3SIOA

Ac-achbp ligand binding domain (not including beta 9-10 linker) mutated to human alpha-7 nachr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVYLSFSLLDIVKADSSTNEVDLVYWEQQSWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVNSSGHVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYGGWEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 53
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3sioA00
3TLWA 4HQPA 1UX2A 2WZYA 5HEHA 2BG9E 3WTNA 1I9BA 3UU8A 3TLVA 2BR8A 2WNLA 2W8FA 3SQ9A 2YOEA 3U8LA 5TVCA 2C9TA 3U8MA 2XNTA 2XYSA 4IL4A 2XQ5A 2BYQA 2PH9A 4FRRA 2Y57A 3RIFA 3UQ4A 3WIPA 3ZDHA 2BYNA 4HFIA 2XQ4A 4BFQA 4LMJA 4TWFA 4QH5A 2YMEA 5AFMB 5J5FA 5HCJA 3EI0A 3RQWA 4D01A 3JADA 5AFJA 2YMDA 3WTKA 4UM3A 4DBMA 2WNJA 4QABA 4AFTA 2BG9B 2XQ9A 3C84A 4TNWA 4B5DA 5AFKA 3ZDGA 1UV6A 3WTHA 4ALXA 4ZK1A 4ILCA 2PGZA 4UM3S 2Y56A 4UM3P 5FJVA 5SYOA 2XNVA 5JMEA 5HEJA 4UXUA 4Z90A 3EHZA 4X5TA 5LG3A 3U8JA 2W8GA 2ZJVA 4ZR6A 2BYPA 2BR7A 5L47A 2Y58A 1UW6A 5AFHA 5AFMA 4A97A 3P4WA 3WTLA 3SIOA 4TWHA 2BG9C 4IL9A 3RIAA 3WTMA 4QH4A 5KZUA 3U8NA 5J5IA 4PIRA 2X00D 2VL0A 2BG9A 4XHEA 5HEUA 3UU3A 4LMLA 3RQUA 2Y7YA 2XNUA 5AFNA 4QACA 3WTIA 4AFGA 3EAMA 5IUXA 4HFBA 3TLTA 4ZZCA 4A98A 5HCMA 4F8HA 5CO5A 5LXBA 4XK9A 5L4EA 3WTJA 2UZ6A 5HEOA 5J0ZA 2BYSA 4ZJSA 2XQ8A 5AINA 4HFDA 4BQTA 2BJ0A 2ZJUA 3C79A 2XQAA 4Z91A 2BYRA 4QH1A 5J5GA 5CFBA 2X00A 3WTOA 4HFEA 4IREA 5BW2A 3UU5A 3UUBA 3PEOA 2WN9A 2XZ6A 4ILBA 5L4HA 3U8KA 2XZ5A 4AFHA 5BP0A 2XQ7A 3IGQA 3RI5A 5J5HA 5BRXA 2YKSA 4HFHA 2XQ3A 3JAFA 4NPPA 4TWDA 4WV9A 4ZK4A 2WNCA 3SQ6A 4ZZBA 2Y54A 3TLSA 4UM1A 3UU6A 4COFA 4TNVA 4HFCA 3ZKRA 3SH1A 3UQ7A 2XYTA 3PMZA 4NZBA 3LSVA 4UY2A 3RHWA 2QC1B 3T4MA 2YN6A 4ZJTA 4LMKA 3UU4A 3JAEA 3GUAA 4ZRUA 5KE4A 2XQ6A 4ILAA 3TLUA 3P50A 4QAAA 4EZ1A 5HEGA 5AFLA
chains in the Genus database with same CATH superfamily
3TLWA 4HQPA 1UX2A 2WZYA 5HEHA 2BG9E 3WTNA 1I9BA 3UU8A 3TLVA 2BR8A 2WNLA 2W8FA 3SQ9A 2YOEA 3U8LA 5TVCA 2C9TA 3U8MA 2XNTA 2XYSA 4IL4A 2XQ5A 2BYQA 2PH9A 4FRRA 2Y57A 3RIFA 3UQ4A 3WIPA 3ZDHA 2BYNA 4HFIA 2XQ4A 4BFQA 4LMJA 4TWFA 4QH5A 2YMEA 5AFMB 5J5FA 5HCJA 3EI0A 3RQWA 4D01A 3JADA 5AFJA 2YMDA 3WTKA 4UM3A 4DBMA 2WNJA 4QABA 