3EAMA

An open-pore structure of a bacterial pentameric ligand-gated ion channel
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a pentameric ligand-gated ion channel in an apparently open conformation.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3eamA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3eamA01
3UUBA 5AFMB 4ZRUA 3TLUA 4UM3S 3LSVA 3WIPA 1UW6A 2BR8A 2BYPA 2LLYA 2XQ3A 4Z91A 5KZUA 3WTNA 2KSRA 3P50A 2Y54A 5HEGA 3RHWA 3UU3A 4LMKA 4TWHA 4TWFA 4F8HA 4ZZBA 3WTLA 2BYRA 3U8MA 2XYTA 2BR7A 2LKGA 4ZR6A 4TNWA 2W8FA 5CO5A 3WTMA 3TLTA 3C84A 4QH4A 2XQ6A 4HFHA 5BRXA 3TLVA 4QACA 3SQ9A 3U8LA 5KE4A 5AFJA 4XK9A 2C9TA 4A97A 2BYQA 2BG9A 4PIRA 4BQTA 4UM3P 2Y57A 2XQ8A 2YKSA 5HEUA 4FRRA 4WV9A 4IL9A 4AFGA 4ZJTA 1OEDA 2VL0A 2BJ0A 3WTKA 3UU8A 2LKHA 3EAMA 3ZDHA 4X5TA 2YN6A 4LMJA 2WZYA 5AFHA 3RIFA 4UM3A 3SQ6A 2XNUA 4HQPA 5L4HA 5J5FA 4ZZCA 4B5DA 5HEHA 5HCMA 2YMEA 4UY2A 3ZKRA 1OEDB 3T4MA 4EZ1A 3U8JA 1UV6A 3WTIA 4NPPA 2QC1B 2M6BA 4ILAA 3JAEA 4TWDA 2BG9B 2PH9A 3EHZA 2XYSA 3PMZA 4XHEA 2BYNA 5J5GA 5AFNA 3TLWA 5J5HA 3PEOA 4UXUA 2YMDA 5LG3A 4D01A 5JMEA 3JAFA 2ZJVA 5HEJA 2BYSA 2W8GA 2WNCA 2XQ5A 2Y58A 5J5IA 4LMLA 2WNLA 5FJVA 2UZ6A 5IUXA 4QAAA 5AFLA 4IL4A 3P4WA 4HFCA 4ZJSA 2Y56A 3JADA 4ILBA 5SYOA 2XQ4A 2WN9A 3SIOA 5AFMA 2WNJA 4HFEA 5CFBA 3UU6A 3U8KA 4DBMA 4AFHA 5BW2A 5TVCA 5HEOA 5AINA 1OEDE 4IREA 5HCJA 5J0ZA 5BP0A 4A98A 2XZ5A 2ZJUA 4Z90A 2XQ7A 3GUAA 5LXBA 4QH5A 3TLSA 4ILCA 4AFTA 4ZK1A 2XQ9A 3EI0A 3RQWA 1UX2A 4HFDA 4HFIA 4NZBA 3UQ4A 4BFQA 3RQUA 3IGQA 3RIAA 2XQAA 3SH1A 2XZ6A 2MAWA 5L47A 2X00D 2XNVA 2YOEA 4ZK4A 3RI5A 3UU4A 2BG9C 2BG9E 3WTHA 4COFA 2X00A 4QABA 4UM1A 4TNVA 3UQ7A 3U8NA 1OEDC 3C79A 3WTOA 4ALXA 5L4EA 3UU5A 2Y7YA 4HFBA 2LM2A 3ZDGA 1I9BA 2PGZA 3WTJA 5AFKA 2M6IA 2XNTA 4QH1A
chains in the Genus database with same CATH superfamily
3ZYLA 4NUUA 2VL8A 5KZUA 4JI5T 3I9YA 3TKLB 4I55E 3HA4A 3QK6A 4QACA 4GK0E 2OV9A 4HWHA 3U78A 4C90A 4H63V 4IL9A 3AEGA 4KMCA 1I6ZA 3ZDHA 4LMJA 2NOXA 3VKGA 3SFDA 3UUMA 5JDHA 4ILAA 3EHZA 4DV5T 1T8BA 3RIUC 2K3WA 4X62T 2Y58A 5LGTB 5J5IA 4LMLA 2WNLA 4JI1T 1W0BA 5SYOA 5KX5E 3KV6A 2V7LA 4LF7T 4LFAT 4B3RT 4AI6A 3A8YC 5JR9A 4GOUA 2DCFA 1UX2A 1E7PA 5LOVE 4ADZA 4DV6T 4ZS2A 1FMVA 3KINB 2MAWA 4YHHT 1UCUA 4TUYE 1US7B 3UU4A 2HN2A 3T1YT 4PJNA 5AQFB 3WTOA 2IIUA 3RPUA 3RH3A 4YFSA 4YSXA 2D9DA 2V6XA 2X51A 1NEKA 2BKOA 4CZZB 5LMUT 1YW0A 1YKEB 3SFEA 3LFMA 3C64A 4DVDA 3RF1A 1L0VA 1OWAA 3MACA 2Y8DA 1YQ3A 4X1YE 1UV6A 4EZHA 5JRCA 2IUBA 2X0HA 1JNRA 3L09A 3HKCE 5AQJB 3OKQA 2WNCA 4QWNB 3BQIA 4QXBB 1MNDA 5HXHA 3V5UA 5AFLA 4EXTA 3QNUA 1T7SA 4AKGA 4DV4T 5LHGB 1BR1A 3A5XA 5ETWA 1MMDA 3ZJ1A 3E0ZA 3CKDA 4UVBB 3KVBA 3SIOA 2W0GA 3O4XE 3LK42 5JR9C 5L3DB 2JJ9A 3VKHA 3GUAA 4IDOA 2LSGA 2OA5A 3B57A 4PJMA 2BG9C 2Q9QB 3VHLA 3QC9A 4U74A 3EDUA 2V5CA 2J4GA 3X1DA 5LNKA 3CMLA 4EV6A 4ZI3C 1UGOA 2BBHA 5HEGA 1HG5A 5ADXL 5HXCA 3PU8A 3SS1A 2XYTA 5FY1A 4JI3T 2N9DA 3WAKA 2A2FX 4OK0A 3CVRA 5CA1E 1V9DA 5TAOA 4F6RC 2B1EA 4FRRA 5FL1A 1YKHB 3GN5A 2WU5A 4LF8T 4WZXA 2VL0A 2W00A 2DWGA 3PUAA 2CEAA 2CMRA 3K8PC 3OBVE 2DLRA 5JREA 1LKXA 2YMEA 3ZCIA 1VOMA 4DBRA 2UXDT 2A3DA 1I94T 3FZMB 5AQOB 4DR5T 5HYAA 3CX6B 3UFGA 3EDVA 3JCFA 2K5BB 3Q2MA 3UULA 2L3LA 3C50A 1WYCA 4PAGA 5LGUB 3AXJB 2WMOA 3P7IA 4XAXB 5EK3A 3F2EA 3N9QA 3P4WA 2XQ4A 4DV0T 2CLYC 2VK9A 5TVCA 4I4TE 5ABFA 5J0ZA 4A98A 2XQ7A 4O8SA 5FXXA 5H6RB 3RQWA 3Q9DA 5JH7E 3J9X1 3UQ4A 2V7IA 4H63H 2JQ9A 1N36T 3WTHA 4H9NC 4DR4T 1MMGA 1H7CA 3NWIA 1WR0A 2H7OA 1WCRA 3PDYA 4JI8T 2KINB 2E2AA 4NIQA 2LLYA 2XHEB 4FJOA 3WTNA 4K0UA 5IWAT 5EK4A 2W2UA 2V7JA 4ZOLE 1ZEEA 3S4UA 3C84A 2NTYA 2BYQA 4ANJA 4CN1A 2VQET 4ZJTA 1NAFA 2PTFA 3KFWX 3KVAA 5BR8T 2EHOB 3CQGB 4CXXA 4UY2A 2BVMA 3WTIA 5JQGE 3SWHA 3OTOT 1SA0E 2D0TA 4P0BA 4M1PA 3CQCB 4ZEYA 4X1KE 4DR7T 3LJCA 2WAUA 4HGAA 2CLYB 2NTXA 4NXNT 3AA6B 