3EAMA

An open-pore structure of a bacterial pentameric ligand-gated ion channel
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title X-ray structure of a pentameric ligand-gated ion channel in an apparently open conformation.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3eamA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3eamA01
3RQUA 2BJ0A 2Y54A 4QACA 5AFNA 2YMEA 5BP0A 2LLYA 5L47A 5AFHA 2XQ7A 4B5DA 2XNTA 2W8GA 2XNVA 5IUXA 4HFEA 4ZZCA 3SH1A 2X00D 1UV6A 4UM3A 2PH9A 4QH5A 3WTKA 4ALXA 5JMEA 5J0ZA 3UU6A 4COFA 3RIAA 2W8FA 2LKGA 3P50A 3TLUA 4BQTA 4IL4A 4HFDA 1UX2A 2Y7YA 2LKHA 4TWHA 3P4WA 3UQ7A 4QAAA 3LSVA 4DBMA 5BW2A 5AFKA 2XQAA 3GUAA 4NZBA 1OEDE 2BYPA 2YMDA 2BYRA 4AFTA 5LXBA 5FJVA 5HEJA 2WNCA 2XYTA 4HFIA 5HCJA 4UM3P 5J5GA 3WTJA 5KZUA 3ZKRA 3WTMA 3IGQA 2BG9A 2M6BA 3EHZA 4HFBA 4AFHA 5L4EA 3PMZA 2XZ6A 2XQ4A 4A97A 4WV9A 4ILAA 2XQ3A 2LM2A 5HEHA 2XQ6A 2Y58A 3WTNA 2Y56A 3RI5A 4QH4A 3UU5A 3UUBA 2X00A 3C84A 3UU4A 4LMLA 3WTOA 3JAFA 4HFHA 4HQPA 2ZJVA 5J5HA 2XQ5A 2QC1B 4ZK4A 4IREA 3U8LA 5AFMA 3SIOA 4ZZBA 5AINA 2BYQA 2MAWA 2C9TA 4TWDA 3WTLA 2YOEA 2YKSA 5AFJA 2XQ8A 3UQ4A 5J5FA 4XHEA 3ZDGA 3JAEA 2WNLA 4HFCA 2Y57A 3WTIA 2WN9A 4AFGA 4ZJTA 5CFBA 1UW6A 2BG9E 4ILCA 3SQ9A 3T4MA 5HEGA 4ZR6A 1OEDB 4Z91A 4Z90A 1OEDA 2VL0A 4ZRUA 2XQ9A 5LG3A 3U8JA 2WNJA 4A98A 2XZ5A 3U8KA 4EZ1A 3UU3A 5HCMA 5BRXA 5J5IA 4NPPA 3RHWA 2XNUA 3U8MA 1I9BA 3PEOA 4TNVA 2BYSA 4D01A 2BYNA 4XK9A 4F8HA 4X5TA 3C79A 4UM3S 5SYOA 4QH1A 3SQ6A 2ZJUA 4LMKA 4ZJSA 3EAMA 4UXUA 2XYSA 3RQWA 2WZYA 2PGZA 1OEDC 4BFQA 3JADA 4TWFA 4ILBA 3WTHA 3TLSA 3EI0A 3UU8A 5AFMB 5HEUA 4IL9A 3TLVA 4TNWA 4FRRA 4UY2A 2BG9C 5L4HA 2BR7A 3U8NA 5CO5A 2YN6A 3WIPA 2BG9B 4LMJA 5AFLA 2M6IA 3ZDHA 5TVCA 3TLWA 2KSRA 3TLTA 5KE4A 4PIRA 4QABA 5HEOA 2BR8A 4UM1A 3RIFA 2UZ6A 4ZK1A
chains in the Genus database with same CATH superfamily
3QOFA 4YXDA 1AJ3A 4U7IA 1UV6A 4GIWA 4O2AE 5DQVA 3RLFF 4TWHA 2QA7A 2ZM8A 4DV1T 4GKKT 1NWMX 4ZS3A 3AAIA 2H7OA 2L8KA 3IGQA 3ONXA 1R8IA 4E7ZA 3E0ZA 4NUVA 3NZPA 3ZMUB 3PUZF 2X0HA 3LFMA 3JAFA 2CCQA 3FB2A 5J5HA 1D1AA 3T1YT 4O4HE 5LGUB 4TWDA 2W2UA 4A56A 3MJXA 1WYBA 4DR1T 2CPTA 2MBGA 3CK6A 3U3IA 3FZLB 3CX6B 2UXBT 4WW0A 2UUAT 3OYZA 3N2KE 3C4XA 4QH1A 3ZSSA 4ZJSA 2K24A 2YK0A 5JDMA 3N2OA 4I4TE 2K48A 4CN1A 3NVOA 3JC6D 3I1AA 5JDGA 5L4HA 2KINB 4OK0A 2DI4A 4HFVA 5CO5A 2UXNB 1XDPA 4QX7B 5FP3A 3ZDHA 3PUQA 3TLTA 2CLYC 5JRCA 5EZYE 5LXTE 4IGUA 2XM2A 2X9WA 2BJ0A 2LLYA 5LGNB 3LK42 5LHIB 4LFCT 2NW9A 3B13A 4OHFA 4IT4A 5AQLB 5DQWA 2L9QA 3L39A 4V1Av 2DWGA 1M62A 3L8RA 1BR0A 2V26A 2XQAA 3RH3A 2ACXA 2BYRA 3OJAA 4NIQA 5EK2A 2F4VT 1HX1B 4HWDA 3CVRA 2CXLA 4QH4A 3UUBA 4IE5A 4U74A 3OVUA 5AFMA 3SIOA 3Q5XA 5J5FA 4KBMB 1HTJF 4XHEA 2WN9A 1J5WA 3QK6A 3QNUA 2XPKA 3AEFA 2V7IA 1WRDA 2V5DA 4XAXB 3O1IA 4H9QC 3VR8A 2E9XB 3PU8A 2RPAA 4MALA 2J62A 3PUXF 4PNIA 4BJNA 3M65A 3WIPA 4MLKA 5KDMC 4C91A 4I50E 4FI5A 4DMWA 2Y54A 4KMCA 3PE0A 3PTRB 3WAJA 2XNVA 3RPUA 2V6YA 2PH9A 4DV4T 4QH5A 3FZKB 3RIAA 4GYSA 1H7CA 4IL4A 3ZMSB 4CN4A 2Y7YA 3P4WA 3C64A 5FVLA 1ZKEA 3KDSE 3MKDA 2A2FX 2V8SV 2LE8A 3RYHE 1LVFA 5FJVA 4PJMA 5CB4E 4DVDA 1W0BA 3QB5K 5AQJB 3PMZA 1HFAA 4A97A 3P4SA 3AE9A 1WCRA 2NR4A 3NWIA 1XDOA 3F31A 3RIUA 2WB5A 1MNDA 4DMVA 1ZEEA 3AA7B 2KXPB 3ZMZB 4ZJTA 4ILCA 2MOZA 2SPCA 2DCFA 1OEDB 2D0TA 4HKAA 2X9YA 3K8PC 4CI1B 2WQYA 2JQQA 3LJCA 