3EAMA

An open-pore structure of a bacterial pentameric ligand-gated ion channel
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title X-ray structure of a pentameric ligand-gated ion channel in an apparently open conformation.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3eamA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3eamA01
4HFEA 2W8FA 4QAAA 4X5TA 1OEDA 4BFQA 2XZ6A 4F8HA 3RIFA 3ZDGA 2YKSA 5CFBA 2XNUA 3TLVA 5AFHA 4EZ1A 4UM3P 3P50A 3T4MA 3UQ4A 3WIPA 2WNLA 3WTJA 4A98A 4IL4A 4B5DA 5HCMA 3RHWA 3RIAA 5J5GA 2VL0A 4XHEA 2LLYA 3UU6A 3UU3A 3ZKRA 2BYQA 4AFHA 5BW2A 3ZDHA 5BRXA 4TWHA 4UM1A 3WTLA 3C84A 2C9TA 4HFDA 2PGZA 2WNJA 3PEOA 4ZR6A 4A97A 4HFHA 2Y54A 3WTOA 5HEJA 5KE4A 4Z91A 5J0ZA 2XYTA 4D01A 5AFMB 3GUAA 5L4EA 4HFBA 4AFTA 4FRRA 1OEDC 4ILAA 2XQ6A 5AFJA 4ZK1A 2BG9E 2BYRA 4ILBA 3UU8A 3RQUA 2BG9B 5L4HA 3U8LA 1I9BA 5AFMA 4UY2A 5L47A 4WV9A 2ZJUA 4QH1A 2LKGA 5AFLA 5JMEA 2BR7A 2XYSA 2PH9A 4AFGA 4ALXA 3JAFA 4UM3A 4LMLA 2BG9A 2X00D 2XQ9A 4HQPA 5IUXA 4DBMA 2Y7YA 4ZRUA 4ZZBA 3SH1A 2XQ5A 3C79A 4LMKA 4IL9A 4ZJSA 2LM2A 2LKHA 3TLWA 4NPPA 5HCJA 2BYPA 3WTIA 3SQ9A 3UUBA 2YOEA 4TNWA 3PMZA 5SYOA 5HEHA 2BJ0A 4HFIA 5TVCA 4QH5A 1UW6A 4TWDA 2BR8A 2W8GA 3JAEA 4BQTA 3EI0A 1UX2A 2M6IA 4ZK4A 3SQ6A 3U8JA 5FJVA 5AFNA 3UU4A 2YMEA 3EAMA 3UQ7A 5AINA 2WNCA 2BYNA 2BYSA 4HFCA 2BG9C 3U8NA 2ZJVA 2XNVA 4LMJA 2MAWA 5KZUA 3RI5A 2WZYA 5LG3A 1UV6A 5J5IA 5AFKA 5HEOA 2QC1B 3WTMA 2XQ7A 4COFA 2M6BA 2Y56A 4QH4A 2YMDA 3WTNA 3UU5A 5J5HA 3JADA 4TWFA 4PIRA 5LXBA 4IREA 3TLUA 4UM3S 4ZJTA 3SIOA 2Y57A 2KSRA 5CO5A 5HEUA 3U8MA 5HEGA 3RQWA 3EHZA 5J5FA 4UXUA 5BP0A 3TLTA 4ZZCA 3P4WA 2XZ5A 1OEDE 2Y58A 2XNTA 1OEDB 3IGQA 4QABA 2XQ4A 2UZ6A 3LSVA 4Z90A 4XK9A 2XQ3A 3TLSA 3WTHA 2WN9A 3U8KA 3WTKA 4NZBA 2XQ8A 4TNVA 4ILCA 2XQAA 2YN6A 4QACA 2X00A
chains in the Genus database with same CATH superfamily
1IZNB 3ANWB 1FEWA 3MACA 4B5DA 5LBMA 5L3BB 5ABEA 4Q25A 3SFDA 4OYJA 3RYCE 3ZMTB 2LSKA 3U78A 2CHNA 4A97A 5AFMB 1MIVA 1HX8A 3DP7A 4EYUA 2K48A 5AFJA 4J2CA 2W62A 2MOZA 3HKBE 1BR4A 3F57A 4AIUA 4O4JE 5AFLA 2BR7A 3N9QA 3FZLB 2NP9A 4ZZBA 1WRDA 5HXCA 1M62A 3RYFE 4JI2T 4JLEA 2BR8A 3X1DA 1KK7A 5JQGE 5FNVE 4IT4A 2V7IA 5AQSB 2CE7A 2XAJB 4O4HE 5KZUA 5H6QB 5AFKA 2XY8B 3M65A 2XQ7A 3HA4A 1XMOT 4JI8T 5CO5A 5AQKB 5J5FA 2V8SV 2E8IA 4CQIA 3VU7H 3AE2A 4IDNA 4JI3T 4JI7T 2CWYA 4TNVA 1OXZA 2IDOB 4XBFB 2L9QA 2PFVA 3I9YA 2XNUA 4HGAA 1J1JA 4OFZA 4DV5T 3ZMZB 1YQ3A 4ILUA 3RIAA 5AQJB 4XHEA 4MALA 4HKAA 4EEDA 4UF0B 4CXXA 2WNJA 4PW8A 1FIOA 2V5CA 3NRYA 5L4EA 3NRXA 3V5SA 5KMGP 3HL6A 1MMGA 2UXCT 4PJMA 4E7ZA 2BYRA 1HS7A 4CXWA 4O4IE 2CLYB 4WV9A 4ZI3D 2NR4A 2IUBA 2V1DB 3K3OA 4LF6T 3RKGA 2CEAA 2I6HA 4YJ3E 1WCRA 3VR9A 1JNZA 4IL9A 5JR9A 1MIWA 1FMWA 5JDGA 3EDVA 5HAXA 3K1SA 2BJ0A 3NBXX 3RH3A 5JDLA 5EK3A 2FJDA 4IE4A 4L9IA 2LRKA 5AFNA 3KVBA 2WNCA 5LGUB 5L3DB 4P0BA 3FHNA 1KNPA 2ZM0A 3EVYA 5LNKA 1D0YA 2VL8A 4TWFA 4L5GA 4B6XA 2PTFA 2KSRA 5GONE 4DV3T 3HI2A 4IHJE 2VVNA 1HG5A 4PJLA 3P4WA 3RLFF 2XM2A 1CUNA 2XQ4A 5AQPB 3EUHA 2WN9A 3AE4A 2IC9A 1D1AA 2LHRA 2OA5A 3OBVE 3UQ4A 4IL4A 4IGUA 2MBGA 4BA9A 1VOMA 3WTOA 5HEJA 1HG2A 4G2AA 3KV9A 2MTQA 3N5LA 1HTJF 4AKLA 5C8YE 3PUYF 4ZOLE 4O2AE 3Q2MA 3QB5K 5JVDE 4H9NC 4DBQA 4ALXA 4LMLA 4QWNB 5DQVA 4MFRA 3CMLA 3TLWA 2BYPA 4PK5A 3SQ9A 4LFBT 3PMZA 2LOPA 2JIWA 1UW6A 2WQYA 4O2BE 3EI0A 3A7MA 4TX5A 3CWZB 2WY2A 3GN5A 3LK42 1NEKA 3OYXA 4HWDA 3WTNA 3HKDE 4EEBA 4UM3S 4DV1T 2ZLYA 4NUVA 3FBZA 1BR0A 3VHLA 3L09A 1YQ4A 5FXXA 2UZ6A 4PJNA 4U2YA 2W66A 1Y64B 5DJQC 2FJEA 4QACA 3AEFA 3RRWA 2AXDS 3EDUA 2BVMA 1ZHCA 2NWBA 1UCUA 2HN1A 3E08A 3LJCA 1LKXA 5DQWA 3PEOA 5IWAT 2LT3A 4D01A 4HFBA 2Q9QD 3L8RA 4DV6T 4JV5T 3ABVA 4JYAT 2BG9B 2CWOA 4PFOA 4AI6A 1YD8G 2IC6A 4GKKT 1ZKEA 4MBQA 2XYSA 1NAFA 1I94T 3H3MA 2Y7YA 1E1HB 5F3JA 3KDSE 5L3CB 2BVLA 2XQYA 4EAHA 2JMKA 2DL1A 5HEHA 