4O4JE 3ZT7A 2XTLA 5HEOA 5HCJA 3N2KE 3TLSA 3FBZA 4AFTA 3JC6C 2X9WA 2QGSA 3CQXC 4U3CA 3K3NA 3RIAA 4ZHQE 2D0UA 4MFRA 3RI5A 2W63A 3AE3A 5A1LA 3IF8B 1I9BA 3L3PA 2M6IA 5CA0E 4IDQA 1GQEA 3FHNA 3G06A 2W66A 3LBXB 1G73A 3QUJA 2KSRA 4YTPA 3LK3B 4CI3B 2YU1A 3E08A 3PURA 4JUYA 4HN9A 1FJGT 2XQ6A 4MALA 3WAJA 1WYBA 5JDNA 5ABEA 4PIRA 2E9XC 2YKSA 3AE5A 1MIYA 4KBMB 2BJ0A 1KNZA 3EAMA 2DNXA 4UIGA 2L9QA 4U72A 5J5FA 3LG7A 5ABFB 3ETUA 3T4MA 2ACZA 1FEWA 4XHEA 3RYCE 5JTGA 5LYJE 2ZM6T 3TLWA 2XUEA 3C98B 3ZLIA 2CXFA 3ANWB 3W15B 2BYSA 1WLXA 2XQ5A 2JRKA 4DNDA 3CIRA 1T98A 5IUXA 2WM9A 3VR9A 4PNIA 4ZS3A 2BVLA 1N34T 2RPAA 2UXCT 4QH5A 1ZV4X 2HPJA 2ZLYA 3ZYKA 2YEVC 2XNVA 3UTKA 1HR0T 4LF6T 2WDQA 4JI6T 4ALXA 4HFBA 2PGZA 4EAHA 4QH1A 5FXVA 1HS7A 3UUBA 2XSAA 5AFMB 4H9PC 2VKJA 2BR8A 4Z91A 2G0UA 3P50A 3P4SA 4UF0A 3R6NA 3M65A 1W09A 4PK4A 3C51A 2ACXA 3PUYF 1XMOT 1HF8A 2R6GF 3WTMA 4QH4A 2XJ7A 5AQRB 3I0OA 5KDMC 4U31A 2Y48B 3N9LA 3ONXA 2VKOA 4AQGA 5AFHA 2H3RA 3RYFE 4P0AA 2X68A 4DV3T 2XYSA 4TWDA 2SPCA 2BG9B 4ZI2C 2MPKA 2YMDA 2V7KA 3JAFA 4GYRA 5JMEA 1S94A 4H9RC 5JDFA 3UUNA 4L0RA 2CWYA 3AE7A 4EZ4A 3PUSA 3ZMTB 3JADA 1IZNB 1LVFA 4XBFB 4HFEA 2XAQB 3C4ZA 4H9QC 2WWUA 4X64T 1N32T 1OEDE 5BP0A 2K9AA 2ZM2A 4WW0A 1X9BA 2UXNB 2C5KT 2VKDA 3AEEA 4DUZT 5AQNB 2IDOB 2CXDA 5HXRA 4NUVA 2LE8A 3ZDGA 3WTJA 5AFKA 3AAEB 3AA0B 1QLBA 5HWYA 4ZRUA 3RRWA 2BYPA 2XQ3A 2WP9A 3GWHA 1W0AA 4DMWA 2D2SA 3RHWA 4TWHA 4TWFA 3MKDA 1XWMA 4ZR6A 4AQFC 2BS4A 2X0YA 2ODUA 4P09A 2C9TA 4WV9A 4IGUA 3WTKA 3UU8A 2RA1A 2QVAA 5IHYA 2WDVA 3N2GE 4J2CA 4JI4T 1KNPA 4B5DA 2I59A 1YXRA 1MMAA 2K48A 1UURA 2WS3A 4DIDB 4PFOA 1VRBA 5FY7A 5HEJA 3ANWA 4CI1B 4L9IA 4JI0T 4IL4A 2WY2A 4HFCA 1HNWT 3ETVA 5AFMA 4DBMA 4KP3C 2WDRA 3UT5E 4UELA 4O4IE 1G8XA 1KEYA 4WYVA 3VRAA 3N5LA 4TN7B 5L2LA 2BKNA 1HFAA 5J2UE 4IHJE 2FJDA 4H9OC 2XZ6A 2I6HA 2UU9T 2YOEA 4ZK4A 4A5XA 2C0SA 4AKRB 1MNEA 3KV9A 4JI7T 5L4EA 2M67A 4DV7T 5CJ5A 2XNTA 2PBIA 4WBOA 1XDOA 3LSVA 2AXDS 3ONLC 4UR9A 3RKGA 2D5UA 3UFEA 1HNXT 3DP7A 4DR1T 3IA3A 5FYMA 2VKHA 4ZI7E 4CI2B 4ZZBA 5CO5A 5F3JA 2V1DB 3C4XA 5L3FB 3U8LA 5DQVA 5HEUA 3BK9A 3AECA 3B13A 5L3BB 2QRXA 5EK2A 4OX9T 3FBLA 4GKJT 3AEAA 2XNUA 4IDNA 3ZMSB 3ESLA 4GIWA 4HFVA 3HL6A 2CE7A 1XNRT 1XMQT 3OJAA 4EB6E 2CBJA 3AE6A 1U5PA 4UXUA 2E9XD 5LG3A 4D01A 2ZJVA 5FXZA 3MJXA 3OYXA 4DR2T 3FZKB 3I1AA 3VRBA 2W62A 2VURA 4CXWA 1UX5A 4YTMA 4EOZB 2MYSA 3FZFB 2YK0A 2OLTA 2XQ9A 3QB5K 3IBPA 2HN1A 4HFDA 3RQUA 1WRDA 4I43B 4MHCA 2L8KA 3I9WA 1ZHCA 3RYIE 2JQQA 3JC6D 3AVSA 3U8NA 3O1HA 3C79A 2LM2A 1M7KA 3L39A 3TLUA 1QUUA 1UW6A 2C5IT 4B6XA 3QB5A 4UVAB 5ABHA 3NZQA 5LA6E 2X0LB 2BR7A 2BZBA 5L3GB 3K3QC 1WR6A 4O2AE 3GMIA 4AISA 3P4QA 3RX6A 1BR2A 2BG9A 2MTQA 2FUPA 5AQGB 4YTNA 1XDPA 2MOZA 2XQ8A 3KDSE 3ABVA 3KBTA 2VQFT 3HKBE 3U8JA 3ZYMA 2K24A 2QC1B 4X66T 3BQLA 5AFNA 2UXBT 3PEOA 3T1HT 5FKYA 4JEUB 4E7ZA 4AXPA 3I0QA 2JQHA 2W67A 4LF5T 4UF0B 3N9PA 3KV4A 2IAKA 5FNVE 5JDLA 1YD8G 4IREA 5FL0A 3ONJA 4U7IA 5LXBA 3H3AA 2E5LT 2DWKA 1AJ3A 2N1GA 2NP9A 4TZ4C 3MZKB 4EEBA 3CPZA 5ABGA 4ILUA 1R8IA 3AE8A 4X20E 4MBQA 2W61A 1BR0A 1MMNA 5E0OA 5C8YE 2UUCT 5DABA 2XSBA 5LJNA 4AIUA 5JDMA 1IJ5A 3AE9A 2JPFA 2QYWA 2KLQA 3AEDA 4IE4A 2Y6XA 3K1SA 3U8MA 2LKGA 3AVRA 3FZLB 3TLTA 2XY8B 1CHUA 2J62A 4YSZA 4JYAT 2LEHA 4BQTA 2WZHA 5JRCB 3E22E 5LP6E 3QOFA 1E2AA 1HTJF 3ZN1B 3K3OA 4ERRA 1FMWA 3U3IA 5L3CB 2M6BA 1X79A 5J5HA 2V8SV 5AQIB 2KWHA 3RRCA 3CK6A 2W8GA 3D0TA 4EYYR 4YJ3E 4PW8A 5KXJA 2KXPB 1E1HB 4K0KT 2WN9A 4HTEA 1ZKEA 4B3MT 3U8KA 4AFHA 5BW2A 1D0YA 1U4QA 2XZ5A 4Z90A 4CN6A 2WMNA 3ZT5A 1ZOYA 1IBLT 4HFIA 4AQFA 4BFQA 3FZHB 4UVCB 2XQAA 3ZT6A 2X00D 3PTRB 5AQQB 4DMVA 5FVKA 2X00A 4PJLA 2A9UA 4BJNA 4I50E 4Q25A 2Y7YA 1T72A 4GK5E 2E5VA 2I0MA 3PJAA 3EABA 1Y64B 3T8OA 3PUZF 3WTLA 2V6YA 3BQKA 2LHNA 3AA1B 4IE7A 2BKPA 5AQKB 2XZEA 2PG8A 3CX7B 5BRXA 5AFJA 1N33T 3O1JA 4A97A 