3SIOA

Ac-achbp ligand binding domain (not including beta 9-10 linker) mutated to human alpha-7 nachr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVYLSFSLLDIVKADSSTNEVDLVYWEQQSWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVNSSGHVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYGGWEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords Soluble acetylcholine receptor
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
source organism Aplysia californica
total genus 53
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3sioA00
2WZYA 2XZ6A 2XQAA 4HFBA 5J5GA 2PGZA 3PMZA 2W8FA 2QC1B 4PIRA 3WTKA 4HFDA 4UXUA 5HEOA 3RI5A 4XHEA 5IUXA 4IREA 4QACA 4WV9A 3UQ4A 2YMEA 4AFTA 4A97A 4D01A 2BYRA 2ZJUA 4LMLA 3ZDGA 4HFCA 5KE4A 4ZR6A 2WN9A 2Y58A 2UZ6A 4BQTA 2Y56A 3UU8A 2BG9B 2XQ6A 2YOEA 1UV6A 3TLTA 2XNVA 4HFIA 2YMDA 4ZJSA 2BG9E 3SH1A 2C9TA 2Y57A 3TLSA 4UM3A 3U8KA 3C84A 4LMKA 2XZ5A 3RIFA 2Y54A 1UW6A 2WNJA 4A98A 3U8JA 2BG9C 2BR7A 3UUBA 3UU5A 3TLUA 4ILBA 2WNCA 3RQWA 5HCJA 2XQ5A 3JAEA 3U8LA 5CFBA 4TWHA 5LXBA 4ZJTA 5FJVA 5CO5A 5J5HA 4ZK4A 4QABA 4ZZBA 4TWFA 5AFKA 3U8MA 4TNWA 3WTHA 5HEGA 3JADA 4EZ1A 3C79A 4UM3P 3GUAA 4Z91A 5J5IA 4X5TA 1UX2A 3EHZA 4UM1A 5JMEA 3WTNA 4HQPA 5BP0A 3WTMA 4QH1A 4DBMA 5J0ZA 3UU4A 2XQ3A 2W8GA 2X00D 4XK9A 4ALXA 3UU3A 3RQUA 4COFA 4TNVA 4NPPA 5HEUA 2XQ4A 3WTIA 3WIPA 5AFLA 4ZZCA 3ZKRA 2X00A 3P4WA 4IL4A 4Z90A 5AFJA 4ILCA 5TVCA 2XNUA 4QH4A 4TWDA 3RHWA 3TLWA 4AFHA 2PH9A 5AFMA 5HEJA 2BYSA 2BJ0A 3UQ7A 3EAMA 3T4MA 5LG3A 3TLVA 4BFQA 3LSVA 2XQ9A 3SQ6A 3EI0A 5AFHA 1I9BA 5KZUA 2WNLA 5BW2A 5AINA 3JAFA 5BRXA 2ZJVA 2YKSA 4LMJA 2XYSA 4ZK1A 3WTLA 4B5DA 4QAAA 2YN6A 5HEHA 3WTJA 5L47A 4NZBA 2BYNA 2VL0A 5AFNA 3ZDHA 2BYQA 3RIAA 4QH5A 5J5FA 4IL9A 3WTOA 3SQ9A 5L4EA 3IGQA 2BG9A 2XNTA 2Y7YA 2XQ7A 2XYTA 4FRRA 4AFGA 4F8HA 3UU6A 4ILAA 3U8NA 5HCMA 2BYPA 4UY2A 3P50A 4ZRUA 5AFMB 3PEOA 4HFEA 3SIOA 4HFHA 5SYOA 2BR8A 4UM3S 2XQ8A 5L4HA
chains in the Genus database with same CATH superfamily