5FKYA 4TNVA 2DLRA 4XK9A 4DUZT 4H63H 4AISA 5LYJE 2PJQA 2X9XA 3WTHA 3EI0A 3UU8A 5AQSB 2EHOC 2ODVA 2JMKA 2BG9C 3AXJB 3CPZA 2X66A 2I59A 3RQUA 3UTKA 4IE6A 5AFNA 1N33T 4B3ST 3FZMB 4WZXA 2OLTA 4HFEA 4ZZCA 5FY1A 2LKGA 5FY0A 5JR9A 1G8XA 3ESLA 4L9IA 1Y64B 3NZQA 3AE5A 5ABEA 3J7Yq 3VU7H 2X68A 4IDZA 2WM9A 1HCIA 3N9PA 1U4QA 4L0RA 4UM3P 5FL0A 1WR6A 3EUHA 4AXPA 2N2NA 1NENA 1E7PA 2W61A 2Q9QA 1SUMB 2E5VA 2IAKA 4YY3T 2H3RA 2PG8A 2WP9A 3QC9A 3NRXA 4IREA 3N9OA 5AQOB 1T7SA 2B1EA 4N78D 4XZCA 3UQ4A 4PK5A 4HFCA 1D0XA 2XQ9A 3ZN1B 3HKCE 2LJLA 4H9PC 2ZJUA 2ZMAA 4H9NC 1MNEA 4GK5E 2KNDA 2ZM2A 4EYYR 4LF9T 3TKLB 1LVKA 2W66A 3ZJ2A 3A8YC 4DV2T 3DP7A 2PBIA 4LMJA 2PFVA 3FBZA 2IC6A 3RIFA 2XHEB 4PK6A 4YT0A 2CMRA 1LKXA 2WWVA 3K3QC 5IUXA 2CBJA 3HI2A 5F3JA 2IC9A 5E0OA 2W8FA 4JEHB 1WFDA 1UK5A 1MIWA 4TV8E 3AA6B 4H9SE 2E5LT 2VL8A 1W9RA 4MBQA 2Z6EA 4LFAT 3ZMVB 4DIDB 2X9HA 2CBIA 5HCJA 5J5GA 4ANJA 5LHHB 3NKZA 4WYVA 3RF1A 4X64T 2LM2A 5ABFB 2FJAA 2Y56A 3RI5A 3C84A 2CXDA 2FJEA 3UU4A 1VCTA 4EEBA 2VVNA 3PUWF 4H9RC 2UXDT 2FBWA 3W15B 4IE7A 5JDFA 4AQYT 2W00A 5ABGA 3PUGA 1HG5A 2A3DA 4LF8T 3U8KA 3C51A 2H7VC 2WBLA 4YSXA 3UULA 3KVAA 2IIUA 4JYAT 4UM3S 3M3ZB 3ZN0B 2CLYB 3LG7A 3HKBE 4K0KT 4UXUA 2WZYA 3IEEA 4UELA 3O4XE 4TV9E 4FJOA 5AQKB 5LP6E 5EK3A 1VRBA 5BMVE 4KHPT 2AXDS 4UY2A 5FVKA 4ASKA 1YXRA 5LOVE 1V9DA 2PTFA 2H88A 2KSRA 2BS4A 5FNVE 1HNXT 4DR5T 4EZ4A 4O4IE 4YJ2E 2E8IA 5IYZE 4ZHQE 3ANWA 4CXWA 2D5UA 2VQET 2E9XA 5LMNT 5J2TE 3CQCB 2BS3A 1YKHB 4QAAA 4PK4A 3GUAA 2G0UA 4WNKA 2VB6A 2XTLA 3PUYF 2Q9QD 2ODUA 4HFBA 4AFHA 2JQKA 4YLHA 3AE8A 5LA6E 2XZ6A 4WV9A 1KF6A 2FJBA 2X0YA 4UF0B 1I6ZA 4TN7B 2CEAA 4HE8A 3KBUA 2ZJVA 3AA1B 1B7TA 2JQHA 2XAHB 2XAGB 4PW8A 4YSZA 2MAWA 2WNLA 2CHNA 3T4MA 2WMOA 1E2AA 2HH7A 1U5PA 2W63A 3VHLA 5JH7E 3H37A 3IHRA 1S35A 3RKOA 4B3RT 4O2BE 5AQRB 3S4UA 2V1DB 2I6HA 5LHGB 4ZI3D 2BR7A 4JUYA 2ZM0A 3DJBA 2L3LA 4LF6T 2VASA 2YN6A 2FUPA 3TLWA 2ACZA 1OEDA 1WLXA 4K0UA 2BKNA 3RIUC 3CQGB 2XQ7A 4UVCB 2XNTA 5LGTB 3L09A 4JI7T 4BQTA 3KV4A 3SFEA 4DV3T 5BW2A 3AEAA 3B57A 1FMVA 2QVAA 3ZPOA 1HNZT 5FXXA 4A5XA 4IE0A 3GA8A 2XYTA 1QUUA 2JJ9A 3AXJA 1T72A 3ETUA 3ZKRA 3L3PA 4IDOA 5L3CB 4X1KE 1KNPA 2K9AA 4M1PA 1ZHCA 4IE4A 4HQPA 1YQ4A 4ZK4A 4OYKA 3AECA 5AQNB 2YKSA 5AFJA 4IDNA 2A72A 5CFBA 1IJ5A 5LG3A 4ZI2C 2EHOB 4EZHA 5FXWA 1XNRT 1L0VA 4DR6T 5JR9C 3MXZA 3P4PA 5JVDE 1MMNA 5FXZA 1GQEA 3AVRA 4JI0T 4JI4T 1T8BA 3RC3A 4G63A 1UX4A 3OTOT 3EVYA 2DHRA 4BAYB 1YD8G 4U33A 2WU2A 5KMGP 2Q9QC 2LSJA 5AQQB 5KE4A 2UZ6A 3T8OA 4KX6A 5HWXA 2MPKA 1SA0E 4QACA 5JDLA 5BP0A 3F57A 2D0UA 4DNDA 5HYAA 2WZIA 2E9XD 5JMEA 3C4ZA 4AQFC 4NUUA 3TLUA 1UX2A 4HFDA 3AEBA 2LKHA 4KHZF 2BZBA 4JBWF 5AFKA 2KT9A 4LF5T 5AQGB 4JEUB 2XAJB 1FJGT 3ZC1A 1S94A 4DR3T 3ONJA 1G73A 1KEYA 3CIRA 2XQ6A 1XMOT 4WBOA 2IW5B 2VWAA 3FXEB 4I43B 3VRAA 4IDPA 3WTLA 3O1JA 5C8YE 3ZDGA 2MYSA 3BQIA 3Q2MA 5EK4A 3U8JA 5L3FB 1MMAA 4U7YA 3F2EA 3JC6C 4YTMA 3MK7C 1I9BA 3U8MA 3E22E 4EXTA 4I0UA 5ABFA 2XZEA 1XMQT 3LDQB 4EAHA 4X1YE 2PGZA 2J47A 3AAEB 3H3MA 3UT5E 4QXBB 3BQLA 3K3NA 2AE9A 2Y8DA 2YU2A 4IIJE 4E7SA 4JV5T 3LK2B 3EDUA 3SH1A 2X00D 5IWAT 3O9XA 3HL6A 4ZEYA 2LSGA 2X0LB 3N9QA 2C5JA 3A5XA 3MZKB 3ZCJA 1Z8UA 2QYWA 2LHNA 5L3EB 2WMNA 3Q9DA 2IUBA 5JRCB 4ERRA 3RYFE 5AQPB 2NTXA 2WAUA 2XAFB 3UU5A 4LMLA 4JI1T 2CE7A 5JDQA 2QC1B 2JPFA 3OKQA 5DABA 5AQMB 3AEDA 4MFRA 3NBXX 3JAEA 5FL1A 4DBRA 