3FXDB 3LK2B 5GONE 3PUVF 2IC6A 5JDQA 2BS3A 3J7Yq 5L3EB 3RIFA 4UM3A 3SQ6A 5L4HA 4LF9T 4WBNE 2P9BA 2X9YA 1OEDB 3ZEFB 3L8RA 2VWAA 5J5GA 5FXWA 3CX8B 4V1Av 1OXZA 2A72A 2YDRA 4KX6A 4CN4A 3AE1A 2AE9A 1IBKT 2JIWA 1IBMT 1D0ZA 4ZJSA 4YJ2E 4JI2T 3AAIA 3LBXA 3FXEB 2WNJA 3RYHE 5CFBA 1UUSA 1XZYA 2YDQA 2N2NA 3NRYA 2UXXB 4ILCA 1HCIA 5AQMB 5AQUB 5C3JA 2VVSA 2QA7A 2YINA 3HKDE 4KI0F 3RC8A 4OYKA 3N2OA 1D0XA 1KNRA 3ZSTA 1O3XA 3AA7B 1YQ4A 4HKAA 2BG9E 5LCYA 4COFA 4TNVA 3UU5A 5FVLA 4QX7B 4O2BE 3ZMVB 4KHPT 2XM1A 5F5WA 3DJBA 2JMHA 1XNQT 3UU3A 4CQIA 4LMKA 2RP4A 3PUQA 3SRZA 4XK9A 1VCTA 5LB7B 5LBMA 4UM3P 2CBIA 2WZIA 4IDPA 2UUAT 1EZ3A 2LKHA 2JQKA 5LBQB 5AQHB 3NKZA 2ZM0A 3NVOA 5M4YA 3EVYA 5HEHA 4HE8A 4NXMT 3AE2A 4Z8XA 2LT3A 5FP3A 2PH9A 2XPKA 2BYNA 4JLEA 2DL1A 4H9SE 2WSSV 4QXCB 2FJAA 2V6YB 4ZI3D 2BBJA 4YLHA 3ZMUB 5JVDE 2BS2A 4IE5A 4AKIA 2J47A 5JDGA 3ZMZB 4A56A 2LOPA 5AQVB 3VR8A 5HAXA 2PJQA 3UU6A 2WB5A 3ZC0A 3LDQB 4YT0A 3PV0F 5C2TA 1D1BA 2CPTA 2ZJUA 1D1CA 4AKHA 3WI3A 3IGQA 1SE7A 4KUMB 3ZN0B 2XAGB 2DI4A 2Z6EA 5BMVE 4GYSA 3UQ7A 3M3ZB 4XZCA 2MBGA 2X9HA 5HWXA 2E9XB 3WIPA 2BDEA 3H3MA 2X67A 4HWCA 2JMKA 4EYUA 5AFUL 4F8HA 3IEEA 2ODVA 3UUXB 5LHIB 2CCQA 2KT9A 1NWMX 4L5GA 1KFYA 3RKOA 1NENA 4TX5A 4AFGA 5LMNT 4X5TA 3NBXX 4G2AA 5LXTE 4HQPA 4BAYB 2WBLA 3AEFA 5CGMA 1ZP0A 4TV9E 3OYZA 1Z8UA 3JAEA 4ZXLA 3EUHA 4PK6A 3AB3B 3KV5A 2XAFB 3ZPOA 2E8IA 2V7MA 4DUYT 3NRXA 4ILBA 4X65T 4U7YA 3F31A 3FB2A 2H7VC 4P1NA 1B7TA 1LVKA 3PU3A 4UV9B 1MIVA 3AXJA 3Q5DA 2WQYA 2KWIB 4KHZF 1SHZC 3EI0A 4NZBA 1MIWA 3SH1A 2FJBA 2VASA 5LHHB 4G63A 4QABA 5AQTB 4UEMA 3HKEE 4ASKA 1IAPA 2LJLA 2HH7A 4DR6T 4AQYT 4OFZA 4UV8B 1Y01A 2YDSA 5FY0A 2CHOA 2Y54A 3O9XA 4EIWA 4YXDA 3OPCA 2BYRA 4BJMA 5EZYE 4TNWA 1CUNA 2NW7A 4HFHA 2XM2A 5J2TE 5AQLB 2J1DG 2CWOA 1OEDA 5DQWA 2HHHT 2NWBA 2YN6A 2WZYA 4E7SA 4YY3T 1FIOA 1UX4A 1IJ6A 2IMLA 2VVNA 2Q9QD 3A7MA 1SUMB 3ZCJA 2IC9A 4NPPA 1W9RA 4DO0A 2LOSA 3AE4A 5LG4A 3PMZA 4JBWF 3PJAJ 3IHRA 4IDZA 2HPLA 4C91A 3ZSSA 3ZC1A 5AQPB 3RLFF 5HXEA 1HX8A 1S35A 1KK7A 3HI2A 3OVUA 5CB4E 5DJQC 1HX1B 2XQYA 2F4VT 3AEBA 2LRLA 3PUWF 1J5ET 3C4WA 2FJEA 3N9MA 1JNZA 4ZK1A 3ZJ2A 5J1GA 4EEDA 2XAJB 3F57A 4UXNB 2X9XA 4IE6A 2GK9A 4HWDA 3P4PA 4PFPA 4LF4T 2H89A 2W4XA 4UM1A 1OEDC 4YSYA 2EHOC 4AKLA 2WCAA 4UM3S 3P8CD 4QXHB 4DV1T 5F8PA 2NW9A 1D1AA 5LJMA 1UK5A 4O4LE 2CRBA 2IHR1 3V5SA 1BR4A 2LHRA 5KE4A 1Z0PA 2DHRA 5FMNA 2CM0A 2Y57A 4DR3T 1HNZT 2NW8A 2ZM8A 4IIJE 4JV5T 4HEAA 5JR9B 2LSJA 2Q9QC 4ZZCA 1LRZA 4ZI2D 3H37A 3SOLA 1M62A 4U33A 4EZ1A 3MXZA 4YHJA 4LFCT 2LRKA 4MLKA 4N78D 4U2ZA 2KZ7B 4FI5A 3PUXF 4DV2T 3R84B 1WFDA 4B3ST 2PFVA 2C5JA 2EHOD 2E9XA 2LSKA 3MA9A 3Q5XA 2EHOA 5AINA 2V5DA 5AQSB 4DBQA 4TV8E 2YU2A 3N9NA 1DU2A 3O1IA 4QKNA 2CXLA 3N9OA 5L47A 4IT4A 2VB6A 4GKKT 1J1JA 5IYZE 3RC3A 2ES0A 1J5WA 2WWVA 3AAAB 3VU7H 3P4RA 2XAHB 4HWIB 1HG2A 3Q5WA 2IW5B 4CXYA 3NZPA 2NR4A 3DTOA 3GA8A 4OHFA 2W8FA 3TLVA 4OYJA 3SQ9A 4PJJA 2LSIA 3KBUA 2KMFA 4B3TT 2LSYA 2CHNA 4QX8B 2B76A 5HCMA 5HXSA 2UUBT 4I0UA 5H6QB 3ZKRA 2FBWA 4LFBT 3MK7C 3HR0A 2WU2A 3PE0A 2LM9A 3PUGA 5KMGP 4EGWA 1VCSA 3CWZB 4PK5A 2KNDA 5FJVA 2UZ6A 4QAAA 2H88A 2V26A 4O4HE 4X1IE 2Y56A 4ISTA 1KF6A 4JEHB 4WNKA 4HWFA 5LGNB 4IE0A 2X66A 1QSDA 4ISSA 2Q9QA 3GN5B 2XASB 3B5MA 3RGLA 2ZMAA 4BA9A 4QHOA 3RIUA 3Q5EA 2CA5A 4U2YA
chains in the Genus database with same CATH topology