3PU3A 3SQ6A 4LF9T 1XMQT 5TAOA 4ISTA 5FL1A 4GK5E 3VR8A 3PUQA 1V9DA 5FL0A 1VCTA 3H37A 5JREA 4DV4T 2Y56A 3KINB 2LM9A 2Q9QB 3UTKA 1ZOYA 4X65T 3NWIA 2Y8DA 2Y57A 2M67A 3DTOA 4PAGA 4QXBB 2FUPA 3OKQA 5JRCB 2RA1A 2I59A 2KXPB 5DABA 4DR3T 1D0ZA 5J2TE 1S94A 4Z90A 3HR0A 3WTKA 5FVLA 1HNXT 3AXJA 5AQNB 2WAUA 4AKIA 1NWMX 4NUUA 3FXEB 3O1HA 5HCMA 3UU6A 3ZKRA 2R6GF 3TKLB 3C84A 1R8IA 3PUWF 2BZBA 3ZMSB 3LFMA 4MHCA 2KMFA 5J0ZA 5ADXL 3PUXF 4OYKA 4KHPT 3RGLA 3VKGA 3KVAA 5L47A 3FZHB 2LKGA 4AISA 4X64T 4AFGA 2RP4A 2X9XA 2D0UA 2BS4A 4EZHA 4HE8A 1YKEB 3AEAA 5SYOA 4X20E 2JQ9A 4YT0A 2W8GA 2XSBA 3C4ZA 4WBNE 4IE7A 1B7TA 1MMDA 3CVRA 3ZMUB 2E2AA 5LGNB 4KP3C 4AQYT 5AQGB 3RC3A 3ZEFB 2X0HA 4DR7T 4YHHT 4N78D 4X1YE 4PIRA 3SOLA 3C51A 4F6RC 2A9UA 4PNIA 3Q5DA 1UK5A 4UXUA 5BP0A 2JRKA 2VVSA 2K9AA 2V6YA 4QAAA 3E0ZA 5FXVA 2XZ6A 3ZDGA 1IBKT 2NTYA 3MA9A 4HWHA 5LG4A 3AECA 3WIPA 1VCSA 4IE5A 2DWKA 2QRXA 3FXDB 3CQXC 4TUYE 3AEGA 5LGTB 5HYAA 4IDPA 4M1PA 3ZYLA 2NW9A 3K3NA 2EHOA 4Z91A 4ZK1A 4OX9T 3C98B 3RQUA 3U8LA 3T1HT 3AAIA 5FMNA 4IDZA 2VK9A 2Q9QC 5LHGB 1Z8UA 5JR9B 2A3DA 4ASKA 3AEDA 3SH1A 4ZRUA 1QUUA 1E2AA 1LRZA 3UUBA 3G06A 1SHZC 2VURA 5ABFA 5AQMB 3ONXA 4OHFA 3UQ7A 3FB2A 3UT5E 5J5IA 3ZT7A 3C64A 3RF1A 2X68A 3W15B 2YMDA 3UU5A 1E7PA 3UFGA 5LHHB 4FJOA 2V7JA 2WMNA 3FBLA 3SIOA 2Y6XA 5CA1E 3ZCIA 4C90A 2ZMAA 1S35A 3TLTA 4P09A 4H9RC 2Y58A 2VKOA 3RRCA 1HX1B 3MZKB 5LMNT 2WZIA 1AJ3A 3BQIA 3OTOT 3P7IA 2YN6A 2K24A 2CPTA 4ZHQE 1MIYA 2CXFA 1W0BA 4IE0A 2E5VA 1Z0PA 4CN4A 3F2EA 4HEAA 5BW2A 2WMOA 3AE5A 2HN2A 4XZCA 5H6RB 3CQGB 4QXCB 3GUAA 2KLQA 3MKDA 3ZSTA 4AQFA 4ILAA 4X1KE 2XHEB 1QSDA 4I4TE 4UY2A 4QH1A 2X9YA 4KI0F 5FY1A 1D1BA 5LJNA 4HWCA 2XQ9A 5HXRA 4G63A 3LDQB 2UXDT 2CCQA 4GYRA 4KMCA 4YXDA 2IMLA 1U5PA 3O9XA 2H89A 2YOEA 1FMVA 3GN5B 3P4QA 4GOUA 4GK0E 3AAEB 2IHR1 4JI1T 2JQKA 3RI5A 4DMVA 4YTMA 2QC1B 1YW0A 4WW0A 4QH4A 2BKOA 3T1YT 4IREA 4GKJT 2JQHA 3SFEA 3O1IA 3SWHA 1XDPA 5F5WA 1OEDE 2C5KT 1IBLT 2XNTA 2BKNA 3N2OA 4WBOA 2OLTA 5JR9C 5FXWA 4X66T 4DUYT 2Y48B 5CFBA 1T98A 5IHYA 2V6XA 3VKHA 4UM3P 2WDQA 4KHZF 3AA7B 4KUMB 2KT9A 1WFDA 2N2NA 2IAKA 5JDQA 1IAPA 3JC6D 2LSJA 4NXNT 4FRRA 2VKJA 3MJXA 3AE7A 5L4HA 2JMHA 4L0RA 2XZEA 4HWIB 4C91A 2XPKA 2YDQA 4A56A 2X66A 4LMKA 1ZEEA 3FZFB 5HXSA 2QA7A 3DJBA 4DO0A 4ZS3A 3B57A 3RX6A 4HFIA 2ODUA 2I0MA 2UXNB 3O4XE 4YY3T 2HHHT 4DNDA 4EXTA 3A8YC 2XAFB 2H88A 3H3AA 5HEOA 5LCYA 2DWGA 3C4WA 5BR8T 3CX6B 3NVOA 3F31A 3C4XA 1D1CA 1HR0T 5HEUA 4CN6A 2NOXA 3EHZA 3UULA 2IIUA 3PJAA 4QX8B 4QABA 3AXJB 3CPZA 2UUCT 5L2LA 2ACXA 4Z8XA 4CI2B 3RIFA 3N9NA 4EZ1A 4P1NA 5HXHA 3P50A 4JBWF 2P9BA 4A98A 2V7LA 4TV8E 5LJMA 2VKDA 3WAKA 4HWFA 2PGZA 1WYCA 3IF8B 4ZR6A 4B3TT 2PBIA 3JCFA 2KWIB 3L3PA 1MMNA 1HCIA 2SPCA 4DVDA 3UU8A 1N34T 3L39A 3AE8A 4JUYA 1XDOA 5FP3A 4YSZA 3AE1A 4HQPA 3WAJA 2XQ5A 5LA6E 4YSXA 1T72A 4ZI2C 3RIUA 1UUSA 2UUAT 3N2KE 3P4PA 3KBTA 2NW8A 3PV0F 3LBXA 5AINA 4HFCA 2B76A 3CQCB 4AKRB 3BK9A 4X1IE 3AAAB 2WU5A 2KWHA 4JEUB 4H9OC 2XM1A 2J62A 3D0TA 4I55E 2CBJA 2YK0A 3U8MA 5FKYA 3MXZA 3SRZA 3I9WA 1HNZT 2V6YB 3P4RA 2CXLA 3ZYMA 4XK9A 3RKOA 5J2UE 5JDMA 2X00A 2BDEA 1OEDA 4BFQA 5AQVB 3NZPA 5LB7B 3CIRA 1MNDA 2DCFA 3T4MA 2CMRA 4YTPA 4AKGA 1FJGT 2VKHA 1WYBA 4AFHA 2XAHB 1HFAA 2X67A 3PDYA 4HFDA 2E9XA 5CGMA 1XWMA 2W00A 3UUNA 5KXJA 2W61A 1U4QA 2C5IT 1OEDC 2WU2A 3JC6C 4WYVA 4I0UA 3GA8A 2QYWA 3AA6B 5JMEA 1SE7A 4UM3A 1US7B 4BJNA 3ZT5A 4DBMA 5ABFB 2E9XC 2NTXA 4I50E 3QOFA 1KFYA 4H63V 4CXYA 1LVFA 3JAEA 2M6IA 4QKNA 3HKEE 2YMEA 4PFPA 2CA5A 3I0QA 4LF4T 5EK4A 4OK0A 2YINA 1I6ZA 5EZYE 4AXPA 5AQIB 3NKZA 3AEEA 4U7IA 3MK7C 2FBWA 3TLUA 3AEBA 4BJMA 3ZJ1A 4UR9A 3AA0B 1KNRA 2UXXB 4O8SA 5L3EB 4U74A 4CI1B 2XZ5A 4CN1A 4MLKA 3FZMB 3TLSA 3CX8B 4AQGA 3C50A 2WZHA 4HFEA 5FY7A 4YJ2E 3AE9A 2D5UA 3UFEA 2A72A 4BAYB 3QC9A 3OJAA 1WR6A 2JJ9A 2D0TA 2JQQA 3UU3A 2D9DA 3PTRB 3KV6A 4DR2T 4UVBB 