1UW6A 2BG9E 4ZR6A 3ABVA 1EZ3A 3H3AA 2JIWA 2BKPA 2E9XC 3RHWA 2XNUA 3QUJA 3K1SA 2KMFA 2V7LA 3IA3A 4HGAA 3AB3B 1N32T 3KV6A 2Y6XA 5CGMA 5AFMB 3I0OA 2YDQA 4AKGA 2C5KT 2I0MA 2CWYA 4O4LE 1FEWA 4QXCB 5HXCA 4BA9A 4P1NA 4DV0T 2KWHA 4CN6A 2X67A 2D2SA 5AFHA 4B5DA 1ZOYA 5KX5E 5J0ZA 4JI5T 3GN5B 3LSVA 2BBJA 4YJ3E 5J1GA 5LNKA 2X51A 4DR7T 4JI3T 2LOPA 1IAPA 4AKHA 4GOUA 4DUYT 3UUMA 5L4EA 4OX9T 4ILAA 3ZC0A 3UFEA 3FZHB 4YHJA 2J1DG 2UUBT 1BR4A 1T98A 2WU5A 1HNWT 4DV5T 3AEGA 1MMDA 5C2TA 5F8PA 3VKGA 3ZSTA 2IHR1 4HEAA 4UIGA 2A9UA 5HXRA 4CI2B 2VL0A 4EZ1A 5L3BB 4HN9A 5BRXA 4NPPA 2K5BB 4D01A 4F8HA 4X5TA 5H6RB 2VURA 3B5MA 3ZCIA 4UEMA 3SWHA 4EGWA 4AKIA 1J1JA 3JADA 2WDVA 3KV5A 1ZV4X 2XSAA 3G06A 4TNWA 3ZMTB 2LM9A 4EEDA 3U8NA 4WBNE 2CA5A 5H6QB 3DTOA 2EHOA 2C5IT 2VKJA 3WI3A 3ZYKA 3N9NA 1HG2A 3PUSA 1N34T 4U2ZA 3ZT6A 4F6RC 2OA5A 4DR4T 5ETWA 1US7B 3N5LA 2BKOA 2DL1A 5AQVB 2VVSA 4OYJA 1QLBA 2CXFA 4PAGA 1D1BA 4YTPA 2WNCA 4HFIA 3WTJA 1MIVA 5F5WA 4YHHT 5LCYA 5JREA 4QWNB 2Y58A 2LEHA 2V5CA 4KUMB 1IBLT 4DO0A 5JR9B 1D1CA 4ZZBA 2XJ7A 3IBPA 4PJNA 2YOEA 3VR9A 4AI6A 1IBKT 2DNXA 2Y57A 3WTIA 3IF8B 2LRLA 1NEKA 3AE4A 2BBHA 2V7JA 2M67A 1O3XA 4BJMA 2HN2A 3ONLC 2XZ5A 3ZEFB 4X20E 1OWAA 2XM1A 5JDNA 5LJNA 4CZZB 2IMLA 1D0ZA 3HA4A 1IJ6A 1YQ3A 2CHOA 1D0YA 2KWIB 3TLSA 4IL9A 2WY2A 4EB6E 5AQFB 3C98B 5LBQB 5HAXA 5BR8T 2BR8A 2C0SA 2N1GA 4AQGA 2RA1A 2LRKA 3P4RA 4DBQA 1MMGA 2W8GA 2HN1A 1LRZA 4MHCA 2FJDA 4ALXA 2H89A 4UR9A 3OPCA 3N9MA 3ETVA 4UVBB 5AQUB 1YKEB 3P7IA 3UQ7A 5C3JA 4YTNA 3KINB 5LJMA 5HXEA 1BR1A 2YDRA 4X1IE 1YW0A 1E1HB 3LBXB 4P09A 3SS1A 4GYRA 3D0TA 3FHNA 4ZI7E 2ZLYA 3WTNA 2W62A 2YU1A 2X00A 2BDEA 3WTOA 4HFHA 3Q5DA 3RGLA 2W0GA 3AE3A 2V7KA 2JMHA 2BYQA 5L2LA 5AQTB 2XQ8A 3BK9A 1UURA 2QGSA 4ILUA 5FXVA 3SQ9A 2WDQA 1ZP0A 5LG4A 4HWHA 3ZJ1A 4IHJE 2VKOA 3AE7A 5TAOA 3R84B 4UV9B 4Q25A 2ZM6T 3AE1A 2NTYA 4EOZB 1HR0T 3EAMA 3MACA 2R6GF 2P9BA 3VKHA 4YSYA 5LMUT 1W0AA 3C50A 2WS3A 5CJ5A 2XQYA 1Z0PA 3AE6A 5CA1E 5HXHA 2NP9A 2BG9B 3A7MA 2BVLA 5HEOA 2EHOD 2B76A 2E2AA 3PV0F 5HWYA 4JI2T 4CQIA 3PU3A 5L47A 4CXXA 2KZ7B 1X79A 3KV9A 5AQHB 4ZOLE 1MIYA 3PURA 5DJQC 5GONE 4DBMA 1KNZA 1UX5A 4AKRB 2IDOB 4KI0F 5M4YA 4JI6T 2WSSV 2LHRA 4LF7T 3OYXA 5LB7B 2YEVC 3FZFB 2NW8A 2JRKA 5L3GB 2KLQA 3UUNA 5HXSA 3ANWB 1WR0A 5JDHA 5AINA 3HR0A 3I9WA 1HS7A 4PFPA 4HWCA 3RKGA 3GN5A 3I9YA 2LT3A 4CXYA 4Z91A 4Z90A 2YDSA 4ZRUA 1CHUA 4XBFB 3UU3A 2W67A 3PJAJ 3PEOA 4O8SA 4ZI3C 4LMKA 4ISTA 3RQWA 3KVBA 4HTEA 2CWOA 4TWFA 4B3TT 3KFWX 5HEUA 4X66T 3WAKA 5AFLA 5CA0E 1JNZA 5TVCA 4TUYE 4TZ4C 4QABA 4UM1A 4ZK1A 2XUEA 3UFGA 2YMEA 2VKDA 3CQXC 1KK7A 1OXZA 2WCAA 4UM3A 4DV6T 4X65T 2HHHT 3R6NA 3UU6A 3P50A 2W4XA 1UGOA 4GKJT 4P0BA 4HWFA 4PJLA 3RYIE 3RRWA 3PUAA 2BYPA 4EIWA 5HEJA 3J9X1 5KZUA 2WZHA 2WWUA 2JQ9A 3K3OA 3N9LA 1X9BA 2XQ3A 5AFUL 2NOXA 1VCSA 3CKDA 4DV7T 3Q5EA 2RP4A 3SRZA 5IHYA 2J4GA 2VKHA 5JTGA 4O4JE 4EV6A 2C9TA 4U31A 4PJJA 3RC8A 1I94T 1Y01A 4QKNA 4G2AA 3BQKA 3CX8B 1M7KA 3KBTA 4H9OC 3P8CD 3RYCE 2WDRA 3GWHA 5J5IA 3OBVE 4UXNB 4NXMT 3C79A 3GMIA 2OV9A 2CM0A 5KXJA 4BFQA 4YFSA 3HKDE 2K3WA 1IBMT 4B3MT 4OFZA 3AE2A 1WYCA 3ZT5A 3FBLA 4JI8T 3AVSA 2XSBA 3V5SA 4U72A 4UF0A 4L5GA 1KNRA 1FMWA 3O1HA 2QRXA 3FXDB 5ABHA 3C4WA 4CI3B 1QSDA 4QHOA 3I0QA 3LK3B 3EDVA 2XY8B 2N9DA 3AA0B 4NZBA 2YMDA 4AFTA 4GK0E 3CWZB 4AQFA 2DWKA 4H63V 3WTMA 1BR2A 3EHZA 4B6XA 3HKEE 2NWBA 5HEHA 