3UUBA 5AFMB 4ZRUA 3TLUA 4UM3S 3LSVA 3WIPA 1UW6A 2BR8A 2BYPA 2LLYA 2XQ3A 4Z91A 5KZUA 3WTNA 2KSRA 3P50A 2Y54A 5HEGA 3RHWA 3UU3A 4LMKA 4TWHA 4TWFA 4F8HA 4ZZBA 3WTLA 2BYRA 3U8MA 2XYTA 2BR7A 2LKGA 4ZR6A 4TNWA 2W8FA 5CO5A 3WTMA 3TLTA 3C84A 4QH4A 2XQ6A 4HFHA 5BRXA 3TLVA 4QACA 3SQ9A 3U8LA 5KE4A 5AFJA 4XK9A 2C9TA 4A97A 2BYQA 2BG9A 4PIRA 4BQTA 4UM3P 2Y57A 2XQ8A 2YKSA 5HEUA 4FRRA 4WV9A 4IL9A 4AFGA 4ZJTA 1OEDA 2VL0A 2BJ0A 3WTKA 3UU8A 2LKHA 3EAMA 3ZDHA 4X5TA 2YN6A 4LMJA 2WZYA 5AFHA 3RIFA 4UM3A 3SQ6A 2XNUA 4HQPA 5L4HA 5J5FA 4ZZCA 4B5DA 5HEHA 5HCMA 2YMEA 4UY2A 3ZKRA 1OEDB 3T4MA 4EZ1A 3U8JA 1UV6A 3WTIA 4NPPA 2QC1B 2M6BA 4ILAA 3JAEA 4TWDA 2BG9B 2PH9A 3EHZA 2XYSA 3PMZA 4XHEA 2BYNA 5J5GA 5AFNA 3TLWA 5J5HA 3PEOA 4UXUA 2YMDA 5LG3A 4D01A 5JMEA 3JAFA 2ZJVA 5HEJA 2BYSA 2W8GA 2WNCA 2XQ5A 2Y58A 5J5IA 4LMLA 2WNLA 5FJVA 2UZ6A 5IUXA 4QAAA 5AFLA 4IL4A 3P4WA 4HFCA 4ZJSA 2Y56A 3JADA 4ILBA 5SYOA 2XQ4A 2WN9A 3SIOA 5AFMA 2WNJA 4HFEA 5CFBA 3UU6A 3U8KA 4DBMA 4AFHA 5BW2A 5TVCA 5HEOA 5AINA 1OEDE 4IREA 5HCJA 5J0ZA 5BP0A 4A98A 2XZ5A 2ZJUA 4Z90A 2XQ7A 3GUAA 5LXBA 4QH5A 3TLSA 4ILCA 4AFTA 4ZK1A 2XQ9A 3EI0A 3RQWA 1UX2A 4HFDA 4HFIA 4NZBA 3UQ4A 4BFQA 3RQUA 3IGQA 3RIAA 2XQAA 3SH1A 2XZ6A 2MAWA 5L47A 2X00D 2XNVA 2YOEA 4ZK4A 3RI5A 3UU4A 2BG9C 2BG9E 3WTHA 4COFA 2X00A 4QABA 4UM1A 4TNVA 3UQ7A 3U8NA 1OEDC 3C79A 3WTOA 4ALXA 5L4EA 3UU5A 2Y7YA 4HFBA 2LM2A 3ZDGA 1I9BA 2PGZA 3WTJA 5AFKA 2M6IA 2XNTA 4QH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUB A;  5AFM B;  4ZRU A;  3TLU A;  4UM3 S;  3LSV A;  3WIP A;  1UW6 A;  2BR8 A;  2BYP A;  2LLY A;  2XQ3 A;  4Z91 A;  5KZU A;  3WTN A;  2KSR A;  3P50 A;  2Y54 A;  5HEG A;  3RHW A;  3UU3 A;  4LMK A;  4TWH A;  4TWF A;  4F8H A;  4ZZB A;  3WTL A;  2BYR A;  3U8M A;  2XYT A;  2BR7 A;  2LKG A;  4ZR6 A;  4TNW A;  2W8F A;  5CO5 A;  3WTM A;  3TLT A;  3C84 A;  4QH4 A;  2XQ6 A;  4HFH A;  5BRX A;  3TLV A;  4QAC A;  3SQ9 A;  3U8L A;  5KE4 A;  5AFJ A;  4XK9 A;  2C9T A;  4A97 A;  2BYQ A;  2BG9 A;  4PIR A;  4BQT A;  4UM3 P;  2Y57 A;  2XQ8 A;  2YKS A;  5HEU A;  4FRR A;  4WV9 A;  4IL9 A;  4AFG A;  4ZJT A;  1OED A;  2VL0 A;  2BJ0 A;  3WTK A;  3UU8 A;  2LKH A;  3EAM A;  3ZDH A;  4X5T A;  2YN6 A;  4LMJ A;  2WZY A;  5AFH A;  3RIF A;  4UM3 A;  3SQ6 A;  2XNU A;  4HQP A;  5L4H A;  5J5F A;  4ZZC A;  4B5D A;  5HEH A;  5HCM A;  2YME A;  4UY2 A;  3ZKR A;  1OED B;  3T4M A;  4EZ1 A;  3U8J A;  1UV6 A;  3WTI A;  4NPP A;  2QC1 B;  2M6B A;  4ILA A;  3JAE A;  4TWD A;  2BG9 B;  2PH9 A;  3EHZ A;  2XYS A;  3PMZ A;  4XHE A;  2BYN A;  5J5G A;  5AFN A;  3TLW A;  5J5H A;  3PEO A;  4UXU A;  2YMD A;  5LG3 A;  4D01 A;  5JME A;  3JAF A;  2ZJV A;  5HEJ A;  2BYS A;  2W8G A;  2WNC A;  2XQ5 A;  2Y58 A;  5J5I A;  4LML A;  2WNL A;  5FJV A;  2UZ6 A;  5IUX A;  4QAA A;  5AFL A;  4IL4 A;  3P4W A;  4HFC A;  4ZJS A;  2Y56 A;  3JAD A;  4ILB A;  5SYO A;  2XQ4 A;  2WN9 A;  3SIO A;  5AFM A;  2WNJ A;  4HFE A;  5CFB A;  3UU6 A;  3U8K A;  4DBM A;  4AFH A;  5BW2 A;  5TVC A;  5HEO A;  5AIN A;  1OED E;  4IRE A;  5HCJ A;  5J0Z A;  5BP0 A;  4A98 A;  2XZ5 A;  2ZJU A;  4Z90 A;  2XQ7 A;  3GUA A;  5LXB A;  4QH5 A;  3TLS A;  4ILC A;  4AFT A;  4ZK1 A;  2XQ9 A;  3EI0 A;  3RQW A;  1UX2 A;  4HFD A;  4HFI A;  4NZB A;  3UQ4 A;  4BFQ A;  3RQU A;  3IGQ A;  3RIA A;  2XQA A;  3SH1 A;  2XZ6 A;  2MAW A;  5L47 A;  2X00 D;  2XNV A;  2YOE A;  4ZK4 A;  3RI5 A;  3UU4 A;  2BG9 C;  2BG9 E;  3WTH A;  4COF A;  2X00 A;  4QAB A;  4UM1 A;  4TNV A;  3UQ7 A;  3U8N A;  1OED C;  3C79 A;  3WTO A;  4ALX A;  5L4E A;  3UU5 A;  2Y7Y A;  4HFB A;  2LM2 A;  3ZDG A;  1I9B A;  2PGZ A;  3WTJ A;  5AFK A;  2M6I A;  2XNT A;  4QH1 A; 
#chains in the Genus database with same CATH topology
 3ZYL A;  4NUU A;  2VL8 A;  5KZU A;  4JI5 T;  3I9Y A;  3TKL B;  4I55 E;  3HA4 A;  3QK6 A;  4QAC A;  4GK0 E;  2OV9 A;  4HWH A;  3U78 A;  4C90 A;  4H63 V;  4IL9 A;  3AEG A;  4KMC A;  1I6Z A;  3ZDH A;  4LMJ A;  2NOX A;  3VKG A;  3SFD A;  3UUM A;  5JDH A;  4ILA A;  3EHZ A;  4DV5 T;  1T8B A;  3RIU C;  2K3W A;  4X62 T;  2Y58 A;  5LGT B;  5J5I A;  4LML A;  2WNL A;  4JI1 T;  1W0B A;  5SYO A;  5KX5 E;  3KV6 A;  2V7L A;  4LF7 T;  4LFA T;  4B3R T;  4AI6 A;  3A8Y C;  5JR9 A;  4GOU A;  2DCF A;  1UX2 A;  1E7P A;  5LOV E;  4ADZ A;  4DV6 T;  4ZS2 A;  1FMV A;  3KIN B;  2MAW