2DHRA 5KE4A 2XYTA 4EIWA 2K3WA 5FYMA 2V5DA 4IDQA 3AB3B 2E5LT 3QK6A 2W2UA 4U31A 1UX4A 5IUXA 5AQLB 4ISSA 4KBMB 3Q9DA 5TVCA 2HH7A 5LP6E 4WZXA 4KX6A 2XASB 4GYSA 4U33A 3V5UA 2VQFT 5AQHB 1WR0A 2VQET 4O4LE 3N9MA 3U8NA 3AE6A 4H9SE 1G73A 5LG3A 4COFA 2M6BA 3ZYKA 4LF7T 3JADA 2EHOC 1KF6A 2Z6EA 4YFSA 3CKDA 2V7MA 5IYZE 5HEGA 3KFWX 4EGWA 1G8XA 1BR1A 1SA0E 1SUMB 3LK3B 4LF8T 3R6NA 5AQFB 3A5XA 4GIWA 2XQ8A 2XQAA 5C2TA 2YKSA 1WLXA 3PUSA 5CB4E 3LG7A 2DNXA 3P8CD 5AQQB 2BS2A 2WS3A 2C9TA 5JTGA 3I0OA 4HFHA 2Y54A 3SS1A 2JPFA 1O3XA 3Q5XA 4AFTA 2QGSA 2BBJA 2XJ7A 4UVAB 2MYSA 1I9BA 4FI5A 2DI4A 3AE3A 1W09A 3ONJA 2YU1A 3CK6A 2LM2A 2LKHA 4YTNA 4NPPA 2VB6A 5HCJA 1J5ET 1N32T 3UUMA 2H7VC 3ZMVB 4V1Av 4TNWA 2LE8A 3PURA 4TWDA 5FY0A 2AE9A 1IBMT 4ZI2D 3PUAA 1T7SA 2MAWA 2W67A 5JDNA 2WZYA 2ODVA 3WTMA 4U2ZA 3QNUA 1EZ3A 1OWAA 5C3JA 3U3IA 4AQFC 4CI3B 4DV2T 3ZN1B 4K0UA 2L3LA 4ADZA 1W9RA 4ZI7E 2X51A 4DR5T 2XQ3A 1IJ5A 2J47A 2CHOA 5JDHA 3IEEA 3TLVA 5AFHA 3HKCE 3WTJA 1D0XA 2LSGA 2VL0A 4ANJA 5L3GB 3ANWA 3CX7B 5BRXA 5BMVE 2ZM6T 1J5WA 5HWYA 1YXRA 3QUJA 3R84B 4UXNB 1T8BA 2XTLA 1HF8A 4TN7B 5AFMA 3I1AA 4EZ4A 2BKPA 1LVKA 1YKHB 3RPUA 3JAFA 3K8PC 2X00D 4NIQA 4QXHB 3C79A 4ZJSA 1MMAA 2ACZA 1CHUA 3LBXB 1XNQT 2WSSV 2XSAA 3UUXB 4ZK4A 3U8JA 2LHNA 4P0AA 5ABHA 2KNDA 2E9XD 2WCAA 3PUZF 1UV6A 4JEHB 4UEMA 3RYIE 1XNRT 1GQEA 5AQTB 2LEHA 3K3QC 5LMUT 2YU2A 2ZM2A 3Q5WA 1ZP0A 4TV9E 2IW5B 4ZZCA 3WI3A 1OEDB 1VRBA 3U8KA 1DU2A 2V26A 3ZN0B 4NZBA 2XAGB 2G0UA 3N9OA 2HPLA 3ONLC 3T8OA 2E9XB 4ZS2A 3RHWA 4B3ST 2BYQA 5E0OA 2KINB 4TWHA 3WTLA 2PG8A 5ABGA 2WWVA 2BS3A 2W63A 4NXMT 4UF0A 4B3MT 3M3ZB 2BG9E 2H3RA 5CA0E 4ILBA 3VRAA 2ZJUA 5ETWA 4JI4T 2PH9A 2RPAA 2W4XA 3ZCJA 4DV7T 2D2SA 1HNWT 2XUEA 3B13A 3OVUA 4I43B 3BQLA 4H9PC 1N33T 4QH5A 3J7Yq 2UUBT 5KX5E 5FJVA 2GK9A 1X79A 2CRBA 2WP9A 4LFAT 3ZLIA 1H7CA 1UX5A 2VASA 4DMWA 5L3FB 2ZM8A 2N9DA 3N2GE 3GWHA 2CLYC 4WNKA 4B3RT 4DUZT 2PJQA 3PU8A 3RC8A 5LXTE 3B5MA 5HXEA 4ZJTA 2UXBT 4YHJA 2MPKA 3RQWA 2ES0A 2NW7A 4ERRA 4EB6E 3ZPOA 3IGQA 2EHOD 3ZT6A 2L8KA 3WTHA 2F4VT 3IA3A 1M7KA 4ILCA 3RIUC 2W8FA 4X5TA 4F8HA 4JI5T 2VWAA 5LOVE 2W0GA 3QB5A 4UIGA 2LSIA 1ZV4X 4TZ4C 4UV8B 3PUVF 3PE0A 4IE6A 2UU9T 4DR1T 5J5GA 2LLYA 2WBLA 4UM1A 4IDOA 3E22E 4ZI3C 4LF5T 1IJ6A 4H9QC 5KDMC 4HTEA 4YSYA 2HPJA 4DR6T 3S4UA 2BBHA 3ESLA 5AQRB 3Q5EA 2LOSA 2A2FX 3P4SA 3KV4A 2C0SA 2EHOB 5LYJE 5LBQB 3IHRA 2CM0A 4PK6A 2WDVA 5CJ5A 4DV0T 3KV5A 3KBUA 4JI0T 3WTIA 2B1EA 2K5BB 2X9WA 3AVSA 3ZC0A 4BQTA 2LSYA 3IBPA 1KNZA 4UV9B 2FJBA 5AQOB 4U7YA 3J9X1 3EAMA 3UU4A 2BYNA 1KEYA 1X9BA 2ZJVA 2XAQB 4K0KT 2J4GA 2LRLA 2X9HA 4EV6A 5LHIB 4LFCT 4QX7B 4E7SA 2WM9A 5LXBA 4PJJA 1NENA 2FJAA 1BR2A 5FXZA 2YDRA 1UURA 3ZJ2A 5FVKA 2KZ7B 4ZXLA 5M4YA 3LSVA 1W0AA 5J1GA 3AA1B 4QHOA 4IIJE 3ETUA 3N9LA 4EYYR 5F8PA 5JDFA 4A5XA 4UVCB 2WNLA 2N1GA 2H7OA 3ZDHA 2YEVC 1MNEA 2QVAA 2YDSA 1N36T 1L0VA 5AFUL 3ZSSA 3PUGA 2CXDA 1XZYA 2XQ6A 2OV9A 1JNRA 4XAXB 4DBRA 4DR4T 2X0YA 5AQUB 4CZZB 5HWXA 2DLRA 3RYHE 2BG9A 4JI6T 3LK2B 4HN9A 2J1DG 5JH7E 4DIDB 3ETVA 4H63H 2WDRA 4U72A 1UX2A 2V7KA 5A1LA 2WB5A 5EK2A 3OYZA 2CBIA 2WWUA 3N9PA 2LJLA 2BYSA 3VRBA 4U3CA 2BG9C 3O1JA 2XNVA 2C5JA 4LMJA 3OPCA 3ZC1A 4ZEYA 5J5HA 3FZKB 4EOZB 3PJAJ 1QLBA 3GMIA 4UELA 4AKHA 2Q9QA 4PK4A 1Y01A 3EABA 3BQKA 2X0LB 4HFVA 1UGOA 3AVRA 3NZQA 5JRCA 4X62T 4YLHA
chains in the Genus database with same CATH topology