2WZYA 2XZ6A 2XQAA 4HFBA 5J5GA 2PGZA 3PMZA 2W8FA 2QC1B 4PIRA 3WTKA 4HFDA 4UXUA 5HEOA 3RI5A 4XHEA 5IUXA 4IREA 4QACA 4WV9A 3UQ4A 2YMEA 4AFTA 4A97A 4D01A 2BYRA 2ZJUA 4LMLA 3ZDGA 4HFCA 5KE4A 4ZR6A 2WN9A 2Y58A 2UZ6A 4BQTA 2Y56A 3UU8A 2BG9B 2XQ6A 2YOEA 1UV6A 3TLTA 2XNVA 4HFIA 2YMDA 4ZJSA 2BG9E 3SH1A 2C9TA 2Y57A 3TLSA 4UM3A 3U8KA 3C84A 4LMKA 2XZ5A 3RIFA 2Y54A 1UW6A 2WNJA 4A98A 3U8JA 2BG9C 2BR7A 3UUBA 3UU5A 3TLUA 4ILBA 2WNCA 3RQWA 5HCJA 2XQ5A 3JAEA 3U8LA 5CFBA 4TWHA 5LXBA 4ZJTA 5FJVA 5CO5A 5J5HA 4ZK4A 4QABA 4ZZBA 4TWFA 5AFKA 3U8MA 4TNWA 3WTHA 5HEGA 3JADA 4EZ1A 3C79A 4UM3P 3GUAA 4Z91A 5J5IA 4X5TA 1UX2A 3EHZA 4UM1A 5JMEA 3WTNA 4HQPA 5BP0A 3WTMA 4QH1A 4DBMA 5J0ZA 3UU4A 2XQ3A 2W8GA 2X00D 4XK9A 4ALXA 3UU3A 3RQUA 4COFA 4TNVA 4NPPA 5HEUA 2XQ4A 3WTIA 3WIPA 5AFLA 4ZZCA 3ZKRA 2X00A 3P4WA 4IL4A 4Z90A 5AFJA 4ILCA 5TVCA 2XNUA 4QH4A 4TWDA 3RHWA 3TLWA 4AFHA 2PH9A 5AFMA 5HEJA 2BYSA 2BJ0A 3UQ7A 3EAMA 3T4MA 5LG3A 3TLVA 4BFQA 3LSVA 2XQ9A 3SQ6A 3EI0A 5AFHA 1I9BA 5KZUA 2WNLA 5BW2A 5AINA 3JAFA 5BRXA 2ZJVA 2YKSA 4LMJA 2XYSA 4ZK1A 3WTLA 4B5DA 4QAAA 2YN6A 5HEHA 3WTJA 5L47A 4NZBA 2BYNA 2VL0A 5AFNA 3ZDHA 2BYQA 3RIAA 4QH5A 5J5FA 4IL9A 3WTOA 3SQ9A 5L4EA 3IGQA 2BG9A 2XNTA 2Y7YA 2XQ7A 2XYTA 4FRRA 4AFGA 4F8HA 3UU6A 4ILAA 3U8NA 5HCMA 2BYPA 4UY2A 3P50A 4ZRUA 5AFMB 3PEOA 4HFEA 3SIOA 4HFHA 5SYOA 2BR8A 4UM3S 2XQ8A 5L4HA
chains in the Genus database with same CATH topology
2WZYA 2XZ6A 2XQAA 4HFBA 5J5GA 2PGZA 3PMZA 2W8FA 2QC1B 4PIRA 3WTKA 4HFDA 4UXUA 5HEOA 3RI5A 4XHEA 5IUXA 4IREA 4QACA 4WV9A 3UQ4A 2YMEA 4AFTA 4A97A 4D01A 2BYRA 2ZJUA 4LMLA 3ZDGA 4HFCA 5KE4A 4ZR6A 2WN9A 2Y58A 2UZ6A 4BQTA 2Y56A 3UU8A 2BG9B 2XQ6A 2YOEA 1UV6A 3TLTA 2XNVA 4HFIA 2YMDA 4ZJSA 2BG9E 3SH1A 2C9TA 2Y57A 3TLSA 4UM3A 3U8KA 3C84A 4LMKA 2XZ5A 3RIFA 2Y54A 1UW6A 2WNJA 4A98A 3U8JA 2BG9C 2BR7A 3UUBA 3UU5A 3TLUA 4ILBA 2WNCA 3RQWA 5HCJA 2XQ5A 3JAEA 3U8LA 5CFBA 4TWHA 5LXBA 4ZJTA 5FJVA 5CO5A 5J5HA 4ZK4A 4QABA 4ZZBA 4TWFA 5AFKA 3U8MA 4TNWA 3WTHA 5HEGA 3JADA 4EZ1A 3C79A 4UM3P 3GUAA 4Z91A 5J5IA 4X5TA 1UX2A 3EHZA 4UM1A 5JMEA 3WTNA 4HQPA 5BP0A 3WTMA 4QH1A 4DBMA 5J0ZA 3UU4A 2XQ3A 2W8GA 2X00D 4XK9A 4ALXA 3UU3A 3RQUA 4COFA 4TNVA 4NPPA 5HEUA 2XQ4A 3WTIA 3WIPA 5AFLA 4ZZCA 3ZKRA 2X00A 3P4WA 4IL4A 4Z90A 5AFJA 4ILCA 5TVCA 2XNUA 4QH4A 4TWDA 3RHWA 3TLWA 4AFHA 2PH9A 5AFMA 5HEJA 2BYSA 2BJ0A 3UQ7A 3EAMA 3T4MA 5LG3A 3TLVA 4BFQA 3LSVA 2XQ9A 3SQ6A 3EI0A 5AFHA 1I9BA 5KZUA 2WNLA 5BW2A 5AINA 3JAFA 