4I55E 2XQ5A 2UUCT 3ZLIA 3U8LA 3ZT7A 3AAAB 1J5ET 3MA9A 1XWMA 3ZYLA 1FIOA 3X1DA 4LFBT 5HEGA 5AQIB 4AIUA 2WNJA 4JLEA 3CX7B 3ZYMA 3LBXA 4QXHB 5FYMA 2V6YB 3RX6A 1N36T 2BYSA 5SYOA 3SQ6A 4ADZA 5ADXL 2XYSA 3RRCA 2BVMA 1OEDC 4QX8B 1HF8A 3QB5A 2GK9A 3UUXB 1CUNA 1JNRA 4C90A 3SOLA 4IDQA 1IZNB 5JQGE 2MTQA 3N2GE 1W09A 2CRBA 2BS2A 2VK9A 2ES0A 4UV8B 3WTKA 4COFA 2V7MA 3Q5WA 1KFYA 4U2YA 3PUVF 4NXNT 1OEDE 5LXBA 3NRYA 3E08A 4TX5A 2YINA 5LBMA 2BG9A 2M6BA 3EABA 4Z8XA 4X62T 3T1HT 1UUSA 2XQ4A 4U3CA 1HX8A 1NAFA 4DR2T 2LSIA 4KP3C 2LSYA 3CMLA 4HWIB 2HPJA 2VQFT 2XASB 3PDYA 1SE7A 4LF4T 1XNQT 5J2UE 2V6XA 2Y48B 3PJAA 4EYUA 5A1LA 4AFGA 1DU2A 5FMNA 4J2CA 2D9DA 4UVAB 2XAQB 3V5UA 2UU9T 1SHZC 2LSKA 3SFDA 3U78A 4A98A 2UXCT 4ZXLA 5HCMA 4ZS2A 1XZYA 4AKLA 4ISSA 2BYNA 4P0AA 4ZI2D 1UCUA 4ILBA 2NW7A 2HPLA 3TLVA 4FRRA 3P4QA 3AEEA 2LOSA 5FY7A 3JCFA 2M6IA 1VOMA 4PIRA 2UXXB 5L3DB 2Q9QB 4PFOA 3VRBA
chains in the Genus database with same CATH topology
3RQUA 2BJ0A 2Y54A 4QACA 5AFNA 2YMEA 5BP0A 2LLYA 5L47A 5AFHA 2XQ7A 4B5DA 2XNTA 2W8GA 2XNVA 5IUXA 4HFEA 4ZZCA 3SH1A 2X00D 1UV6A 4UM3A 2PH9A 4QH5A 3WTKA 4ALXA 5JMEA 5J0ZA 3UU6A 4COFA 3RIAA 2W8FA 2LKGA 3P50A 3TLUA 4BQTA 4IL4A 4HFDA 1UX2A 2Y7YA 2LKHA 4TWHA 3P4WA 3UQ7A 4QAAA 3LSVA 4DBMA 5BW2A 5AFKA 2XQAA 3GUAA 4NZBA 1OEDE 2BYPA 2YMDA 2BYRA 4AFTA 5LXBA 5FJVA 5HEJA 2WNCA 2XYTA 4HFIA 5HCJA 4UM3P 5J5GA 3WTJA 5KZUA 3ZKRA 3WTMA 3IGQA 2BG9A 2M6BA 3EHZA 4HFBA 4AFHA 5L4EA 3PMZA 2XZ6A 2XQ4A 4A97A 4WV9A 4ILAA 2XQ3A 2LM2A 5HEHA 2XQ6A 2Y58A 3WTNA 2Y56A 3RI5A 4QH4A 3UU5A 3UUBA 2X00A 3C84A 3UU4A 4LMLA 3WTOA 3JAFA 4HFHA 4HQPA 2ZJVA 5J5HA 2XQ5A 2QC1B 4ZK4A 4IREA 3U8LA 5AFMA 3SIOA 4ZZBA 5AINA 2BYQA 2MAWA 2C9TA 4TWDA 3WTLA 2YOEA 2YKSA 5AFJA 2XQ8A 3UQ4A 5J5FA 4XHEA 3ZDGA 3JAEA 2WNLA 4HFCA 2Y57A 3WTIA 2WN9A 4AFGA 4ZJTA 5CFBA 1UW6A 2BG9E 4ILCA 3SQ9A 3T4MA 5HEGA 4ZR6A 1OEDB 4Z91A 4Z90A 1OEDA 2VL0A 4ZRUA 2XQ9A 5LG3A 3U8JA 2WNJA 4A98A 2XZ5A 3U8KA 4EZ1A 3UU3A 5HCMA 5BRXA 5J5IA 4NPPA 3RHWA 2XNUA 3U8MA 1I9BA 3PEOA 4TNVA 2BYSA 4D01A 2BYNA 4XK9A 4F8HA 4X5TA 3C79A 4UM3S 5SYOA 4QH1A 3SQ6A 2ZJUA 4LMKA 4ZJSA 3EAMA 4UXUA 2XYSA 3RQWA 2WZYA 2PGZA 1OEDC 4BFQA 3JADA 4TWFA 4ILBA 3WTHA 3TLSA 3EI0A 3UU8A 5AFMB 5HEUA 4IL9A 3TLVA 4TNWA 4FRRA 4UY2A 2BG9C 5L4HA 2BR7A 3U8NA 5CO5A 2YN6A 3WIPA 2BG9B 4LMJA 5AFLA 2M6IA 3ZDHA 5TVCA 3TLWA 2KSRA 3TLTA 5KE4A 4PIRA 4QABA 5HEOA 2BR8A 4UM1A 3RIFA 2UZ6A 4ZK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQU A;  2BJ0 A;  2Y54 A;  4QAC A;  5AFN A;  2YME A;  5BP0 A;  2LLY A;  5L47 A;  5AFH A;  2XQ7 A;  4B5D A;  2XNT A;  2W8G A;  2XNV A;  5IUX A;  4HFE A;  4ZZC A;  3SH1 A;  2X00 D;  1UV6 A;  4UM3 A;  2PH9 A;  4QH5 A;  3WTK A;  4ALX A;  5JME A;  5J0Z A;  3UU6 A;  4COF A;  3RIA A;  2W8F A;  2LKG A;  3P50 A;  3TLU A;  4BQT A;  4IL4 A;  4HFD A;  1UX2 A;  2Y7Y A;  2LKH A;  4TWH A;  3P4W A;  3UQ7 A;  4QAA A;  3LSV A;  4DBM A;  5BW2 A;  5AFK A;  2XQA A;  3GUA A;  4NZB A;  1OED E;  2BYP A;  2YMD A;  2BYR A;  4AFT A;  5LXB A;  5FJV A;  5HEJ A;  2WNC A;  2XYT A;  4HFI A;  5HCJ A;  4UM3 P;  5J5G A;  3WTJ A;  5KZU A;  3ZKR A;  3WTM A;  3IGQ A;  2BG9 A;  2M6B A;  3EHZ A;  4HFB A;  4AFH A;  5L4E A;  3PMZ A;  2XZ6 A;  2XQ4 A;  4A97 A;  4WV9 A;  4ILA A;  2XQ3 A;  2LM2 A;  5HEH A;  2XQ6 A;  2Y58 A;  3WTN A;  2Y56 A;  3RI5 A;  4QH4 A;  3UU5 