4HFEA 2W8FA 4QAAA 4X5TA 1OEDA 4BFQA 2XZ6A 4F8HA 3RIFA 3ZDGA 2YKSA 5CFBA 2XNUA 3TLVA 5AFHA 4EZ1A 4UM3P 3P50A 3T4MA 3UQ4A 3WIPA 2WNLA 3WTJA 4A98A 4IL4A 4B5DA 5HCMA 3RHWA 3RIAA 5J5GA 2VL0A 4XHEA 2LLYA 3UU6A 3UU3A 3ZKRA 2BYQA 4AFHA 5BW2A 3ZDHA 5BRXA 4TWHA 4UM1A 3WTLA 3C84A 2C9TA 4HFDA 2PGZA 2WNJA 3PEOA 4ZR6A 4A97A 4HFHA 2Y54A 3WTOA 5HEJA 5KE4A 4Z91A 5J0ZA 2XYTA 4D01A 5AFMB 3GUAA 5L4EA 4HFBA 4AFTA 4FRRA 1OEDC 4ILAA 2XQ6A 5AFJA 4ZK1A 2BG9E 2BYRA 4ILBA 3UU8A 3RQUA 2BG9B 5L4HA 3U8LA 1I9BA 5AFMA 4UY2A 5L47A 4WV9A 2ZJUA 4QH1A 2LKGA 5AFLA 5JMEA 2BR7A 2XYSA 2PH9A 4AFGA 4ALXA 3JAFA 4UM3A 4LMLA 2BG9A 2X00D 2XQ9A 4HQPA 5IUXA 4DBMA 2Y7YA 4ZRUA 4ZZBA 3SH1A 2XQ5A 3C79A 4LMKA 4IL9A 4ZJSA 2LM2A 2LKHA 3TLWA 4NPPA 5HCJA 2BYPA 3WTIA 3SQ9A 3UUBA 2YOEA 4TNWA 3PMZA 5SYOA 5HEHA 2BJ0A 4HFIA 5TVCA 4QH5A 1UW6A 4TWDA 2BR8A 2W8GA 3JAEA 4BQTA 3EI0A 1UX2A 2M6IA 4ZK4A 3SQ6A 3U8JA 5FJVA 5AFNA 3UU4A 2YMEA 3EAMA 3UQ7A 5AINA 2WNCA 2BYNA 2BYSA 4HFCA 2BG9C 3U8NA 2ZJVA 2XNVA 4LMJA 2MAWA 5KZUA 3RI5A 2WZYA 5LG3A 1UV6A 5J5IA 5AFKA 5HEOA 2QC1B 3WTMA 2XQ7A 4COFA 2M6BA 2Y56A 4QH4A 2YMDA 3WTNA 3UU5A 5J5HA 3JADA 4TWFA 4PIRA 5LXBA 4IREA 3TLUA 4UM3S 4ZJTA 3SIOA 2Y57A 2KSRA 5CO5A 5HEUA 3U8MA 5HEGA 3RQWA 3EHZA 5J5FA 4UXUA 5BP0A 3TLTA 4ZZCA 3P4WA 2XZ5A 1OEDE 2Y58A 2XNTA 1OEDB 3IGQA 4QABA 2XQ4A 2UZ6A 3LSVA 4Z90A 4XK9A 2XQ3A 3TLSA 3WTHA 2WN9A 3U8KA 3WTKA 4NZBA 2XQ8A 4TNVA 4ILCA 2XQAA 2YN6A 4QACA 2X00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFE A;  2W8F A;  4QAA A;  4X5T A;  1OED A;  4BFQ A;  2XZ6 A;  4F8H A;  3RIF A;  3ZDG A;  2YKS A;  5CFB A;  2XNU A;  3TLV A;  5AFH A;  4EZ1 A;  4UM3 P;  3P50 A;  3T4M A;  3UQ4 A;  3WIP A;  2WNL A;  3WTJ A;  4A98 A;  4IL4 A;  4B5D A;  5HCM A;  3RHW A;  3RIA A;  5J5G A;  2VL0 A;  4XHE A;  2LLY A;  3UU6 A;  3UU3 A;  3ZKR A;  2BYQ A;  4AFH A;  5BW2 A;  3ZDH A;  5BRX A;  4TWH A;  4UM1 A;  3WTL A;  3C84 A;  2C9T A;  4HFD A;  2PGZ A;  2WNJ A;  3PEO A;  4ZR6 A;  4A97 A;  4HFH A;  2Y54 A;  3WTO A;  5HEJ A;  5KE4 A;  4Z91 A;  5J0Z A;  2XYT A;  4D01 A;  5AFM B;  3GUA A;  5L4E A;  4HFB A;  4AFT A;  4FRR A;  1OED C;  4ILA A;  2XQ6 A;  5AFJ A;  4ZK1 A;  2BG9 E;  2BYR A;  4ILB A;  3UU8 A;  3RQU A;  2BG9 B;  5L4H A;  3U8L A;  1I9B A;  5AFM A;  4UY2 A;  5L47 A;  4WV9 A;  2ZJU A;  4QH1 A;  2LKG A;  5AFL A;  5JME A;  2BR7 A;  2XYS A;  2PH9 A;  4AFG A;  4ALX A;  3JAF A;  4UM3 A;  4LML A;  2BG9 A;  2X00 D;  2XQ9 A;  4HQP A;  5IUX A;  4DBM A;  2Y7Y A;  4ZRU A;  4ZZB A;  3SH1 A;  2XQ5 A;  3C79 A;  4LMK A;  4IL9 A;  4ZJS A;  2LM2 A;  2LKH A;  3TLW A;  4NPP A;  5HCJ A;  2BYP A;  3WTI A;  3SQ9 A;  3UUB A;  2YOE A;  4TNW A;  3PMZ A;  5SYO A;  5HEH A;  2BJ0 A;  4HFI A;  5TVC A;  4QH5 A;  1UW6 A;  4TWD A;  2BR8 A;  2W8G A;  3JAE A;  4BQT A;  3EI0 A;  1UX2 A;  2M6I A;  4ZK4 A;  3SQ6 A;  3U8J A;  5FJV A;  5AFN A;  3UU4 A;  2YME A;  3EAM A;  3UQ7 A;  5AIN A;  2WNC A;  2BYN A;  2BYS A;  4HFC A;  2BG9 C;  3U8N A;  2ZJV A;  2XNV A;  4LMJ A;  2MAW A;  5KZU A;  3RI5 A;  2WZY A;  5LG3 A;  1UV6 A;  5J5I A;  5AFK A;  5HEO A;  2QC1 B;  3WTM A;  2XQ7 A;  4COF A;  2M6B A;  2Y56 A;  4QH4 A;  2YMD A;  3WTN A;  3UU5 A;  5J5H A;  3JAD A;  4TWF A;  4PIR A;  5LXB A;  4IRE A;  3TLU A;  4UM3 S;  4ZJT A;  3SIO A;  2Y57 A;  2KSR A;  5CO5 A;  5HEU A;  3U8M A;  5HEG A;  3RQW A;  3EHZ A;  5J5F A;  4UXU A;  5BP0 A;  3TLT A;  4ZZC A;  3P4W A;  2XZ5 A;  1OED E;  2Y58 A;  2XNT A;  1OED B;  3IGQ A;  4QAB A;  2XQ4 A;  2UZ6 A;  3LSV A;  4Z90 A;  4XK9 A;  2XQ3 A;  3TLS A;  3WTH A;  2WN9 A;  3U8K A;  3WTK A;  4NZB A;  2XQ8 A;  4TNV A;  4ILC A;  2XQA A;  2YN6 A;  4QAC A;  2X00 A; 
#chains in the Genus database with same CATH topology
 1IZN B;  3ANW B;  1FEW A;  3MAC A;  4B5D A;  5LBM A;  5L3B B;  5ABE A;  4Q25 A;  3SFD A;  4OYJ A;  3RYC E;  3ZMT B;  2LSK A;  3U78 A;  2CHN A;  4A97 A;  5AFM B;  1MIV A;  1HX8 A;  3DP7 A;  4EYU A;  2K48 A;  5AFJ A;  4J2C A;  2W62 A;  2MOZ A;  3HKB E;  1BR4 A;  3F57 A;  4AIU A;  4O4J E;  5AFL A;  2BR7 A;  3N9Q A;  3FZL B;  2NP9 A;  4ZZB A;  1WRD A;  5HXC A;  1M62 A;  3RYF E;  4JI2 T;  4JLE A;  2BR8 A;  3X1D A;  1KK7 A;  5JQG E;  5FNV E;  4IT4 A;  2V7I A;  5AQS B;  2CE7 A;  2XAJ B;  4O4H E;  5KZU A;  5H6Q B;  5AFK A;  2XY8 B;  3M65 A;  2XQ7 A;  