;  2Y56 A;  4HFD A;  4LML A;  4ZRU A;  5KZU A;  2BG9 A;  3P50 A;  4TNW A;  4QAB A;  5FJV A;  5HEG A;  3LSV A;  4LMK A;  4AFH A;  5BRX A;  2WN9 A;  2BYR A;  2XYT A;  3U8N A;  4Z91 A;  4F8H A;  4HFH A;  4ILB A;  4UY2 A;  2WNJ A;  3RQU A;  3WTK A;  3TLW A;  2BG9 E;  4COF A;  3ZKR A;  3C79 A;  2UZ6 A;  4ILA A;  2BG9 C;  3JAE A;  5KE4 A;  2BYQ A;  3WTH A;  1UW6 A;  5L4E A;  3RIF A;  5HCM A;  4NZB A;  3PEO A;  3JAD A;  3JAF A;  5AIN A;  4A97 A;  2PH9 A;  2WNL A;  4TWH A;  2PGZ A;  2QC1 B;  4HQP A;  4IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...