4AFTA 2BG9B 2XQ9A 3C84A 4TNWA 4B5DA 5AFKA 3ZDGA 1UV6A 3WTHA 4ALXA 4ZK1A 4ILCA 2PGZA 4UM3S 2Y56A 4UM3P 5FJVA 5SYOA 2XNVA 5JMEA 5HEJA 4UXUA 4Z90A 3EHZA 4X5TA 5LG3A 3U8JA 2W8GA 2ZJVA 4ZR6A 2BYPA 2BR7A 5L47A 2Y58A 1UW6A 5AFHA 5AFMA 4A97A 3P4WA 3WTLA 3SIOA 4TWHA 2BG9C 4IL9A 3RIAA 3WTMA 4QH4A 5KZUA 3U8NA 5J5IA 4PIRA 2X00D 2VL0A 2BG9A 4XHEA 5HEUA 3UU3A 4LMLA 3RQUA 2Y7YA 2XNUA 5AFNA 4QACA 3WTIA 4AFGA 3EAMA 5IUXA 4HFBA 3TLTA 4ZZCA 4A98A 5HCMA 4F8HA 5CO5A 5LXBA 4XK9A 5L4EA 3WTJA 2UZ6A 5HEOA 5J0ZA 2BYSA 4ZJSA 2XQ8A 5AINA 4HFDA 4BQTA 2BJ0A 2ZJUA 3C79A 2XQAA 4Z91A 2BYRA 4QH1A 5J5GA 5CFBA 2X00A 3WTOA 4HFEA 4IREA 5BW2A 3UU5A 3UUBA 3PEOA 2WN9A 2XZ6A 4ILBA 5L4HA 3U8KA 2XZ5A 4AFHA 5BP0A 2XQ7A 3IGQA 3RI5A 5J5HA 5BRXA 2YKSA 4HFHA 2XQ3A 3JAFA 4NPPA 4TWDA 4WV9A 4ZK4A 2WNCA 3SQ6A 4ZZBA 2Y54A 3TLSA 4UM1A 3UU6A 4COFA 4TNVA 4HFCA 3ZKRA 3SH1A 3UQ7A 2XYTA 3PMZA 4NZBA 3LSVA 4UY2A 3RHWA 2QC1B 3T4MA 2YN6A 4ZJTA 4LMKA 3UU4A 3JAEA 3GUAA 4ZRUA 5KE4A 2XQ6A 4ILAA 3TLUA 3P50A 4QAAA 4EZ1A 5HEGA 5AFLA
chains in the Genus database with same CATH topology
3TLWA 4HQPA 1UX2A 2WZYA 5HEHA 2BG9E 3WTNA 1I9BA 3UU8A 3TLVA 2BR8A 2WNLA 2W8FA 3SQ9A 2YOEA 3U8LA 5TVCA 2C9TA 3U8MA 2XNTA 2XYSA 4IL4A 2XQ5A 2BYQA 2PH9A 4FRRA 2Y57A 3RIFA 3UQ4A 3WIPA 3ZDHA 2BYNA 4HFIA 2XQ4A 4BFQA 4LMJA 4TWFA 4QH5A 2YMEA 5AFMB 5J5FA 5HCJA 3EI0A 3RQWA 4D01A 3JADA 5AFJA 2YMDA 3WTKA 4UM3A 4DBMA 2WNJA 4QABA 4AFTA 2BG9B 2XQ9A 3C84A 4TNWA 4B5DA 5AFKA 3ZDGA 1UV6A 3WTHA 4ALXA 4ZK1A 4ILCA 2PGZA 4UM3S 2Y56A 4UM3P 5FJVA 5SYOA 2XNVA 5JMEA 5HEJA 4UXUA 4Z90A 3EHZA 4X5TA 5LG3A 3U8JA 2W8GA 2ZJVA 4ZR6A 2BYPA 2BR7A 5L47A 2Y58A 1UW6A 5AFHA 5AFMA 4A97A 3P4WA 3WTLA 3SIOA 4TWHA 2BG9C 4IL9A 3RIAA 3WTMA 4QH4A 5KZUA 3U8NA 5J5IA 4PIRA 2X00D 2VL0A 2BG9A 4XHEA 5HEUA 3UU3A 4LMLA 3RQUA 2Y7YA 2XNUA 5AFNA 4QACA 3WTIA 4AFGA 3EAMA 5IUXA 4HFBA 3TLTA 4ZZCA 4A98A 5HCMA 4F8HA 5CO5A 5LXBA 4XK9A 5L4EA 3WTJA 2UZ6A 5HEOA 5J0ZA 2BYSA 4ZJSA 2XQ8A 5AINA 4HFDA 4BQTA 2BJ0A 2ZJUA 3C79A 2XQAA 4Z91A 2BYRA 4QH1A 5J5GA 5CFBA 2X00A 3WTOA 4HFEA 4IREA 5BW2A 3UU5A 3UUBA 3PEOA 2WN9A 2XZ6A 4ILBA 5L4HA 3U8KA 2XZ5A 4AFHA 5BP0A 2XQ7A 3IGQA 3RI5A 5J5HA 5BRXA 2YKSA 4HFHA 2XQ3A 3JAFA 4NPPA 4TWDA 