3HA4 A;  1XMO T;  4JI8 T;  5CO5 A;  5AQK B;  5J5F A;  2V8S V;  2E8I A;  4CQI A;  3VU7 H;  3AE2 A;  4IDN A;  4JI3 T;  4JI7 T;  2CWY A;  4TNV A;  1OXZ A;  2IDO B;  4XBF B;  2L9Q A;  2PFV A;  3I9Y A;  2XNU A;  4HGA A;  1J1J A;  4OFZ A;  4DV5 T;  3ZMZ B;  1YQ3 A;  4ILU A;  3RIA A;  5AQJ B;  4XHE A;  4MAL A;  4HKA A;  4EED A;  4UF0 B;  4CXX A;  2WNJ A;  4PW8 A;  1FIO A;  2V5C A;  3NRY A;  5L4E A;  3NRX A;  3V5S A;  5KMG P;  3HL6 A;  1MMG A;  2UXC T;  4PJM A;  4E7Z A;  2BYR A;  1HS7 A;  4CXW A;  4O4I E;  2CLY B;  4WV9 A;  4ZI3 D;  2NR4 A;  2IUB A;  2V1D B;  3K3O A;  4LF6 T;  3RKG A;  2CEA A;  2I6H A;  4YJ3 E;  1WCR A;  3VR9 A;  1JNZ A;  4IL9 A;  5JR9 A;  1MIW A;  1FMW A;  5JDG A;  3EDV A;  5HAX A;  3K1S A;  2BJ0 A;  3NBX X;  3RH3 A;  5JDL A;  5EK3 A;  2FJD A;  4IE4 A;  4L9I A;  2LRK A;  5AFN A;  3KVB A;  2WNC A;  5LGU B;  5L3D B;  4P0B A;  3FHN A;  1KNP A;  2ZM0 A;  3EVY A;  5LNK A;  1D0Y A;  2VL8 A;  4TWF A;  4L5G A;  4B6X A;  2PTF A;  2KSR A;  5GON E;  4DV3 T;  3HI2 A;  4IHJ E;  2VVN A;  1HG5 A;  4PJL A;  3P4W A;  3RLF F;  2XM2 A;  1CUN A;  2XQ4 A;  5AQP B;  3EUH A;  2WN9 A;  3AE4 A;  2IC9 A;  1D1A A;  2LHR A;  2OA5 A;  3OBV E;  3UQ4 A;  4IL4 A;  4IGU A;  2MBG A;  4BA9 A;  1VOM A;  3WTO A;  5HEJ A;  1HG2 A;  4G2A A;  3KV9 A;  2MTQ A;  3N5L A;  1HTJ F;  4AKL A;  5C8Y E;  3PUY F;  4ZOL E;  4O2A E;  3Q2M A;  3QB5 K;  5JVD E;  4H9N C;  4DBQ A;  4ALX A;  4LML A;  4QWN B;  5DQV A;  4MFR A;  3CML A;  3TLW A;  2BYP A;  4PK5 A;  3SQ9 A;  4LFB T;  3PMZ A;  2LOP A;  2JIW A;  1UW6 A;  2WQY A;  4O2B E;  3EI0 A;  3A7M A;  4TX5 A;  3CWZ B;  2WY2 A;  3GN5 A;  3LK4 2;  1NEK A;  3OYX A;  4HWD A;  3WTN A;  3HKD E;  4EEB A;  4UM3 S;  4DV1 T;  2ZLY A;  4NUV A;  3FBZ A;  1BR0 A;  3VHL A;  3L09 A;  1YQ4 A;  5FXX A;  2UZ6 A;  4PJN A;  4U2Y A;  2W66 A;  1Y64 B;  5DJQ C;  2FJE A;  4QAC A;  3AEF A;  3RRW A;  2AXD S;  3EDU A;  2BVM A;  1ZHC A;  2NWB A;  1UCU A;  2HN1 A;  3E08 A;  3LJC A;  1LKX A;  5DQW A;  3PEO A;  5IWA T;  2LT3 A;  4D01 A;  4HFB A;  2Q9Q D;  3L8R A;  4DV6 T;  4JV5 T;  3ABV A;  4JYA T;  2BG9 B;  2CWO A;  4PFO A;  4AI6 A;  1YD8 G;  2IC6 A;  4GKK T;  1ZKE A;  4MBQ A;  2XYS A;  1NAF A;  1I94 T;  3H3M A;  2Y7Y A;  1E1H B;  5F3J A;  3KDS E;  5L3C B;  2BVL A;  2XQY A;  4EAH A;  2JMK A;  2DL1 A;  5HEH A;  3PU3 A;  3SQ6 A;  4LF9 T;  1XMQ T;  5TAO A;  4IST A;  5FL1 A;  4GK5 E;  3VR8 A;  3PUQ A;  1V9D A;  5FL0 A;  1VCT A;  3H37 A;  5JRE A;  4DV4 T;  2Y56 A;  3KIN B;  2LM9 A;  2Q9Q B;  3UTK A;  1ZOY A;  4X65 T;  3NWI A;  2Y8D A;  2Y57 A;  2M67 A;  3DTO A;  4PAG A;  4QXB B;  2FUP A;  3OKQ A;  5JRC B;  2RA1 A;  2I59 A;  2KXP B;  5DAB A;  4DR3 T;  1D0Z A;  5J2T E;  1S94 A;  4Z90 A;  3HR0 A;  3WTK A;  5FVL A;  1HNX T;  3AXJ A;  5AQN B;  2WAU A;  4AKI A;  1NWM X;  4NUU A;  3FXE B;  3O1H A;  5HCM A;  3UU6 A;  3ZKR A;  2R6G F;  3TKL B;  3C84 A;  1R8I A;  3PUW F;  2BZB A;  3ZMS B;  3LFM A;  4MHC A;  2KMF A;  5J0Z A;  5ADX L;  3PUX F;  4OYK A;  4KHP T;  3RGL A;  3VKG A;  3KVA A;  5L47 A;  3FZH B;  2LKG A;  4AIS A;  4X64 T;  4AFG A;  2RP4 A;  2X9X A;  2D0U A;  2BS4 A;  4EZH A;  4HE8 A;  1YKE B;  3AEA A;  5SYO A;  4X20 E;  2JQ9 A;  4YT0 A;  2W8G A;  2XSB A;  3C4Z A;  4WBN E;  4IE7 A;  1B7T A;  1MMD A;  3CVR A;  3ZMU B;  2E2A A;  5LGN B;  4KP3 C;  4AQY T;  5AQG B;  3RC3 A;  3ZEF B;  2X0H A;  4DR7 T;  4YHH T;  4N78 D;  4X1Y E;  4PIR A;  3SOL A;  3C51 A;  4F6R C;  2A9U A;  4PNI A;  3Q5D A;  1UK5 A;  4UXU A;  5BP0 A;  2JRK A;  2VVS A;  2K9A A;  2V6Y A;  4QAA A;  3E0Z A;  5FXV A;  2XZ6 A;  3ZDG A;  1IBK T;  2NTY A;  3MA9 A;  4HWH A;  5LG4 A;  3AEC A;  3WIP A;  1VCS A;  4IE5 A;  2DWK A;  2QRX A;  3FXD B;  3CQX C;  4TUY E;  3AEG A;  5LGT B;  5HYA A;  4IDP A;  4M1P A;  3ZYL A;  2NW9 A;  3K3N A;  2EHO A;  