5BRXA 2ZJVA 2YKSA 4LMJA 2XYSA 4ZK1A 3WTLA 4B5DA 4QAAA 2YN6A 5HEHA 3WTJA 5L47A 4NZBA 2BYNA 2VL0A 5AFNA 3ZDHA 2BYQA 3RIAA 4QH5A 5J5FA 4IL9A 3WTOA 3SQ9A 5L4EA 3IGQA 2BG9A 2XNTA 2Y7YA 2XQ7A 2XYTA 4FRRA 4AFGA 4F8HA 3UU6A 4ILAA 3U8NA 5HCMA 2BYPA 4UY2A 3P50A 4ZRUA 5AFMB 3PEOA 4HFEA 3SIOA 4HFHA 5SYOA 2BR8A 4UM3S 2XQ8A 5L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZY A;  2XZ6 A;  2XQA A;  4HFB A;  5J5G A;  2PGZ A;  3PMZ A;  2W8F A;  2QC1 B;  4PIR A;  3WTK A;  4HFD A;  4UXU A;  5HEO A;  3RI5 A;  4XHE A;  5IUX A;  4IRE A;  4QAC A;  4WV9 A;  3UQ4 A;  2YME A;  4AFT A;  4A97 A;  4D01 A;  2BYR A;  2ZJU A;  4LML A;  3ZDG A;  4HFC A;  5KE4 A;  4ZR6 A;  2WN9 A;  2Y58 A;  2UZ6 A;  4BQT A;  2Y56 A;  3UU8 A;  2BG9 B;  2XQ6 A;  2YOE A;  1UV6 A;  3TLT A;  2XNV A;  4HFI A;  2YMD A;  4ZJS A;  2BG9 E;  3SH1 A;  2C9T A;  2Y57 A;  3TLS A;  4UM3 A;  3U8K A;  3C84 A;  4LMK A;  2XZ5 A;  3RIF A;  2Y54 A;  1UW6 A;  2WNJ A;  4A98 A;  3U8J A;  2BG9 C;  2BR7 A;  3UUB A;  3UU5 A;  3TLU A;  4ILB A;  2WNC A;  3RQW A;  5HCJ A;  2XQ5 A;  3JAE A;  3U8L A;  5CFB A;  4TWH A;  5LXB A;  4ZJT A;  5FJV A;  5CO5 A;  5J5H A;  4ZK4 A;  4QAB A;  4ZZB A;  4TWF A;  5AFK A;  3U8M A;  4TNW A;  3WTH A;  5HEG A;  3JAD A;  4EZ1 A;  3C79 A;  4UM3 P;  3GUA A;  4Z91 A;  5J5I A;  4X5T A;  1UX2 A;  3EHZ A;  4UM1 A;  5JME A;  3WTN A;  4HQP A;  5BP0 A;  3WTM A;  4QH1 A;  4DBM A;  5J0Z A;  3UU4 A;  2XQ3 A;  2W8G A;  2X00 D;  4XK9 A;  4ALX A;  3UU3 A;  3RQU A;  4COF A;  4TNV A;  4NPP A;  5HEU A;  2XQ4 A;  3WTI A;  3WIP A;  5AFL A;  4ZZC A;  3ZKR A;  2X00 A;  3P4W A;  4IL4 A;  4Z90 A;  5AFJ A;  4ILC A;  5TVC A;  2XNU A;  4QH4 A;  4TWD A;  3RHW A;  3TLW A;  4AFH A;  2PH9 A;  5AFM A;  5HEJ A;  2BYS A;  2BJ0 A;  3UQ7 A;  3EAM A;  3T4M A;  5LG3 A;  3TLV A;  4BFQ A;  3LSV A;  2XQ9 A;  3SQ6 A;  3EI0 A;  5AFH A;  1I9B A;  5KZU A;  2WNL A;  5BW2 A;  5AIN A;  3JAF A;  5BRX A;  2ZJV A;  2YKS A;  4LMJ A;  2XYS A;  4ZK1 A;  3WTL A;  4B5D A;  4QAA A;  2YN6 A;  5HEH A;  3WTJ A;  5L47 A;  4NZB A;  2BYN A;  2VL0 A;  5AFN A;  3ZDH A;  2BYQ A;  3RIA A;  4QH5 A;  5J5F A;  4IL9 A;  3WTO A;  3SQ9 A;  5L4E A;  3IGQ A;  2BG9 A;  2XNT A;  2Y7Y A;  2XQ7 A;  2XYT A;  4FRR A;  4AFG A;  4F8H A;  3UU6 A;  4ILA A;  3U8N A;  5HCM A;  2BYP A;  4UY2 A;  3P50 A;  4ZRU A;  5AFM B;  3PEO A;  4HFE A;  3SIO A;  4HFH A;  5SYO A;  2BR8 A;  4UM3 S;  2XQ8 A;  5L4H A; 