A;  3UUB A;  2X00 A;  3C84 A;  3UU4 A;  4LML A;  3WTO A;  3JAF A;  4HFH A;  4HQP A;  2ZJV A;  5J5H A;  2XQ5 A;  2QC1 B;  4ZK4 A;  4IRE A;  3U8L A;  5AFM A;  3SIO A;  4ZZB A;  5AIN A;  2BYQ A;  2MAW A;  2C9T A;  4TWD A;  3WTL A;  2YOE A;  2YKS A;  5AFJ A;  2XQ8 A;  3UQ4 A;  5J5F A;  4XHE A;  3ZDG A;  3JAE A;  2WNL A;  4HFC A;  2Y57 A;  3WTI A;  2WN9 A;  4AFG A;  4ZJT A;  5CFB A;  1UW6 A;  2BG9 E;  4ILC A;  3SQ9 A;  3T4M A;  5HEG A;  4ZR6 A;  1OED B;  4Z91 A;  4Z90 A;  1OED A;  2VL0 A;  4ZRU A;  2XQ9 A;  5LG3 A;  3U8J A;  2WNJ A;  4A98 A;  2XZ5 A;  3U8K A;  4EZ1 A;  3UU3 A;  5HCM A;  5BRX A;  5J5I A;  4NPP A;  3RHW A;  2XNU A;  3U8M A;  1I9B A;  3PEO A;  4TNV A;  2BYS A;  4D01 A;  2BYN A;  4XK9 A;  4F8H A;  4X5T A;  3C79 A;  4UM3 S;  5SYO A;  4QH1 A;  3SQ6 A;  2ZJU A;  4LMK A;  4ZJS A;  3EAM A;  4UXU A;  2XYS A;  3RQW A;  2WZY A;  2PGZ A;  1OED C;  4BFQ A;  3JAD A;  4TWF A;  4ILB A;  3WTH A;  3TLS A;  3EI0 A;  3UU8 A;  5AFM B;  5HEU A;  4IL9 A;  3TLV A;  4TNW A;  4FRR A;  4UY2 A;  2BG9 C;  5L4H A;  2BR7 A;  3U8N A;  5CO5 A;  2YN6 A;  3WIP A;  2BG9 B;  4LMJ A;  5AFL A;  2M6I A;  3ZDH A;  5TVC A;  3TLW A;  2KSR A;  3TLT A;  5KE4 A;  4PIR A;  4QAB A;  5HEO A;  2BR8 A;  4UM1 A;  3RIF A;  2UZ6 A;  4ZK1 A; 
#chains in the Genus database with same CATH topology
 3QOF A;  4YXD A;  1AJ3 A;  4U7I A;  1UV6 A;  4GIW A;  4O2A E;  5DQV A;  3RLF F;  4TWH A;  2QA7 A;  2ZM8 A;  4DV1 T;  4GKK T;  1NWM X;  4ZS3 A;  3AAI A;  2H7O A;  2L8K A;  3IGQ A;  3ONX A;  1R8I A;  4E7Z A;  3E0Z A;  4NUV A;  3NZP A;  3ZMU B;  3PUZ F;  2X0H A;  3LFM A;  3JAF A;  2CCQ A;  3FB2 A;  5J5H A;  1D1A A;  3T1Y T;  4O4H E;  5LGU B;  4TWD A;  2W2U A;  4A56 A;  3MJX A;  1WYB A;  4DR1 T;  2CPT A;  2MBG A;  3CK6 A;  3U3I A;  3FZL B;  3CX6 B;  2UXB T;  4WW0 A;  2UUA T;  3OYZ A;  3N2K E;  3C4X A;  4QH1 A;  3ZSS A;  4ZJS A;  2K24 A;  2YK0 A;  5JDM A;  3N2O A;  4I4T E;  2K48 A;  4CN1 A;  3NVO A;  3JC6 D;  3I1A A;  5JDG A;  5L4H A;  2KIN B;  4OK0 A;  2DI4 A;  4HFV A;  5CO5 A;  2UXN B;  1XDP A;  4QX7 B;  5FP3 A;  3ZDH A;  3PUQ A;  3TLT A;  2CLY C;  5JRC A;  5EZY E;  5LXT E;  4IGU A;  2XM2 A;  2X9W A;  2BJ0 A;  2LLY A;  5LGN B;  3LK4 2;  5LHI B;  4LFC T;  2NW9 A;  3B13 A;  4OHF A;  4IT4 A;  5AQL B;  5DQW A;  2L9Q A;  3L39 A;  4V1A v;  2DWG A;  1M62 A;  3L8R A;  1BR0 A;  2V26 A;  2XQA A;  3RH3 A;  2ACX A;  2BYR A;  3OJA A;  4NIQ A;  5EK2 A;  2F4V T;  1HX1 B;  4HWD A;  3CVR A;  2CXL A;  4QH4 A;  3UUB A;  4IE5 A;  4U74 A;  3OVU A;  5AFM A;  3SIO A;  3Q5X A;  5J5F A;  4KBM B;  1HTJ F;  4XHE A;  2WN9 A;  1J5W A;  3QK6 A;  3QNU A;  2XPK A;  3AEF A;  2V7I A;  1WRD A;  2V5D A;  4XAX B;  3O1I A;  4H9Q C;  3VR8 A;  2E9X B;  3PU8 A;  2RPA A;  4MAL A;  2J62 A;  3PUX F;  4PNI A;  4BJN A;  3M65 A;  3WIP A;  4MLK A;  5KDM C;  4C91 A;  4I50 E;  4FI5 A;  4DMW A;  2Y54 A;  4KMC A;  3PE0 A;  3PTR B;  3WAJ A;  2XNV A;  3RPU A;  2V6Y A;  2PH9 A;  4DV4 T;  4QH5 A;  3FZK B;  3RIA A;  4GYS A;  1H7C A;  4IL4 A;  3ZMS B;  4CN4 A;  2Y7Y A;  3P4W A;  3C64 A;  5FVL A;  1ZKE A;  3KDS E;  3MKD A;  2A2F X;  2V8S V;  2LE8 A;  3RYH E;  1LVF A;  5FJV A;  4PJM A;  5CB4 E;  4DVD A;  1W0B A;  3QB5 K;  5AQJ B;  3PMZ A;  1HFA A;  4A97 A;  3P4S A;  3AE9 A;  1WCR A;  2NR4 A;  3NWI A;  1XDO A;  3F31 A;  3RIU