4Z91 A;  4ZK1 A;  4OX9 T;  3C98 B;  3RQU A;  3U8L A;  3T1H T;  3AAI A;  5FMN A;  4IDZ A;  2VK9 A;  2Q9Q C;  5LHG B;  1Z8U A;  5JR9 B;  2A3D A;  4ASK A;  3AED A;  3SH1 A;  4ZRU A;  1QUU A;  1E2A A;  1LRZ A;  3UUB A;  3G06 A;  1SHZ C;  2VUR A;  5ABF A;  5AQM B;  3ONX A;  4OHF A;  3UQ7 A;  3FB2 A;  3UT5 E;  5J5I A;  3ZT7 A;  3C64 A;  3RF1 A;  2X68 A;  3W15 B;  2YMD A;  3UU5 A;  1E7P A;  3UFG A;  5LHH B;  4FJO A;  2V7J A;  2WMN A;  3FBL A;  3SIO A;  2Y6X A;  5CA1 E;  3ZCI A;  4C90 A;  2ZMA A;  1S35 A;  3TLT A;  4P09 A;  4H9R C;  2Y58 A;  2VKO A;  3RRC A;  1HX1 B;  3MZK B;  5LMN T;  2WZI A;  1AJ3 A;  3BQI A;  3OTO T;  3P7I A;  2YN6 A;  2K24 A;  2CPT A;  4ZHQ E;  1MIY A;  2CXF A;  1W0B A;  4IE0 A;  2E5V A;  1Z0P A;  4CN4 A;  3F2E A;  4HEA A;  5BW2 A;  2WMO A;  3AE5 A;  2HN2 A;  4XZC A;  5H6R B;  3CQG B;  4QXC B;  3GUA A;  2KLQ A;  3MKD A;  3ZST A;  4AQF A;  4ILA A;  4X1K E;  2XHE B;  1QSD A;  4I4T E;  4UY2 A;  4QH1 A;  2X9Y A;  4KI0 F;  5FY1 A;  1D1B A;  5LJN A;  4HWC A;  2XQ9 A;  5HXR A;  4G63 A;  3LDQ B;  2UXD T;  2CCQ A;  4GYR A;  4KMC A;  4YXD A;  2IML A;  1U5P A;  3O9X A;  2H89 A;  2YOE A;  1FMV A;  3GN5 B;  3P4Q A;  4GOU A;  4GK0 E;  3AAE B;  2IHR 1;  4JI1 T;  2JQK A;  3RI5 A;  4DMV A;  4YTM A;  2QC1 B;  1YW0 A;  4WW0 A;  4QH4 A;  2BKO A;  3T1Y T;  4IRE A;  4GKJ T;  2JQH A;  3SFE A;  3O1I A;  3SWH A;  1XDP A;  5F5W A;  1OED E;  2C5K T;  1IBL T;  2XNT A;  2BKN A;  3N2O A;  4WBO A;  2OLT A;  5JR9 C;  5FXW A;  4X66 T;  4DUY T;  2Y48 B;  5CFB A;  1T98 A;  5IHY A;  2V6X A;  3VKH A;  4UM3 P;  2WDQ A;  4KHZ F;  3AA7 B;  4KUM B;  2KT9 A;  1WFD A;  2N2N A;  2IAK A;  5JDQ A;  1IAP A;  3JC6 D;  2LSJ A;  4NXN T;  4FRR A;  2VKJ A;  3MJX A;  3AE7 A;  5L4H A;  2JMH A;  4L0R A;  2XZE A;  4HWI B;  4C91 A;  2XPK A;  2YDQ A;  4A56 A;  2X66 A;  4LMK A;  1ZEE A;  3FZF B;  5HXS A;  2QA7 A;  3DJB A;  4DO0 A;  4ZS3 A;  3B57 A;  3RX6 A;  4HFI A;  2ODU A;  2I0M A;  2UXN B;  3O4X E;  4YY3 T;  2HHH T;  4DND A;  4EXT A;  3A8Y C;  2XAF B;  2H88 A;  3H3A A;  5HEO A;  5LCY A;  2DWG A;  3C4W A;  5BR8 T;  3CX6 B;  3NVO A;  3F31 A;  3C4X A;  1D1C A;  1HR0 T;  5HEU A;  4CN6 A;  2NOX A;  3EHZ A;  3UUL A;  2IIU A;  3PJA A;  4QX8 B;  4QAB A;  3AXJ B;  3CPZ A;  2UUC T;  5L2L A;  2ACX A;  4Z8X A;  4CI2 B;  3RIF A;  3N9N A;  4EZ1 A;  4P1N A;  5HXH A;  3P50 A;  4JBW F;  2P9B A;  4A98 A;  2V7L A;  4TV8 E;  5LJM A;  2VKD A;  3WAK A;  4HWF A;  2PGZ A;  1WYC A;  3IF8 B;  4ZR6 A;  4B3T T;  2PBI A;  3JCF A;  2KWI B;  3L3P A;  1MMN A;  1HCI A;  2SPC A;  4DVD A;  3UU8 A;  1N34 T;  3L39 A;  3AE8 A;  4JUY A;  1XDO A;  5FP3 A;  4YSZ A;  3AE1 A;  4HQP A;  3WAJ A;  2XQ5 A;  5LA6 E;  4YSX A;  1T72 A;  4ZI2 C;  3RIU A;  1UUS A;  2UUA T;  3N2K E;  3P4P A;  3KBT A;  2NW8 A;  3PV0 F;  3LBX A;  5AIN A;  4HFC A;  2B76 A;  3CQC B;  4AKR B;  3BK9 A;  4X1I E;  3AAA B;  2WU5 A;  2KWH A;  4JEU B;  4H9O C;  2XM1 A;  2J62 A;  3D0T A;  4I55 E;  2CBJ A;  2YK0 A;  3U8M A;  5FKY A;  3MXZ A;  3SRZ A;  3I9W A;  1HNZ T;  2V6Y B;  3P4R A;  2CXL A;  3ZYM A;  4XK9 A;  3RKO A;  5J2U E;  5JDM A;  2X00 A;  2BDE A;  1OED A;  4BFQ A;  5AQV B;  3NZP A;  5LB7 B;  3CIR A;  1MND A;  2DCF A;  3T4M A;  2CMR A;  4YTP A;  4AKG A;  1FJG T;  2VKH A;  1WYB A;  4AFH A;  2XAH B;  1HFA A;  2X67 A;  3PDY A;  4HFD A;  2E9X A;  5CGM A;  1XWM A;  2W00 A;  3UUN A;  5KXJ A;  2W61 A;  1U4Q A;  2C5I T;  1OED C;  2WU2 A;  3JC6 C;  4WYV A;  4I0U A;  3GA8 A;  2QYW A;  3AA6 B;  5JME A;  1SE7 A;  4UM3 A;  1US7 B;  4BJN A;  3ZT5 A;  4DBM A;  5ABF B;  2E9X C;  2NTX A;  4I50 E;  3QOF A;  1KFY A;  4H63 V;  4CXY A;  1LVF A;  3JAE A;  2M6I A;  4QKN A;  3HKE E;  2YME A;  4PFP A;  2CA5 A;  3I0Q A;  4LF4 T;  5EK4 A;  4OK0 A;  2YIN A;  1I6Z A;  5EZY E;  4AXP A;  5AQI B;  3NKZ A;  3AEE A;  4U7I A;  3MK7 C;  2FBW A;  3TLU A;  3AEB A;  4BJM A;  3ZJ1 A;  4UR9 A;  3AA0 B;  1KNR A;  2UXX B;  4O8S A;  5L3E B;  4U74 A;  4CI1 B;  2XZ5 A;  4CN1 A;  4MLK A;  3FZM B;  3TLS A;  3CX8 B;  4AQG A;  3C50 A;  2WZH A;  4HFE A;  5FY7 A;  4YJ2 E;  3AE9 A;  2D5U A;  3UFE A;  2A72 A;  4BAY B;  3QC9 A;  3OJA A;  1WR6 A;  2JJ9 A;  2D0T A;  2JQQ A;  3UU3 A;  2D9D A;  3PTR B;  3KV6 A;  4DR2 T;  4UVB B;  2DHR A;  5KE4 A;  2XYT A;  4EIW A;  2K3W A;  5FYM A;  2V5D A;  4IDQ A;  3AB3 B;  2E5L T;  3QK6 A;  2W2U A;  4U31 A;  1UX4 A;  5IUX A;  5AQL B;  4ISS A;  4KBM B;  3Q9D A;  5TVC A;  2HH7 A;  5LP6 E;  4WZX A;  4KX6 A;  2XAS B;  4GYS A;  4U33 A;  3V5U A;  2VQF T;  5AQH B;  1WR0 A;  2VQE T;  4O4L E;  3N9M A;  3U8N A;  3AE6 A;  4H9S E;  1G73 A;  5LG3 A;  4COF A;  2M6B A;  3ZYK A;  4LF7 T;  3JAD A;  2EHO C;  1KF6 A;  2Z6E A;  4YFS A;  3CKD A;  2V7M A;  5IYZ E;  5HEG A;  3KFW X;  4EGW A;  1G8X A;  1BR1 A;  1SA0 E;  1SUM B;  3LK3 B;  4LF8 T;  3R6N A;  5AQF B;  3A5X A;  4GIW A;  2XQ8 A;  2XQA A;  5C2T A;  2YKS A;  1WLX A;  3PUS A;  5CB4 E;  3LG7 A;  2DNX A;  3P8C D;  5AQQ B;  2BS2 A;  2WS3 A;  2C9T A;  5JTG A;  3I0O A;  4HFH A;  2Y54 A;  3SS1 A;  2JPF A;  1O3X A;  3Q5X A;  4AFT A;  2QGS A;  2BBJ A;  2XJ7 A;  4UVA B;  2MYS A;  1I9B A;  4FI5 A;  2DI4 A;  3AE3 A;  1W09 A;  3ONJ A;  2YU1 A;  3CK6 A;  2LM2 A;  2LKH A;  4YTN A;  4NPP A;  2VB6 A;  5HCJ A;  1J5E T;  1N32 T;  3UUM A;  2H7V C;  3ZMV B;  4V1A v;  4TNW A;  2LE8 A;  3PUR A;  4TWD A;  5FY0 A;  2AE9 A;  1IBM T;  4ZI2 D;  3PUA A;  1T7S A;  2MAW A;  2W67 A;  5JDN A;  2WZY A;  2ODV A;  3WTM A;  4U2Z A;  3QNU A;  1EZ3 A;  1OWA A;  5C3J A;  3U3I A;  4AQF C;  4CI3 B;  4DV2 T;  3ZN1 B;  4K0U A;  2L3L A;  4ADZ A;  1W9R A;  4ZI7 E;  2X51 A;  4DR5 T;  2XQ3 A;  1IJ5 A;  2J47 A;  2CHO A;  5JDH A;  3IEE A;  3TLV A;  5AFH A;  3HKC E;  3WTJ A;  1D0X A;  2LSG A;  2VL0 A;  4ANJ A;  5L3G B;  3ANW A;  3CX7 B;  5BRX A;  5BMV E;  2ZM6 T;  1J5W A;  5HWY A;  1YXR A;  3QUJ A;  3R84 B;  4UXN B;  1T8B A;  2XTL A;  1HF8 A;  4TN7 B;  5AFM A;  3I1A A;  4EZ4 A;  2BKP A;  1LVK A;  1YKH B;  3RPU A;  3JAF A;  3K8P C;  2X00 D;  4NIQ A;  4QXH B;  3C79 A;  4ZJS A;  1MMA A;  2ACZ A;  1CHU A;  3LBX B;  1XNQ T;  2WSS V;  2XSA A;  3UUX B;  4ZK4 A;  3U8J A;  2LHN A;  4P0A A;  5ABH A;  2KND A;  2E9X D;  2WCA A;  3PUZ F;  1UV6 A;  4JEH B;  4UEM A;  3RYI E;  1XNR T;  1GQE A;  5AQT B;  2LEH A;  3K3Q C;  5LMU T;  2YU2 A;  2ZM2 A;  3Q5W A;  1ZP0 A;  4TV9 E;  2IW5 B;  4ZZC A;  3WI3 A;  1OED B;  1VRB A;  3U8K A;  1DU2 A;  2V26 A;  3ZN0 B;  4NZB A;  2XAG B;  2G0U A;  3N9O A;  2HPL A;  3ONL C;  3T8O A;  2E9X B;  4ZS2 A;  3RHW A;  4B3S T;  2BYQ A;  5E0O A;  2KIN B;  4TWH A;  3WTL A;  2PG8 A;  5ABG A;  2WWV A;  2BS3 A;  2W63 A;  4NXM T;  4UF0 A;  4B3M T;  3M3Z B;  2BG9 E;  2H3R A;  5CA0 E;  4ILB A;  3VRA A;  2ZJU A;  5ETW A;  4JI4 T;  2PH9 A;  2RPA A;  2W4X A;  3ZCJ A;  4DV7 T;  2D2S A;  1HNW T;  2XUE A;  3B13 A;  3OVU A;  4I43 B;  3BQL A;  4H9P C;  1N33 T;  4QH5 A;  3J7Y q;  2UUB T;  5KX5 E;  5FJV A;  2GK9 A;  1X79 A;  2CRB A;  2WP9 A;  4LFA T;  3ZLI A;  1H7C A;  1UX5 A;  2VAS A;  4DMW A;  5L3F B;  2ZM8 A;  2N9D A;  3N2G E;  3GWH A;  2CLY C;  4WNK A;  4B3R T;  4DUZ T;  2PJQ A;  3PU8 A;  3RC8 A;  5LXT E;  3B5M A;  5HXE A;  4ZJT A;  2UXB T;  4YHJ A;  2MPK A;  3RQW A;  2ES0 A;  2NW7 A;  4ERR A;  4EB6 E;  3ZPO A;  3IGQ A;  2EHO D;  3ZT6 A;  2L8K A;  3WTH A;  2F4V T;  3IA3 A;  1M7K A;  4ILC A;  3RIU C;  2W8F A;  4X5T A;  4F8H A;  4JI5 T;  2VWA A;  5LOV E;  2W0G A;  3QB5 A;  4UIG A;  2LSI A;  1ZV4 X;  4TZ4 C;  4UV8 B;  3PUV F;  3PE0 A;  4IE6 A;  2UU9 T;  4DR1 T;  5J5G A;  2LLY A;  2WBL A;  4UM1 A;  4IDO A;  3E22 E;  4ZI3 C;  4LF5 T;  1IJ6 A;  4H9Q C;  5KDM C;  4HTE A;  