4WV9A 4ZK4A 2WNCA 3SQ6A 4ZZBA 2Y54A 3TLSA 4UM1A 3UU6A 4COFA 4TNVA 4HFCA 3ZKRA 3SH1A 3UQ7A 2XYTA 3PMZA 4NZBA 3LSVA 4UY2A 3RHWA 2QC1B 3T4MA 2YN6A 4ZJTA 4LMKA 3UU4A 3JAEA 3GUAA 4ZRUA 5KE4A 2XQ6A 4ILAA 3TLUA 3P50A 4QAAA 4EZ1A 5HEGA 5AFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLW A;  4HQP A;  1UX2 A;  2WZY A;  5HEH A;  2BG9 E;  3WTN A;  1I9B A;  3UU8 A;  3TLV A;  2BR8 A;  2WNL A;  2W8F A;  3SQ9 A;  2YOE A;  3U8L A;  5TVC A;  2C9T A;  3U8M A;  2XNT A;  2XYS A;  4IL4 A;  2XQ5 A;  2BYQ A;  2PH9 A;  4FRR A;  2Y57 A;  3RIF A;  3UQ4 A;  3WIP A;  3ZDH A;  2BYN A;  4HFI A;  2XQ4 A;  4BFQ A;  4LMJ A;  4TWF A;  4QH5 A;  2YME A;  5AFM B;  5J5F A;  5HCJ A;  3EI0 A;  3RQW A;  4D01 A;  3JAD A;  5AFJ A;  2YMD A;  3WTK A;  4UM3 A;  4DBM A;  2WNJ A;  4QAB A;  4AFT A;  2BG9 B;  2XQ9 A;  3C84 A;  4TNW A;  4B5D A;  5AFK A;  3ZDG A;  1UV6 A;  3WTH A;  4ALX A;  4ZK1 A;  4ILC A;  2PGZ A;  4UM3 S;  2Y56 A;  4UM3 P;  5FJV A;  5SYO A;  2XNV A;  5JME A;  5HEJ A;  4UXU A;  4Z90 A;  3EHZ A;  4X5T A;  5LG3 A;  3U8J A;  2W8G A;  2ZJV A;  4ZR6 A;  2BYP A;  2BR7 A;  5L47 A;  2Y58 A;  1UW6 A;  5AFH A;  5AFM A;  4A97 A;  3P4W A;  3WTL A;  3SIO A;  4TWH A;  2BG9 C;  4IL9 A;  3RIA A;  3WTM A;  4QH4 A;  5KZU A;  3U8N A;  5J5I A;  4PIR A;  2X00 D;  2VL0 A;  2BG9 A;  4XHE A;  5HEU A;  3UU3 A;  4LML A;  3RQU A;  2Y7Y A;  2XNU A;  5AFN A;  4QAC A;  3WTI A;  4AFG A;  3EAM A;  5IUX A;  4HFB A;  3TLT A;  4ZZC A;  4A98 A;  5HCM A;  4F8H A;  5CO5 A;  5LXB A;  4XK9 A;  5L4E A;  3WTJ A;  2UZ6 A;  5HEO A;  5J0Z A;  2BYS A;  4ZJS A;  2XQ8 A;  5AIN A;  4HFD A;  4BQT A;  2BJ0 A;  2ZJU A;  3C79 A;  2XQA A;  4Z91 A;  2BYR A;  4QH1 A;  5J5G A;  5CFB A;  2X00 A;  3WTO A;  4HFE A;  4IRE A;  5BW2 A;  3UU5 A;  3UUB A;  3PEO A;  2WN9 A;  2XZ6 A;  4ILB A;  5L4H A;  3U8K A;  2XZ5 A;  4AFH A;  5BP0 A;  2XQ7 A;  3IGQ A;  3RI5 A;  5J5H A;  5BRX A;  2YKS A;  4HFH A;  2XQ3 A;  3JAF A;  4NPP A;  4TWD A;  4WV9 A;  4ZK4 A;  2WNC A;  3SQ6 A;  4ZZB A;  2Y54 A;  3TLS A;  4UM1 A;  3UU6 A;  4COF A;  4TNV A;  4HFC A;  3ZKR A;  3SH1 A;  3UQ7 A;  2XYT A;  3PMZ A;  4NZB A;  3LSV A;  4UY2 A;  3RHW A;  2QC1 B;  3T4M A;  2YN6 A;  4ZJT A;  4LMK A;  3UU4 A;  3JAE A;  3GUA A;  4ZRU A;  5KE4 A;  2XQ6 A;  4ILA A;  3TLU A;  3P50 A;  4QAA A;  4EZ1 A;  5HEG A;  5AFL A; 
#chains in the Genus database with same CATH topology
 3TLW A;  4HQP A;  1UX2 A;  2WZY A;  5HEH A;  2BG9 E;  3WTN A;  1I9B A;  3UU8 A;  3TLV A;  2BR8 A;  2WNL A;  2W8F A;  3SQ9 A;  2YOE A;  3U8L A;  5TVC A;  2C9T A;  3U8M A;  2XNT A;  2XYS A;  4IL4 A;  2XQ5 A;  2BYQ A;  2PH9 A;  4FRR A;  2Y57 A;  3RIF A;  3UQ4 A;  3WIP A;  3ZDH A;  2BYN A;  4HFI A;  2XQ4 A;  4BFQ A;  4LMJ A;  4TWF A;  4QH5 A;  2YME A;  5AFM B;  5J5F A;  5HCJ A;  3EI0 A;  3RQW A;  4D01 A;  3JAD A;  5AFJ A;  2YMD A;  3WTK A;  4UM3 A;  4DBM A;  2WNJ A;  4QAB A;  4AFT A;  2BG9 B;  2XQ9 A;  3C84 A;  4TNW A;  4B5D A;  5AFK A;  3ZDG A;  1UV6 A;  3WTH A;  4ALX A;  4ZK1 A;  4ILC A;  2PGZ A;  4UM3 S;  2Y56 A;  4UM3 P;  5FJV A;  5SYO A;  2XNV A;  5JME A;  5HEJ A;  4UXU A;  4Z90 A;  3EHZ A;  4X5T A;  5LG3 A;  3U8J A;  2W8G A;  2ZJV A;  4ZR6 A;  2BYP A;  2BR7 A;  5L47 A;  2Y58 A;  1UW6 A;  5AFH A;  5AFM A;  4A97 A;  3P4W A;  3WTL A;  3SIO A;  4TWH A;  2BG9 C;  4IL9 A;  3RIA A;  3WTM A;  4QH4 A;  5KZU A;  3U8N A;  5J5I A;  4PIR A;  2X00 D;  2VL0 A;  2BG9 A;  4XHE A;  5HEU A;  3UU3 A;  4LML A;  3RQU A;  2Y7Y A;  2XNU A;  5AFN A;  4QAC A;  3WTI A;  4AFG A;  3EAM A;  5IUX A;  4HFB A;  3TLT A;  4ZZC A;  4A98 A;  5HCM A;  4F8H A;  5CO5 A;  5LXB A;  4XK9 A;  5L4E A;  3WTJ A;  2UZ6 A;  5HEO A;  5J0Z A;  2BYS A;  4ZJS A;  2XQ8 A;  5AIN A;  4HFD A;  4BQT A;  2BJ0 A;  2ZJU A;  3C79 A;  2XQA A;  4Z91 A;  2BYR A;  4QH1 A;  5J5G A;  5CFB A;  2X00 A;  3WTO A;  4HFE A;  4IRE A;  5BW2 A;  3UU5 A;  3UUB A;  3PEO A;  2WN9 A;  2XZ6 A;  4ILB A;  5L4H A;  3U8K A;  2XZ5 A;  4AFH A;  5BP0 A;  2XQ7 A;  3IGQ A;  3RI5 A;  5J5H A;  5BRX A;  2YKS A;  4HFH A;  2XQ3 A;  3JAF A;  4NPP A;  4TWD A;  4WV9 A;  4ZK4 A;  2WNC A;  3SQ6 A;  4ZZB A;  2Y54 A;  3TLS A;  4UM1 A;  3UU6 A;  4COF A;  4TNV A;  4HFC A;  3ZKR A;  3SH1 A;  3UQ7 A;  2XYT A;  3PMZ A;  4NZB A;  3LSV A;  4UY2 A;  3RHW A;  2QC1 B;  3T4M A;  2YN6 A;  4ZJT A;  4LMK A;  3UU4 A;  3JAE A;  3GUA A;  4ZRU A;  5KE4 A;  2XQ6 A;  4ILA A;  3TLU A;  3P50 A;  4QAA A;  4EZ1 A;  5HEG A;  5AFL A; 