A;  4YHH T;  1UCU A;  4TUY E;  1US7 B;  3UU4 A;  2HN2 A;  3T1Y T;  4PJN A;  5AQF B;  3WTO A;  2IIU A;  3RPU A;  3RH3 A;  4YFS A;  4YSX A;  2D9D A;  2V6X A;  2X51 A;  1NEK A;  2BKO A;  4CZZ B;  5LMU T;  1YW0 A;  1YKE B;  3SFE A;  3LFM A;  3C64 A;  4DVD A;  3RF1 A;  1L0V A;  1OWA A;  3MAC A;  2Y8D A;  1YQ3 A;  4X1Y E;  1UV6 A;  4EZH A;  5JRC A;  2IUB A;  2X0H A;  1JNR A;  3L09 A;  3HKC E;  5AQJ B;  3OKQ A;  2WNC A;  4QWN B;  3BQI A;  4QXB B;  1MND A;  5HXH A;  3V5U A;  5AFL A;  4EXT A;  3QNU A;  1T7S A;  4AKG A;  4DV4 T;  5LHG B;  1BR1 A;  3A5X A;  5ETW A;  1MMD A;  3ZJ1 A;  3E0Z A;  3CKD A;  4UVB B;  3KVB A;  3SIO A;  2W0G A;  3O4X E;  3LK4 2;  5JR9 C;  5L3D B;  2JJ9 A;  3VKH A;  3GUA A;  4IDO A;  2LSG A;  2OA5 A;  3B57 A;  4PJM A;  2BG9 C;  2Q9Q B;  3VHL A;  3QC9 A;  4U74 A;  3EDU A;  2V5C A;  2J4G A;  3X1D A;  5LNK A;  3CML A;  4EV6 A;  4ZI3 C;  1UGO A;  2BBH A;  5HEG A;  1HG5 A;  5ADX L;  5HXC A;  3PU8 A;  3SS1 A;  2XYT A;  5FY1 A;  4JI3 T;  2N9D A;  3WAK A;  2A2F X;  4OK0 A;  3CVR A;  5CA1 E;  1V9D A;  5TAO A;  4F6R C;  2B1E A;  4FRR A;  5FL1 A;  1YKH B;  3GN5 A;  2WU5 A;  4LF8 T;  4WZX A;  2VL0 A;  2W00 A;  2DWG A;  3PUA A;  2CEA A;  2CMR A;  3K8P C;  3OBV E;  2DLR A;  5JRE A;  1LKX A;  2YME A;  3ZCI A;  1VOM A;  4DBR A;  2UXD T;  2A3D A;  1I94 T;  3FZM B;  5AQO B;  4DR5 T;  5HYA A;  3CX6 B;  3UFG A;  3EDV A;  3JCF A;  2K5B B;  3Q2M A;  3UUL A;  2L3L A;  3C50 A;  1WYC A;  4PAG A;  5LGU B;  3AXJ B;  2WMO A;  3P7I A;  4XAX B;  5EK3 A;  3F2E A;  3N9Q A;  3P4W A;  2XQ4 A;  4DV0 T;  2CLY C;  2VK9 A;  5TVC A;  4I4T E;  5ABF A;  5J0Z A;  4A98 A;  2XQ7 A;  4O8S A;  5FXX A;  5H6R B;  3RQW A;  3Q9D A;  5JH7 E;  3J9X 1;  3UQ4 A;  2V7I A;  4H63 H;  2JQ9 A;  1N36 T;  3WTH A;  4H9N C;  4DR4 T;  1MMG A;  1H7C A;  3NWI A;  1WR0 A;  2H7O A;  1WCR A;  3PDY A;  4JI8 T;  2KIN B;  2E2A A;  4NIQ A;  2LLY A;  2XHE B;  4FJO A;  3WTN A;  4K0U A;  5IWA T;  5EK4 A;  2W2U A;  2V7J A;  4ZOL E;  1ZEE A;  3S4U A;  3C84 A;  2NTY A;  2BYQ A;  4ANJ A;  4CN1 A;  2VQE T;  4ZJT A;  1NAF A;  2PTF A;  3KFW X;  3KVA A;  5BR8 T;  2EHO B;  3CQG B;  4CXX A;  4UY2 A;  2BVM A;  3WTI A;  5JQG E;  3SWH A;  3OTO T;  1SA0 E;  2D0T A;  4P0B A;  4M1P A;  3CQC B;  4ZEY A;  4X1K E;  4DR7 T;  3LJC A;  2WAU A;  4HGA A;  2CLY B;  2NTX A;  4NXN T;  3AA6 B;  4O4J E;  3ZT7 A;  2XTL A;  5HEO A;  5HCJ A;  3N2K E;  3TLS A;  3FBZ A;  4AFT A;  3JC6 C;  2X9W A;  2QGS A;  3CQX C;  4U3C A;  3K3N A;  3RIA A;  4ZHQ E;  2D0U A;  4MFR A;  3RI5 A;  2W63 A;  3AE3 A;  5A1L A;  3IF8 B;  1I9B A;  3L3P A;  2M6I A;  5CA0 E;  4IDQ A;  1GQE A;  3FHN A;  3G06 A;  2W66 A;  3LBX B;  1G73 A;  3QUJ A;  2KSR A;  4YTP A;  3LK3 B;  4CI3 B;  2YU1 A;  3E08 A;  3PUR A;  4JUY A;  4HN9 A;  1FJG T;  2XQ6 A;  4MAL A;  3WAJ A;  1WYB A;  5JDN A;  5ABE A;  4PIR A;  2E9X C;  2YKS A;  3AE5 A;  1MIY A;  4KBM B;  2BJ0 A;  1KNZ A;  3EAM A;  2DNX A;  4UIG A;  2L9Q A;  4U72 A;  5J5F A;  3LG7 A;  5ABF B;  3ETU A;  3T4M A;  2ACZ A;  1FEW A;  4XHE A;  3RYC E;  5JTG A;  5LYJ E;  2ZM6 T;  3TLW A;  2XUE A;  3C98 B;  3ZLI A;  2CXF A;  3ANW B;  3W15 B;  2BYS A;  1WLX A;  2XQ5 A;  2JRK A;  4DND A;  3CIR A;  1T98 A;  5IUX A;  2WM9 A;  3VR9 A;  4PNI A;  4ZS3 A;  2BVL A;  1N34 T;  2RPA A;  2UXC T;  4QH5 A;  1ZV4 X;  2HPJ A;  2ZLY A;  3ZYK A;  2YEV C;  2XNV A;  3UTK A;  1HR0 T;  4LF6 T;  2WDQ A;  4JI6 T;  4ALX A;  4HFB A;  2PGZ A;  4EAH A;  4QH1 A;  5FXV A;  1HS7 A;  3UUB A;  2XSA A;  5AFM B;  4H9P C;  2VKJ A;  2BR8 A;  4Z91 A;  2G0U A;  3P50 A;  3P4S A;  4UF0 A;  3R6N A;  3M65 A;  1W09 A;  4PK4 A;  3C51 A;  2ACX A;  3PUY F;  1XMO T;  1HF8 A;  2R6G F;  3WTM A;  4QH4 A;  2XJ7 A;  5AQR B;  3I0O A;  5KDM C;  4U31 A;  2Y48 B;  3N9L A;  3ONX A;  2VKO A;  4AQG A;  5AFH A;  