A;  2WB5 A;  1MND A;  4DMV A;  1ZEE A;  3AA7 B;  2KXP B;  3ZMZ B;  4ZJT A;  4ILC A;  2MOZ A;  2SPC A;  2DCF A;  1OED B;  2D0T A;  4HKA A;  2X9Y A;  3K8P C;  4CI1 B;  2WQY A;  2JQQ A;  3LJC A;  5FKY A;  4TNV A;  2DLR A;  4XK9 A;  4DUZ T;  4H63 H;  4AIS A;  5LYJ E;  2PJQ A;  2X9X A;  3WTH A;  3EI0 A;  3UU8 A;  5AQS B;  2EHO C;  2ODV A;  2JMK A;  2BG9 C;  3AXJ B;  3CPZ A;  2X66 A;  2I59 A;  3RQU A;  3UTK A;  4IE6 A;  5AFN A;  1N33 T;  4B3S T;  3FZM B;  4WZX A;  2OLT A;  4HFE A;  4ZZC A;  5FY1 A;  2LKG A;  5FY0 A;  5JR9 A;  1G8X A;  3ESL A;  4L9I A;  1Y64 B;  3NZQ A;  3AE5 A;  5ABE A;  3J7Y q;  3VU7 H;  2X68 A;  4IDZ A;  2WM9 A;  1HCI A;  3N9P A;  1U4Q A;  4L0R A;  4UM3 P;  5FL0 A;  1WR6 A;  3EUH A;  4AXP A;  2N2N A;  1NEN A;  1E7P A;  2W61 A;  2Q9Q A;  1SUM B;  2E5V A;  2IAK A;  4YY3 T;  2H3R A;  2PG8 A;  2WP9 A;  3QC9 A;  3NRX A;  4IRE A;  3N9O A;  5AQO B;  1T7S A;  2B1E A;  4N78 D;  4XZC A;  3UQ4 A;  4PK5 A;  4HFC A;  1D0X A;  2XQ9 A;  3ZN1 B;  3HKC E;  2LJL A;  4H9P C;  2ZJU A;  2ZMA A;  4H9N C;  1MNE A;  4GK5 E;  2KND A;  2ZM2 A;  4EYY R;  4LF9 T;  3TKL B;  1LVK A;  2W66 A;  3ZJ2 A;  3A8Y C;  4DV2 T;  3DP7 A;  2PBI A;  4LMJ A;  2PFV A;  3FBZ A;  2IC6 A;  3RIF A;  2XHE B;  4PK6 A;  4YT0 A;  2CMR A;  1LKX A;  2WWV A;  3K3Q C;  5IUX A;  2CBJ A;  3HI2 A;  5F3J A;  2IC9 A;  5E0O A;  2W8F A;  4JEH B;  1WFD A;  1UK5 A;  1MIW A;  4TV8 E;  3AA6 B;  4H9S E;  2E5L T;  2VL8 A;  1W9R A;  4MBQ A;  2Z6E A;  4LFA T;  3ZMV B;  4DID B;  2X9H A;  2CBI A;  5HCJ A;  5J5G A;  4ANJ A;  5LHH B;  3NKZ A;  4WYV A;  3RF1 A;  4X64 T;  2LM2 A;  5ABF B;  2FJA A;  2Y56 A;  3RI5 A;  3C84 A;  2CXD A;  2FJE A;  3UU4 A;  1VCT A;  4EEB A;  2VVN A;  3PUW F;  4H9R C;  2UXD T;  2FBW A;  3W15 B;  4IE7 A;  5JDF A;  4AQY T;  2W00 A;  5ABG A;  3PUG A;  1HG5 A;  2A3D A;  4LF8 T;  3U8K A;  3C51 A;  2H7V C;  2WBL A;  4YSX A;  3UUL A;  3KVA A;  2IIU A;  4JYA T;  4UM3 S;  3M3Z B;  3ZN0 B;  2CLY B;  3LG7 A;  3HKB E;  4K0K T;  4UXU A;  2WZY A;  3IEE A;  4UEL A;  3O4X E;  4TV9 E;  4FJO A;  5AQK B;  5LP6 E;  5EK3 A;  1VRB A;  5BMV E;  4KHP T;  2AXD S;  4UY2 A;  5FVK A;  4ASK A;  1YXR A;  5LOV E;  1V9D A;  2PTF A;  2H88 A;  2KSR A;  2BS4 A;  5FNV E;  1HNX T;  4DR5 T;  4EZ4 A;  4O4I E;  4YJ2 E;  2E8I A;  5IYZ E;  4ZHQ E;  3ANW A;  4CXW A;  2D5U A;  2VQE T;  2E9X A;  5LMN T;  5J2T E;  3CQC B;  2BS3 A;  1YKH B;  4QAA A;  4PK4 A;  3GUA A;  2G0U A;  4WNK A;  2VB6 A;  2XTL A;  3PUY F;  2Q9Q D;  2ODU A;  4HFB A;  4AFH A;  2JQK A;  4YLH A;  3AE8 A;  5LA6 E;  2XZ6 A;  4WV9 A;  1KF6 A;  2FJB A;  2X0Y A;  4UF0 B;  1I6Z A;  4TN7 B;  2CEA A;  4HE8 A;  3KBU A;  2ZJV A;  3AA1 B;  1B7T A;  2JQH A;  2XAH B;  2XAG B;  4PW8 A;  4YSZ A;  2MAW A;  2WNL A;  2CHN A;  3T4M A;  2WMO A;  1E2A A;  2HH7 A;  1U5P A;  2W63 A;  3VHL A;  5JH7 E;  3H37 A;  3IHR A;  1S35 A;  3RKO A;  4B3R T;  4O2B E;  5AQR B;  3S4U A;  2V1D B;  2I6H A;  5LHG B;  4ZI3 D;  2BR7 A;  4JUY A;  2ZM0 A;  3DJB A;  2L3L A;  4LF6 T;  2VAS A;  2YN6 A;  2FUP A;  3TLW A;  2ACZ A;  1OED A;  1WLX A;  4K0U A;  2BKN A;  3RIU C;  3CQG B;  2XQ7 A;  4UVC B;  2XNT A;  5LGT B;  3L09 A;  4JI7 T;  4BQT A;  3KV4 A;  3SFE A;  4DV3 T;  5BW2 A;  3AEA A;  3B57 A;  1FMV A;  2QVA A;  3ZPO A;  1HNZ T;  5FXX A;  4A5X A;  4IE0 A;  3GA8 A;  2XYT