#chains in the Genus database with same CATH topology
 2WZY A;  2XZ6 A;  2XQA A;  4HFB A;  5J5G A;  2PGZ A;  3PMZ A;  2W8F A;  2QC1 B;  4PIR A;  3WTK A;  4HFD A;  4UXU A;  5HEO A;  3RI5 A;  4XHE A;  5IUX A;  4IRE A;  4QAC A;  4WV9 A;  3UQ4 A;  2YME A;  4AFT A;  4A97 A;  4D01 A;  2BYR A;  2ZJU A;  4LML A;  3ZDG A;  4HFC A;  5KE4 A;  4ZR6 A;  2WN9 A;  2Y58 A;  2UZ6 A;  4BQT A;  2Y56 A;  3UU8 A;  2BG9 B;  2XQ6 A;  2YOE A;  1UV6 A;  3TLT A;  2XNV A;  4HFI A;  2YMD A;  4ZJS A;  2BG9 E;  3SH1 A;  2C9T A;  2Y57 A;  3TLS A;  4UM3 A;  3U8K A;  3C84 A;  4LMK A;  2XZ5 A;  3RIF A;  2Y54 A;  1UW6 A;  2WNJ A;  4A98 A;  3U8J A;  2BG9 C;  2BR7 A;  3UUB A;  3UU5 A;  3TLU A;  4ILB A;  2WNC A;  3RQW A;  5HCJ A;  2XQ5 A;  3JAE A;  3U8L A;  5CFB A;  4TWH A;  5LXB A;  4ZJT A;  5FJV A;  5CO5 A;  5J5H A;  4ZK4 A;  4QAB A;  4ZZB A;  4TWF A;  5AFK A;  3U8M A;  4TNW A;  3WTH A;  5HEG A;  3JAD A;  4EZ1 A;  3C79 A;  4UM3 P;  3GUA A;  4Z91 A;  5J5I A;  4X5T A;  1UX2 A;  3EHZ A;  4UM1 A;  5JME A;  3WTN A;  4HQP A;  5BP0 A;  3WTM A;  4QH1 A;  4DBM A;  5J0Z A;  3UU4 A;  2XQ3 A;  2W8G A;  2X00 D;  4XK9 A;  4ALX A;  3UU3 A;  3RQU A;  4COF A;  4TNV A;  4NPP A;  5HEU A;  2XQ4 A;  3WTI A;  3WIP A;  5AFL A;  4ZZC A;  3ZKR A;  2X00 A;  3P4W A;  4IL4 A;  4Z90 A;  5AFJ A;  4ILC A;  5TVC A;  2XNU A;  4QH4 A;  4TWD A;  3RHW A;  3TLW A;  4AFH A;  2PH9 A;  5AFM A;  5HEJ A;  2BYS A;  2BJ0 A;  3UQ7 A;  3EAM A;  3T4M A;  5LG3 A;  3TLV A;  4BFQ A;  3LSV A;  2XQ9 A;  3SQ6 A;  3EI0 A;  5AFH A;  1I9B A;  5KZU A;  2WNL A;  5BW2 A;  5AIN A;  3JAF A;  5BRX A;  2ZJV A;  2YKS A;  4LMJ A;  2XYS A;  4ZK1 A;  3WTL A;  4B5D A;  4QAA A;  2YN6 A;  5HEH A;  3WTJ A;  5L47 A;  4NZB A;  2BYN A;  2VL0 A;  5AFN A;  3ZDH A;  2BYQ A;  3RIA A;  4QH5 A;  5J5F A;  4IL9 A;  3WTO A;  3SQ9 A;  5L4E A;  3IGQ A;  2BG9 A;  2XNT A;  2Y7Y A;  2XQ7 A;  2XYT A;  4FRR A;  4AFG A;  4F8H A;  3UU6 A;  4ILA A;  3U8N A;  5HCM A;  2BYP A;  4UY2 A;  3P50 A;  4ZRU A;  5AFM B;  3PEO A;  4HFE A;  3SIO A;  4HFH A;  5SYO A;  2BR8 A;  4UM3 S;  2XQ8 A;  5L4H A; 