2H3R A;  3RYF E;  4P0A A;  2X68 A;  4DV3 T;  2XYS A;  4TWD A;  2SPC A;  2BG9 B;  4ZI2 C;  2MPK A;  2YMD A;  2V7K A;  3JAF A;  4GYR A;  5JME A;  1S94 A;  4H9R C;  5JDF A;  3UUN A;  4L0R A;  2CWY A;  3AE7 A;  4EZ4 A;  3PUS A;  3ZMT B;  3JAD A;  1IZN B;  1LVF A;  4XBF B;  4HFE A;  2XAQ B;  3C4Z A;  4H9Q C;  2WWU A;  4X64 T;  1N32 T;  1OED E;  5BP0 A;  2K9A A;  2ZM2 A;  4WW0 A;  1X9B A;  2UXN B;  2C5K T;  2VKD A;  3AEE A;  4DUZ T;  5AQN B;  2IDO B;  2CXD A;  5HXR A;  4NUV A;  2LE8 A;  3ZDG A;  3WTJ A;  5AFK A;  3AAE B;  3AA0 B;  1QLB A;  5HWY A;  4ZRU A;  3RRW A;  2BYP A;  2XQ3 A;  2WP9 A;  3GWH A;  1W0A A;  4DMW A;  2D2S A;  3RHW A;  4TWH A;  4TWF A;  3MKD A;  1XWM A;  4ZR6 A;  4AQF C;  2BS4 A;  2X0Y A;  2ODU A;  4P09 A;  2C9T A;  4WV9 A;  4IGU A;  3WTK A;  3UU8 A;  2RA1 A;  2QVA A;  5IHY A;  2WDV A;  3N2G E;  4J2C A;  4JI4 T;  1KNP A;  4B5D A;  2I59 A;  1YXR A;  1MMA A;  2K48 A;  1UUR A;  2WS3 A;  4DID B;  4PFO A;  1VRB A;  5FY7 A;  5HEJ A;  3ANW A;  4CI1 B;  4L9I A;  4JI0 T;  4IL4 A;  2WY2 A;  4HFC A;  1HNW T;  3ETV A;  5AFM A;  4DBM A;  4KP3 C;  2WDR A;  3UT5 E;  4UEL A;  4O4I E;  1G8X A;  1KEY A;  4WYV A;  3VRA A;  3N5L A;  4TN7 B;  5L2L A;  2BKN A;  1HFA A;  5J2U E;  4IHJ E;  2FJD A;  4H9O C;  2XZ6 A;  2I6H A;  2UU9 T;  2YOE A;  4ZK4 A;  4A5X A;  2C0S A;  4AKR B;  1MNE A;  3KV9 A;  4JI7 T;  5L4E A;  2M67 A;  4DV7 T;  5CJ5 A;  2XNT A;  2PBI A;  4WBO A;  1XDO A;  3LSV A;  2AXD S;  3ONL C;  4UR9 A;  3RKG A;  2D5U A;  3UFE A;  1HNX T;  3DP7 A;  4DR1 T;  3IA3 A;  5FYM A;  2VKH A;  4ZI7 E;  4CI2 B;  4ZZB A;  5CO5 A;  5F3J A;  2V1D B;  3C4X A;  5L3F B;  3U8L A;  5DQV A;  5HEU A;  3BK9 A;  3AEC A;  3B13 A;  5L3B B;  2QRX A;  5EK2 A;  4OX9 T;  3FBL A;  4GKJ T;  3AEA A;  2XNU A;  4IDN A;  3ZMS B;  3ESL A;  4GIW A;  4HFV A;  3HL6 A;  2CE7 A;  1XNR T;  1XMQ T;  3OJA A;  4EB6 E;  2CBJ A;  3AE6 A;  1U5P A;  4UXU A;  2E9X D;  5LG3 A;  4D01 A;  2ZJV A;  5FXZ A;  3MJX A;  3OYX A;  4DR2 T;  3FZK B;  3I1A A;  3VRB A;  2W62 A;  2VUR A;  4CXW A;  1UX5 A;  4YTM A;  4EOZ B;  2MYS A;  3FZF B;  2YK0 A;  2OLT A;  2XQ9 A;  3QB5 K;  3IBP A;  2HN1 A;  4HFD A;  3RQU A;  1WRD A;  4I43 B;  4MHC A;  2L8K A;  3I9W A;  1ZHC A;  3RYI E;  2JQQ A;  3JC6 D;  3AVS A;  3U8N A;  3O1H A;  3C79 A;  2LM2 A;  1M7K A;  3L39 A;  3TLU A;  1QUU A;  1UW6 A;  2C5I T;  4B6X A;  3QB5 A;  4UVA B;  5ABH A;  3NZQ A;  5LA6 E;  2X0L B;  2BR7 A;  2BZB A;  5L3G B;  3K3Q C;  1WR6 A;  4O2A E;  3GMI A;  4AIS A;  3P4Q A;  3RX6 A;  1BR2 A;  2BG9 A;  2MTQ A;  2FUP A;  5AQG B;  4YTN A;  1XDP A;  2MOZ A;  2XQ8 A;  3KDS E;  3ABV A;  3KBT A;  2VQF T;  3HKB E;  3U8J A;  3ZYM A;  2K24 A;  2QC1 B;  4X66 T;  3BQL A;  5AFN A;  2UXB T;  3PEO A;  3T1H T;  5FKY A;  4JEU B;  4E7Z A;  4AXP A;  3I0Q A;  2JQH A;  2W67 A;  4LF5 T;  4UF0 B;  3N9P A;  3KV4 A;  2IAK A;  5FNV E;  5JDL A;  1YD8 G;  4IRE A;  5FL0 A;  3ONJ A;  4U7I A;  5LXB A;  3H3A A;  2E5L T;  2DWK A;  1AJ3 A;  2N1G A;  2NP9 A;  4TZ4 C;  3MZK B;  4EEB A;  3CPZ A;  5ABG A;  4ILU A;  1R8I A;  3AE8 A;  4X20 E;  4MBQ A;  2W61 A;  1BR0 A;  1MMN A;  5E0O A;  5C8Y E;  2UUC T;  5DAB A;  2XSB A;  5LJN A;  4AIU A;  5JDM A;  1IJ5 A;  3AE9 A;  2JPF A;  2QYW A;  2KLQ A;  3AED A;  4IE4 A;  2Y6X A;  3K1S A;  3U8M A;  2LKG A;  3AVR A;  3FZL B;  3TLT A;  2XY8 B;  1CHU A;  2J62 A;  4YSZ A;  4JYA T;  2LEH A;  4BQT A;  2WZH A;  5JRC B;  3E22 E;  5LP6 E;  3QOF A;  1E2A A;  1HTJ F;  3ZN1 B;  3K3O A;  4ERR A;  1FMW A;  3U3I A;  5L3C B;  2M6B A;  1X79 A;  5J5H A;  2V8S V;  5AQI B;  2KWH A;  3RRC A;  3CK6 A;  2W8G A;  3D0T A;  4EYY R;  4YJ3 E;  4PW8 A;  5KXJ A;  2KXP B;  1E1H B;  4K0K T;  2WN9 A;  4HTE A;  1ZKE A;  4B3M T;  3U8K A;  4AFH A;  5BW2 A;  1D0Y A;  1U4Q A;  2XZ5 A;  4Z90 A;  4CN6 A;  