A;  1QUU A;  2JJ9 A;  3AXJ A;  1T72 A;  3ETU A;  3ZKR A;  3L3P A;  4IDO A;  5L3C B;  4X1K E;  1KNP A;  2K9A A;  4M1P A;  1ZHC A;  4IE4 A;  4HQP A;  1YQ4 A;  4ZK4 A;  4OYK A;  3AEC A;  5AQN B;  2YKS A;  5AFJ A;  4IDN A;  2A72 A;  5CFB A;  1IJ5 A;  5LG3 A;  4ZI2 C;  2EHO B;  4EZH A;  5FXW A;  1XNR T;  1L0V A;  4DR6 T;  5JR9 C;  3MXZ A;  3P4P A;  5JVD E;  1MMN A;  5FXZ A;  1GQE A;  3AVR A;  4JI0 T;  4JI4 T;  1T8B A;  3RC3 A;  4G63 A;  1UX4 A;  3OTO T;  3EVY A;  2DHR A;  4BAY B;  1YD8 G;  4U33 A;  2WU2 A;  5KMG P;  2Q9Q C;  2LSJ A;  5AQQ B;  5KE4 A;  2UZ6 A;  3T8O A;  4KX6 A;  5HWX A;  2MPK A;  1SA0 E;  4QAC A;  5JDL A;  5BP0 A;  3F57 A;  2D0U A;  4DND A;  5HYA A;  2WZI A;  2E9X D;  5JME A;  3C4Z A;  4AQF C;  4NUU A;  3TLU A;  1UX2 A;  4HFD A;  3AEB A;  2LKH A;  4KHZ F;  2BZB A;  4JBW F;  5AFK A;  2KT9 A;  4LF5 T;  5AQG B;  4JEU B;  2XAJ B;  1FJG T;  3ZC1 A;  1S94 A;  4DR3 T;  3ONJ A;  1G73 A;  1KEY A;  3CIR A;  2XQ6 A;  1XMO T;  4WBO A;  2IW5 B;  2VWA A;  3FXE B;  4I43 B;  3VRA A;  4IDP A;  3WTL A;  3O1J A;  5C8Y E;  3ZDG A;  2MYS A;  3BQI A;  3Q2M A;  5EK4 A;  3U8J A;  5L3F B;  1MMA A;  4U7Y A;  3F2E A;  3JC6 C;  4YTM A;  3MK7 C;  1I9B A;  3U8M A;  3E22 E;  4EXT A;  4I0U A;  5ABF A;  2XZE A;  1XMQ T;  3LDQ B;  4EAH A;  4X1Y E;  2PGZ A;  2J47 A;  3AAE B;  3H3M A;  3UT5 E;  4QXB B;  3BQL A;  3K3N A;  2AE9 A;  2Y8D A;  2YU2 A;  4IIJ E;  4E7S A;  4JV5 T;  3LK2 B;  3EDU A;  3SH1 A;  2X00 D;  5IWA T;  3O9X A;  3HL6 A;  4ZEY A;  2LSG A;  2X0L B;  3N9Q A;  2C5J A;  3A5X A;  3MZK B;  3ZCJ A;  1Z8U A;  2QYW A;  2LHN A;  5L3E B;  2WMN A;  3Q9D A;  2IUB A;  5JRC B;  4ERR A;  3RYF E;  5AQP B;  2NTX A;  2WAU A;  2XAF B;  3UU5 A;  4LML A;  4JI1 T;  2CE7 A;  5JDQ A;  2QC1 B;  2JPF A;  3OKQ A;  5DAB A;  5AQM B;  3AED A;  4MFR A;  3NBX X;  3JAE A;  5FL1 A;  4DBR A;  1UW6 A;  2BG9 E;  4ZR6 A;  3ABV A;  1EZ3 A;  3H3A A;  2JIW A;  2BKP A;  2E9X C;  3RHW A;  2XNU A;  3QUJ A;  3K1S A;  2KMF A;  2V7L A;  3IA3 A;  4HGA A;  3AB3 B;  1N32 T;  3KV6 A;  2Y6X A;  5CGM A;  5AFM B;  3I0O A;  2YDQ A;  4AKG A;  2C5K T;  2I0M A;  2CWY A;  4O4L E;  1FEW A;  4QXC B;  5HXC A;  4BA9 A;  4P1N A;  4DV0 T;  2KWH A;  4CN6 A;  2X67 A;  2D2S A;  5AFH A;  4B5D A;  1ZOY A;  5KX5 E;  5J0Z A;  4JI5 T;  3GN5 B;  3LSV A;  2BBJ A;  4YJ3 E;  5J1G A;  5LNK A;  2X51 A;  4DR7 T;  4JI3 T;  2LOP A;  1IAP A;  4AKH A;  4GOU A;  4DUY T;  3UUM A;  5L4E A;  4OX9 T;  4ILA A;  3ZC0 A;  3UFE A;  3FZH B;  4YHJ A;  2J1D G;  2UUB T;  1BR4 A;  1T98 A;  2WU5 A;  1HNW T;  4DV5 T;  3AEG A;  1MMD A;  5C2T A;  5F8P A;  3VKG A;  3ZST A;  2IHR 1;  4HEA A;  4UIG A;  2A9U A;  5HXR A;  4CI2 B;  2VL0 A;  4EZ1 A;  5L3B B;  4HN9 A;  5BRX A;  4NPP A;  2K5B B;  4D01 A;  4F8H A;  4X5T A;  5H6R B;  2VUR A;  3B5M A;  3ZCI A;  4UEM A;  3SWH A;  4EGW A;  4AKI A;  1J1J A;  3JAD A;  2WDV A;  3KV5 A;  1ZV4 X;  2XSA A;  3G06 A;  4TNW A;  3ZMT B;  2LM9 A;  4EED A;  3U8N A;  4WBN E;  2CA5 A;  5H6Q B;  3DTO A;  2EHO A;  2C5I T;  2VKJ A;  3WI3 A;  3ZYK A;  3N9N A;  1HG2 A;  3PUS A;  1N34 T;  4U2Z A;  3ZT6 A;  4F6R C;  2OA5 A;  4DR4 T;  5ETW A;  1US7 B;  3N5L A;  2BKO A;  2DL1 A;  5AQV B;  2VVS A;  4OYJ A;  1QLB A;  2CXF A;  4PAG A;  1D1B A;  4YTP A;  2WNC A;  4HFI A;  3WTJ A;  1MIV A;  5F5W A;  4YHH T;  5LCY