4YSY A;  2HPJ A;  4DR6 T;  3S4U A;  2BBH A;  3ESL A;  5AQR B;  3Q5E A;  2LOS A;  2A2F X;  3P4S A;  3KV4 A;  2C0S A;  2EHO B;  5LYJ E;  5LBQ B;  3IHR A;  2CM0 A;  4PK6 A;  2WDV A;  5CJ5 A;  4DV0 T;  3KV5 A;  3KBU A;  4JI0 T;  3WTI A;  2B1E A;  2K5B B;  2X9W A;  3AVS A;  3ZC0 A;  4BQT A;  2LSY A;  3IBP A;  1KNZ A;  4UV9 B;  2FJB A;  5AQO B;  4U7Y A;  3J9X 1;  3EAM A;  3UU4 A;  2BYN A;  1KEY A;  1X9B A;  2ZJV A;  2XAQ B;  4K0K T;  2J4G A;  2LRL A;  2X9H A;  4EV6 A;  5LHI B;  4LFC T;  4QX7 B;  4E7S A;  2WM9 A;  5LXB A;  4PJJ A;  1NEN A;  2FJA A;  1BR2 A;  5FXZ A;  2YDR A;  1UUR A;  3ZJ2 A;  5FVK A;  2KZ7 B;  4ZXL A;  5M4Y A;  3LSV A;  1W0A A;  5J1G A;  3AA1 B;  4QHO A;  4IIJ E;  3ETU A;  3N9L A;  4EYY R;  5F8P A;  5JDF A;  4A5X A;  4UVC B;  2WNL A;  2N1G A;  2H7O A;  3ZDH A;  2YEV C;  1MNE A;  2QVA A;  2YDS A;  1N36 T;  1L0V A;  5AFU L;  3ZSS A;  3PUG A;  2CXD A;  1XZY A;  2XQ6 A;  2OV9 A;  1JNR A;  4XAX B;  4DBR A;  4DR4 T;  2X0Y A;  5AQU B;  4CZZ B;  5HWX A;  2DLR A;  3RYH E;  2BG9 A;  4JI6 T;  3LK2 B;  4HN9 A;  2J1D G;  5JH7 E;  4DID B;  3ETV A;  4H63 H;  2WDR A;  4U72 A;  1UX2 A;  2V7K A;  5A1L A;  2WB5 A;  5EK2 A;  3OYZ A;  2CBI A;  2WWU A;  3N9P A;  2LJL A;  2BYS A;  3VRB A;  4U3C A;  2BG9 C;  3O1J A;  2XNV A;  2C5J A;  4LMJ A;  3OPC A;  3ZC1 A;  4ZEY A;  5J5H A;  3FZK B;  4EOZ B;  3PJA J;  1QLB A;  3GMI A;  4UEL A;  4AKH A;  2Q9Q A;  4PK4 A;  1Y01 A;  3EAB A;  3BQK A;  2X0L B;  4HFV A;  1UGO A;  3AVR A;  3NZQ A;  5JRC A;  4X62 T;  4YLH A; 
#chains in the Genus database with same CATH homology
 4HFE A;  2W8F A;  4QAA A;  4X5T A;  1OED A;  4BFQ A;  2XZ6 A;  4F8H A;  3RIF A;  3ZDG A;  2YKS A;  5CFB A;  2XNU A;  3TLV A;  5AFH A;  4EZ1 A;  4UM3 P;  3P50 A;  3T4M A;  3UQ4 A;  3WIP A;  2WNL A;  3WTJ A;  4A98 A;  4IL4 A;  4B5D A;  5HCM A;  3RHW A;  3RIA A;  5J5G A;  2VL0 A;  4XHE A;  2LLY A;  3UU6 A;  3UU3 A;  3ZKR A;  2BYQ A;  4AFH A;  5BW2 A;  3ZDH A;  5BRX A;  4TWH A;  4UM1 A;  3WTL A;  3C84 A;  2C9T A;  4HFD A;  2PGZ A;  2WNJ A;  3PEO A;  4ZR6 A;  4A97 A;  4HFH A;  2Y54 A;  3WTO A;  5HEJ A;  5KE4 A;  4Z91 A;  5J0Z A;  2XYT A;  4D01 A;  5AFM B;  3GUA A;  5L4E A;  4HFB A;  4AFT A;  4FRR A;  1OED C;  4ILA A;  2XQ6 A;  5AFJ A;  4ZK1 A;  2BG9 E;  2BYR A;  4ILB A;  3UU8 A;  3RQU A;  2BG9 B;  5L4H A;  3U8L A;  1I9B A;  5AFM A;  4UY2 A;  5L47 A;  4WV9 A;  2ZJU A;  4QH1 A;  2LKG A;  5AFL A;  5JME A;  2BR7 A;  2XYS A;  2PH9 A;  4AFG A;  4ALX A;  3JAF A;  4UM3 A;  4LML A;  2BG9 A;  2X00 D;  2XQ9 A;  4HQP A;  5IUX A;  4DBM A;  2Y7Y A;  4ZRU A;  4ZZB A;  3SH1 A;  2XQ5 A;  3C79 A;  4LMK A;  4IL9 A;  4ZJS A;  2LM2 A;  2LKH A;  3TLW A;  4NPP A;  5HCJ A;  2BYP A;  3WTI A;  3SQ9 A;  3UUB A;  2YOE A;  4TNW A;  3PMZ A;  5SYO A;  5HEH A;  2BJ0 A;  4HFI A;  5TVC A;  4QH5 A;  1UW6 A;  4TWD A;  2BR8 A;  2W8G A;  3JAE A;  4BQT A;  3EI0 A;  1UX2 A;  2M6I A;  4ZK4 A;  3SQ6 A;  3U8J A;  5FJV A;  5AFN A;  3UU4 A;  2YME A;  3EAM A;  3UQ7 A;  5AIN A;  2WNC A;  2BYN A;  2BYS A;  4HFC A;  2BG9 C;  3U8N A;  2ZJV A;  2XNV A;  4LMJ A;  2MAW A;  5KZU A;  3RI5 A;  2WZY A;  5LG3 A;  1UV6 A;  5J5I A;  5AFK A;  5HEO A;  2QC1 B;  3WTM A;  2XQ7 A;  4COF A;  2M6B A;  2Y56 A;  4QH4 A;  2YMD A;  3WTN A;  3UU5 A;  5J5H A;  3JAD A;  4TWF A;  4PIR A;  5LXB A;  4IRE A;  3TLU A;  4UM3 S;  4ZJT A;  3SIO A;  2Y57 A;  2KSR A;  5CO5 A;  5HEU A;  3U8M A;  5HEG A;  3RQW A;  3EHZ A;  5J5F A;  4UXU A;  5BP0 A;  3TLT A;  4ZZC A;  3P4W A;  2XZ5 A;  1OED E;  2Y58 A;  2XNT A;  1OED B;  3IGQ A;  4QAB A;  2XQ4 A;  2UZ6 A;  3LSV A;  4Z90 A;  4XK9 A;  2XQ3 A;  3TLS A;  3WTH A;  2WN9 A;  3U8K A;  3WTK A;  4NZB A;  2XQ8 A;  4TNV A;  4ILC A;  2XQA A;  2YN6 A;  4QAC A;  2X00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...