2WMN A;  3ZT5 A;  1ZOY A;  1IBL T;  4HFI A;  4AQF A;  4BFQ A;  3FZH B;  4UVC B;  2XQA A;  3ZT6 A;  2X00 D;  3PTR B;  5AQQ B;  4DMV A;  5FVK A;  2X00 A;  4PJL A;  2A9U A;  4BJN A;  4I50 E;  4Q25 A;  2Y7Y A;  1T72 A;  4GK5 E;  2E5V A;  2I0M A;  3PJA A;  3EAB A;  1Y64 B;  3T8O A;  3PUZ F;  3WTL A;  2V6Y A;  3BQK A;  2LHN A;  3AA1 B;  4IE7 A;  2BKP A;  5AQK B;  2XZE A;  2PG8 A;  3CX7 B;  5BRX A;  5AFJ A;  1N33 T;  3O1J A;  4A97 A;  3FXD B;  3LK2 B;  5GON E;  3PUV F;  2IC6 A;  5JDQ A;  2BS3 A;  3J7Y q;  5L3E B;  3RIF A;  4UM3 A;  3SQ6 A;  5L4H A;  4LF9 T;  4WBN E;  2P9B A;  2X9Y A;  1OED B;  3ZEF B;  3L8R A;  2VWA A;  5J5G A;  5FXW A;  3CX8 B;  4V1A v;  1OXZ A;  2A72 A;  2YDR A;  4KX6 A;  4CN4 A;  3AE1 A;  2AE9 A;  1IBK T;  2JIW A;  1IBM T;  1D0Z A;  4ZJS A;  4YJ2 E;  4JI2 T;  3AAI A;  3LBX A;  3FXE B;  2WNJ A;  3RYH E;  5CFB A;  1UUS A;  1XZY A;  2YDQ A;  2N2N A;  3NRY A;  2UXX B;  4ILC A;  1HCI A;  5AQM B;  5AQU B;  5C3J A;  2VVS A;  2QA7 A;  2YIN A;  3HKD E;  4KI0 F;  3RC8 A;  4OYK A;  3N2O A;  1D0X A;  1KNR A;  3ZST A;  1O3X A;  3AA7 B;  1YQ4 A;  4HKA A;  2BG9 E;  5LCY A;  4COF A;  4TNV A;  3UU5 A;  5FVL A;  4QX7 B;  4O2B E;  3ZMV B;  4KHP T;  2XM1 A;  5F5W A;  3DJB A;  2JMH A;  1XNQ T;  3UU3 A;  4CQI A;  4LMK A;  2RP4 A;  3PUQ A;  3SRZ A;  4XK9 A;  1VCT A;  5LB7 B;  5LBM A;  4UM3 P;  2CBI A;  2WZI A;  4IDP A;  2UUA T;  1EZ3 A;  2LKH A;  2JQK A;  5LBQ B;  5AQH B;  3NKZ A;  2ZM0 A;  3NVO A;  5M4Y A;  3EVY A;  5HEH A;  4HE8 A;  4NXM T;  3AE2 A;  4Z8X A;  2LT3 A;  5FP3 A;  2PH9 A;  2XPK A;  2BYN A;  4JLE A;  2DL1 A;  4H9S E;  2WSS V;  4QXC B;  2FJA A;  2V6Y B;  4ZI3 D;  2BBJ A;  4YLH A;  3ZMU B;  5JVD E;  2BS2 A;  4IE5 A;  4AKI A;  2J47 A;  5JDG A;  3ZMZ B;  4A56 A;  2LOP A;  5AQV B;  3VR8 A;  5HAX A;  2PJQ A;  3UU6 A;  2WB5 A;  3ZC0 A;  3LDQ B;  4YT0 A;  3PV0 F;  5C2T A;  1D1B A;  2CPT A;  2ZJU A;  1D1C A;  4AKH A;  3WI3 A;  3IGQ A;  1SE7 A;  4KUM B;  3ZN0 B;  2XAG B;  2DI4 A;  2Z6E A;  5BMV E;  4GYS A;  3UQ7 A;  3M3Z B;  4XZC A;  2MBG A;  2X9H A;  5HWX A;  2E9X B;  3WIP A;  2BDE A;  3H3M A;  2X67 A;  4HWC A;  2JMK A;  4EYU A;  5AFU L;  4F8H A;  3IEE A;  2ODV A;  3UUX B;  5LHI B;  2CCQ A;  2KT9 A;  1NWM X;  4L5G A;  1KFY A;  3RKO A;  1NEN A;  4TX5 A;  4AFG A;  5LMN T;  4X5T A;  3NBX X;  4G2A A;  5LXT E;  4HQP A;  4BAY B;  2WBL A;  3AEF A;  5CGM A;  1ZP0 A;  4TV9 E;  3OYZ A;  1Z8U A;  3JAE A;  4ZXL A;  3EUH A;  4PK6 A;  3AB3 B;  3KV5 A;  2XAF B;  3ZPO A;  2E8I A;  2V7M A;  4DUY T;  3NRX A;  4ILB A;  4X65 T;  4U7Y A;  3F31 A;  3FB2 A;  2H7V C;  4P1N A;  1B7T A;  1LVK A;  3PU3 A;  4UV9 B;  1MIV A;  3AXJ A;  3Q5D A;  2WQY A;  2KWI B;  4KHZ F;  1SHZ C;  3EI0 A;  4NZB A;  1MIW A;  3SH1 A;  2FJB A;  2VAS A;  5LHH B;  4G63 A;  4QAB A;  5AQT B;  4UEM A;  3HKE E;  4ASK A;  1IAP A;  2LJL A;  2HH7 A;  4DR6 T;  4AQY T;  4OFZ A;  4UV8 B;  1Y01 A;  2YDS A;  5FY0 A;  2CHO A;  2Y54 A;  3O9X A;  4EIW A;  4YXD A;  3OPC A;  2BYR A;  4BJM A;  5EZY E;  4TNW A;  1CUN A;  2NW7 A;  4HFH A;  2XM2 A;  5J2T E;  5AQL B;  2J1D G;  2CWO A;  1OED A;  5DQW A;  2HHH T;  2NWB A;  2YN6 A;  2WZY A;  4E7S A;  4YY3 T;  1FIO A;  1UX4 A;  1IJ6 A;  2IML A;  2VVN A;  2Q9Q D;  3A7M A;  1SUM B;  3ZCJ A;  2IC9 A;  4NPP A;  1W9R A;  4DO0 A;  2LOS A;  3AE4 A;  5LG4 A;  3PMZ A;  4JBW F;  3PJA J;  3IHR A;  4IDZ A;  2HPL A;  4C91 A;  3ZSS A;  3ZC1 A;  5AQP B;  3RLF F;  5HXE A;  1HX8 A;  1S35 A;  1KK7 A;  3HI2 A;  3OVU A;  5CB4 E;  5DJQ C;  1HX1 B;  2XQY A;  2F4V T;  3AEB A;  2LRL A;  3PUW F;  1J5E T;  3C4W A;  2FJE A;  3N9M A;  1JNZ A;  4ZK1 A;  3ZJ2 A;  5J1G A;  4EED A;  2XAJ B;  3F57 A;  4UXN B;  2X9X A;  4IE6 A;  2GK9 A;  4HWD A;  3P4P A;  4PFP A;  4LF4 T;  2H89 A;  2W4X A;  4UM1 A;  1OED C;  4YSY A;  2EHO