#chains in the Genus database with same CATH homology
 2WZY A;  2XZ6 A;  2XQA A;  4HFB A;  5J5G A;  2PGZ A;  3PMZ A;  2W8F A;  2QC1 B;  4PIR A;  3WTK A;  4HFD A;  4UXU A;  5HEO A;  3RI5 A;  4XHE A;  5IUX A;  4IRE A;  4QAC A;  4WV9 A;  3UQ4 A;  2YME A;  4AFT A;  4A97 A;  4D01 A;  2BYR A;  2ZJU A;  4LML A;  3ZDG A;  4HFC A;  5KE4 A;  4ZR6 A;  2WN9 A;  2Y58 A;  2UZ6 A;  4BQT A;  2Y56 A;  3UU8 A;  2BG9 B;  2XQ6 A;  2YOE A;  1UV6 A;  3TLT A;  2XNV A;  4HFI A;  2YMD A;  4ZJS A;  2BG9 E;  3SH1 A;  2C9T A;  2Y57 A;  3TLS A;  4UM3 A;  3U8K A;  3C84 A;  4LMK A;  2XZ5 A;  3RIF A;  2Y54 A;  1UW6 A;  2WNJ A;  4A98 A;  3U8J A;  2BG9 C;  2BR7 A;  3UUB A;  3UU5 A;  3TLU A;  4ILB A;  2WNC A;  3RQW A;  5HCJ A;  2XQ5 A;  3JAE A;  3U8L A;  5CFB A;  4TWH A;  5LXB A;  4ZJT A;  5FJV A;  5CO5 A;  5J5H A;  4ZK4 A;  4QAB A;  4ZZB A;  4TWF A;  5AFK A;  3U8M A;  4TNW A;  3WTH A;  5HEG A;  3JAD A;  4EZ1 A;  3C79 A;  4UM3 P;  3GUA A;  4Z91 A;  5J5I A;  4X5T A;  1UX2 A;  3EHZ A;  4UM1 A;  5JME A;  3WTN A;  4HQP A;  5BP0 A;  3WTM A;  4QH1 A;  4DBM A;  5J0Z A;  3UU4 A;  2XQ3 A;  2W8G A;  2X00 D;  4XK9 A;  4ALX A;  3UU3 A;  3RQU A;  4COF A;  4TNV A;  4NPP A;  5HEU A;  2XQ4 A;  3WTI A;  3WIP A;  5AFL A;  4ZZC A;  3ZKR A;  2X00 A;  3P4W A;  4IL4 A;  4Z90 A;  5AFJ A;  4ILC A;  5TVC A;  2XNU A;  4QH4 A;  4TWD A;  3RHW A;  3TLW A;  4AFH A;  2PH9 A;  5AFM A;  5HEJ A;  2BYS A;  2BJ0 A;  3UQ7 A;  3EAM A;  3T4M A;  5LG3 A;  3TLV A;  4BFQ A;  3LSV A;  2XQ9 A;  3SQ6 A;  3EI0 A;  5AFH A;  1I9B A;  5KZU A;  2WNL A;  5BW2 A;  5AIN A;  3JAF A;  5BRX A;  2ZJV A;  2YKS A;  4LMJ A;  2XYS A;  4ZK1 A;  3WTL A;  4B5D A;  4QAA A;  2YN6 A;  5HEH A;  3WTJ A;  5L47 A;  4NZB A;  2BYN A;  2VL0 A;  5AFN A;  3ZDH A;  2BYQ A;  3RIA A;  4QH5 A;  5J5F A;  4IL9 A;  3WTO A;  3SQ9 A;  5L4E A;  3IGQ A;  2BG9 A;  2XNT A;  2Y7Y A;  2XQ7 A;  2XYT A;  4FRR A;  4AFG A;  4F8H A;  3UU6 A;  4ILA A;  3U8N A;  5HCM A;  2BYP A;  4UY2 A;  3P50 A;  4ZRU A;  5AFM B;  3PEO A;  4HFE A;  3SIO A;  4HFH A;  5SYO A;  2BR8 A;  4UM3 S;  2XQ8 A;  5L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...