#chains in the Genus database with same CATH homology
 3TLW A;  4HQP A;  1UX2 A;  2WZY A;  5HEH A;  2BG9 E;  3WTN A;  1I9B A;  3UU8 A;  3TLV A;  2BR8 A;  2WNL A;  2W8F A;  3SQ9 A;  2YOE A;  3U8L A;  5TVC A;  2C9T A;  3U8M A;  2XNT A;  2XYS A;  4IL4 A;  2XQ5 A;  2BYQ A;  2PH9 A;  4FRR A;  2Y57 A;  3RIF A;  3UQ4 A;  3WIP A;  3ZDH A;  2BYN A;  4HFI A;  2XQ4 A;  4BFQ A;  4LMJ A;  4TWF A;  4QH5 A;  2YME A;  5AFM B;  5J5F A;  5HCJ A;  3EI0 A;  3RQW A;  4D01 A;  3JAD A;  5AFJ A;  2YMD A;  3WTK A;  4UM3 A;  4DBM A;  2WNJ A;  4QAB A;  4AFT A;  2BG9 B;  2XQ9 A;  3C84 A;  4TNW A;  4B5D A;  5AFK A;  3ZDG A;  1UV6 A;  3WTH A;  4ALX A;  4ZK1 A;  4ILC A;  2PGZ A;  4UM3 S;  2Y56 A;  4UM3 P;  5FJV A;  5SYO A;  2XNV A;  5JME A;  5HEJ A;  4UXU A;  4Z90 A;  3EHZ A;  4X5T A;  5LG3 A;  3U8J A;  2W8G A;  2ZJV A;  4ZR6 A;  2BYP A;  2BR7 A;  5L47 A;  2Y58 A;  1UW6 A;  5AFH A;  5AFM A;  4A97 A;  3P4W A;  3WTL A;  3SIO A;  4TWH A;  2BG9 C;  4IL9 A;  3RIA A;  3WTM A;  4QH4 A;  5KZU A;  3U8N A;  5J5I A;  4PIR A;  2X00 D;  2VL0 A;  2BG9 A;  4XHE A;  5HEU A;  3UU3 A;  4LML A;  3RQU A;  2Y7Y A;  2XNU A;  5AFN A;  4QAC A;  3WTI A;  4AFG A;  3EAM A;  5IUX A;  4HFB A;  3TLT A;  4ZZC A;  4A98 A;  5HCM A;  4F8H A;  5CO5 A;  5LXB A;  4XK9 A;  5L4E A;  3WTJ A;  2UZ6 A;  5HEO A;  5J0Z A;  2BYS A;  4ZJS A;  2XQ8 A;  5AIN A;  4HFD A;  4BQT A;  2BJ0 A;  2ZJU A;  3C79 A;  2XQA A;  4Z91 A;  2BYR A;  4QH1 A;  5J5G A;  5CFB A;  2X00 A;  3WTO A;  4HFE A;  4IRE A;  5BW2 A;  3UU5 A;  3UUB A;  3PEO A;  2WN9 A;  2XZ6 A;  4ILB A;  5L4H A;  3U8K A;  2XZ5 A;  4AFH A;  5BP0 A;  2XQ7 A;  3IGQ A;  3RI5 A;  5J5H A;  5BRX A;  2YKS A;  4HFH A;  2XQ3 A;  3JAF A;  4NPP A;  4TWD A;  4WV9 A;  4ZK4 A;  2WNC A;  3SQ6 A;  4ZZB A;  2Y54 A;  3TLS A;  4UM1 A;  3UU6 A;  4COF A;  4TNV A;  4HFC A;  3ZKR A;  3SH1 A;  3UQ7 A;  2XYT A;  3PMZ A;  4NZB A;  3LSV A;  4UY2 A;  3RHW A;  2QC1 B;  3T4M A;  2YN6 A;  4ZJT A;  4LMK A;  3UU4 A;  3JAE A;  3GUA A;  4ZRU A;  5KE4 A;  2XQ6 A;  4ILA A;  3TLU A;  3P50 A;  4QAA A;  4EZ1 A;  5HEG A;  5AFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...