C;  4AKL A;  2WCA A;  4UM3 S;  3P8C D;  4QXH B;  4DV1 T;  5F8P A;  2NW9 A;  1D1A A;  5LJM A;  1UK5 A;  4O4L E;  2CRB A;  2IHR 1;  3V5S A;  1BR4 A;  2LHR A;  5KE4 A;  1Z0P A;  2DHR A;  5FMN A;  2CM0 A;  2Y57 A;  4DR3 T;  1HNZ T;  2NW8 A;  2ZM8 A;  4IIJ E;  4JV5 T;  4HEA A;  5JR9 B;  2LSJ A;  2Q9Q C;  4ZZC A;  1LRZ A;  4ZI2 D;  3H37 A;  3SOL A;  1M62 A;  4U33 A;  4EZ1 A;  3MXZ A;  4YHJ A;  4LFC T;  2LRK A;  4MLK A;  4N78 D;  4U2Z A;  2KZ7 B;  4FI5 A;  3PUX F;  4DV2 T;  3R84 B;  1WFD A;  4B3S T;  2PFV A;  2C5J A;  2EHO D;  2E9X A;  2LSK A;  3MA9 A;  3Q5X A;  2EHO A;  5AIN A;  2V5D A;  5AQS B;  4DBQ A;  4TV8 E;  2YU2 A;  3N9N A;  1DU2 A;  3O1I A;  4QKN A;  2CXL A;  3N9O A;  5L47 A;  4IT4 A;  2VB6 A;  4GKK T;  1J1J A;  5IYZ E;  3RC3 A;  2ES0 A;  1J5W A;  2WWV A;  3AAA B;  3VU7 H;  3P4R A;  2XAH B;  4HWI B;  1HG2 A;  3Q5W A;  2IW5 B;  4CXY A;  3NZP A;  2NR4 A;  3DTO A;  3GA8 A;  4OHF A;  2W8F A;  3TLV A;  4OYJ A;  3SQ9 A;  4PJJ A;  2LSI A;  3KBU A;  2KMF A;  4B3T T;  2LSY A;  2CHN A;  4QX8 B;  2B76 A;  5HCM A;  5HXS A;  2UUB T;  4I0U A;  5H6Q B;  3ZKR A;  2FBW A;  4LFB T;  3MK7 C;  3HR0 A;  2WU2 A;  3PE0 A;  2LM9 A;  3PUG A;  5KMG P;  4EGW A;  1VCS A;  3CWZ B;  4PK5 A;  2KND A;  5FJV A;  2UZ6 A;  4QAA A;  2H88 A;  2V26 A;  4O4H E;  4X1I E;  2Y56 A;  4IST A;  1KF6 A;  4JEH B;  4WNK A;  4HWF A;  5LGN B;  4IE0 A;  2X66 A;  1QSD A;  4ISS A;  2Q9Q A;  3GN5 B;  2XAS B;  3B5M A;  3RGL A;  2ZMA A;  4BA9 A;  4QHO A;  3RIU A;  3Q5E A;  2CA5 A;  4U2Y A; 
#chains in the Genus database with same CATH homology
 3UUB A;  5AFM B;  4ZRU A;  3TLU A;  4UM3 S;  3LSV A;  3WIP A;  1UW6 A;  2BR8 A;  2BYP A;  2LLY A;  2XQ3 A;  4Z91 A;  5KZU A;  3WTN A;  2KSR A;  3P50 A;  2Y54 A;  5HEG A;  3RHW A;  3UU3 A;  4LMK A;  4TWH A;  4TWF A;  4F8H A;  4ZZB A;  3WTL A;  2BYR A;  3U8M A;  2XYT A;  2BR7 A;  2LKG A;  4ZR6 A;  4TNW A;  2W8F A;  5CO5 A;  3WTM A;  3TLT A;  3C84 A;  4QH4 A;  2XQ6 A;  4HFH A;  5BRX A;  3TLV A;  4QAC A;  3SQ9 A;  3U8L A;  5KE4 A;  5AFJ A;  4XK9 A;  2C9T A;  4A97 A;  2BYQ A;  2BG9 A;  4PIR A;  4BQT A;  4UM3 P;  2Y57 A;  2XQ8 A;  2YKS A;  5HEU A;  4FRR A;  4WV9 A;  4IL9 A;  4AFG A;  4ZJT A;  1OED A;  2VL0 A;  2BJ0 A;  3WTK A;  3UU8 A;  2LKH A;  3EAM A;  3ZDH A;  4X5T A;  2YN6 A;  4LMJ A;  2WZY A;  5AFH A;  3RIF A;  4UM3 A;  3SQ6 A;  2XNU A;  4HQP A;  5L4H A;  5J5F A;  4ZZC A;  4B5D A;  5HEH A;  5HCM A;  2YME A;  4UY2 A;  3ZKR A;  1OED B;  3T4M A;  4EZ1 A;  3U8J A;  1UV6 A;  3WTI A;  4NPP A;  2QC1 B;  2M6B A;  4ILA A;  3JAE A;  4TWD A;  2BG9 B;  2PH9 A;  3EHZ A;  2XYS A;  3PMZ A;  4XHE A;  2BYN A;  5J5G A;  5AFN A;  3TLW A;  5J5H A;  3PEO A;  4UXU A;  2YMD A;  5LG3 A;  4D01 A;  5JME A;  3JAF A;  2ZJV A;  5HEJ A;  2BYS A;  2W8G A;  2WNC A;  2XQ5 A;  2Y58 A;  5J5I A;  4LML A;  2WNL A;  5FJV A;  2UZ6 A;  5IUX A;  4QAA A;  5AFL A;  4IL4 A;  3P4W A;  4HFC A;  4ZJS A;  2Y56 A;  3JAD A;  4ILB A;  5SYO A;  2XQ4 A;  2WN9 A;  3SIO A;  5AFM A;  2WNJ A;  4HFE A;  5CFB A;  3UU6 A;  3U8K A;  4DBM A;  4AFH A;  5BW2 A;  5TVC A;  5HEO A;  5AIN A;  1OED E;  4IRE A;  5HCJ A;  5J0Z A;  5BP0 A;  4A98 A;  2XZ5 A;  2ZJU A;  4Z90 A;  2XQ7 A;  3GUA A;  5LXB A;  4QH5 A;  3TLS A;  4ILC A;  4AFT A;  4ZK1 A;  2XQ9 A;  3EI0 A;  3RQW A;  1UX2 A;  4HFD A;  4HFI A;  4NZB A;  3UQ4 A;  4BFQ A;  3RQU A;  3IGQ A;  3RIA A;  2XQA A;  3SH1 A;  2XZ6 A;  2MAW A;  5L47 A;  2X00 D;  2XNV A;  2YOE A;  4ZK4 A;  3RI5 A;  3UU4 A;  2BG9 C;  2BG9 E;  3WTH A;  4COF A;  2X00 A;  4QAB A;  4UM1 A;  4TNV A;  3UQ7 A;  3U8N A;  1OED C;  3C79 A;  3WTO A;  4ALX A;  5L4E A;  3UU5 A;  2Y7Y A;  4HFB A;  2LM2 A;  3ZDG A;  1I9B A;  2PGZ A;  3WTJ A;  5AFK A;  2M6I A;  2XNT A;  4QH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...