A;  5JRE A;  4QWN B;  2Y58 A;  2LEH A;  2V5C A;  4KUM B;  1IBL T;  4DO0 A;  5JR9 B;  1D1C A;  4ZZB A;  2XJ7 A;  3IBP A;  4PJN A;  2YOE A;  3VR9 A;  4AI6 A;  1IBK T;  2DNX A;  2Y57 A;  3WTI A;  3IF8 B;  2LRL A;  1NEK A;  3AE4 A;  2BBH A;  2V7J A;  2M67 A;  1O3X A;  4BJM A;  2HN2 A;  3ONL C;  2XZ5 A;  3ZEF B;  4X20 E;  1OWA A;  2XM1 A;  5JDN A;  5LJN A;  4CZZ B;  2IML A;  1D0Z A;  3HA4 A;  1IJ6 A;  1YQ3 A;  2CHO A;  1D0Y A;  2KWI B;  3TLS A;  4IL9 A;  2WY2 A;  4EB6 E;  5AQF B;  3C98 B;  5LBQ B;  5HAX A;  5BR8 T;  2BR8 A;  2C0S A;  2N1G A;  4AQG A;  2RA1 A;  2LRK A;  3P4R A;  4DBQ A;  1MMG A;  2W8G A;  2HN1 A;  1LRZ A;  4MHC A;  2FJD A;  4ALX A;  2H89 A;  4UR9 A;  3OPC A;  3N9M A;  3ETV A;  4UVB B;  5AQU B;  1YKE B;  3P7I A;  3UQ7 A;  5C3J A;  4YTN A;  3KIN B;  5LJM A;  5HXE A;  1BR1 A;  2YDR A;  4X1I E;  1YW0 A;  1E1H B;  3LBX B;  4P09 A;  3SS1 A;  4GYR A;  3D0T A;  3FHN A;  4ZI7 E;  2ZLY A;  3WTN A;  2W62 A;  2YU1 A;  2X00 A;  2BDE A;  3WTO A;  4HFH A;  3Q5D A;  3RGL A;  2W0G A;  3AE3 A;  2V7K A;  2JMH A;  2BYQ A;  5L2L A;  5AQT B;  2XQ8 A;  3BK9 A;  1UUR A;  2QGS A;  4ILU A;  5FXV A;  3SQ9 A;  2WDQ A;  1ZP0 A;  5LG4 A;  4HWH A;  3ZJ1 A;  4IHJ E;  2VKO A;  3AE7 A;  5TAO A;  3R84 B;  4UV9 B;  4Q25 A;  2ZM6 T;  3AE1 A;  2NTY A;  4EOZ B;  1HR0 T;  3EAM A;  3MAC A;  2R6G F;  2P9B A;  3VKH A;  4YSY A;  5LMU T;  1W0A A;  3C50 A;  2WS3 A;  5CJ5 A;  2XQY A;  1Z0P A;  3AE6 A;  5CA1 E;  5HXH A;  2NP9 A;  2BG9 B;  3A7M A;  2BVL A;  5HEO A;  2EHO D;  2B76 A;  2E2A A;  3PV0 F;  5HWY A;  4JI2 T;  4CQI A;  3PU3 A;  5L47 A;  4CXX A;  2KZ7 B;  1X79 A;  3KV9 A;  5AQH B;  4ZOL E;  1MIY A;  3PUR A;  5DJQ C;  5GON E;  4DBM A;  1KNZ A;  1UX5 A;  4AKR B;  2IDO B;  4KI0 F;  5M4Y A;  4JI6 T;  2WSS V;  2LHR A;  4LF7 T;  3OYX A;  5LB7 B;  2YEV C;  3FZF B;  2NW8 A;  2JRK A;  5L3G B;  2KLQ A;  3UUN A;  5HXS A;  3ANW B;  1WR0 A;  5JDH A;  5AIN A;  3HR0 A;  3I9W A;  1HS7 A;  4PFP A;  4HWC A;  3RKG A;  3GN5 A;  3I9Y A;  2LT3 A;  4CXY A;  4Z91 A;  4Z90 A;  2YDS A;  4ZRU A;  1CHU A;  4XBF B;  3UU3 A;  2W67 A;  3PJA J;  3PEO A;  4O8S A;  4ZI3 C;  4LMK A;  4IST A;  3RQW A;  3KVB A;  4HTE A;  2CWO A;  4TWF A;  4B3T T;  3KFW X;  5HEU A;  4X66 T;  3WAK A;  5AFL A;  5CA0 E;  1JNZ A;  5TVC A;  4TUY E;  4TZ4 C;  4QAB A;  4UM1 A;  4ZK1 A;  2XUE A;  3UFG A;  2YME A;  2VKD A;  3CQX C;  1KK7 A;  1OXZ A;  2WCA A;  4UM3 A;  4DV6 T;  4X65 T;  2HHH T;  3R6N A;  3UU6 A;  3P50 A;  2W4X A;  1UGO A;  4GKJ T;  4P0B A;  4HWF A;  4PJL A;  3RYI E;  3RRW A;  3PUA A;  2BYP A;  4EIW A;  5HEJ A;  3J9X 1;  5KZU A;  2WZH A;  2WWU A;  2JQ9 A;  3K3O A;  3N9L A;  1X9B A;  2XQ3 A;  5AFU L;  2NOX A;  1VCS A;  3CKD A;  4DV7 T;  3Q5E A;  2RP4 A;  3SRZ A;  5IHY A;  2J4G A;  2VKH A;  5JTG A;  4O4J E;  4EV6 A;  2C9T A;  4U31 A;  4PJJ A;  3RC8 A;  1I94 T;  1Y01 A;  4QKN A;  4G2A A;  3BQK A;  3CX8 B;  1M7K A;  3KBT A;  4H9O C;  3P8C D;  3RYC E;  2WDR A;  3GWH A;  5J5I A;  3OBV E;  4UXN B;  4NXM T;  3C79 A;  3GMI A;  2OV9 A;  2CM0 A;  5KXJ A;  4BFQ A;  4YFS A;  3HKD E;  2K3W A;  1IBM T;  4B3M T;  4OFZ A;  3AE2 A;  1WYC A;  3ZT5 A;  3FBL A;  4JI8 T;  3AVS A;  2XSB A;  3V5S A;  4U72 A;  4UF0 A;  4L5G A;  1KNR A;  1FMW A;  3O1H A;  2QRX A;  3FXD B;  5ABH A;  3C4W A;  4CI3 B;  1QSD A;  4QHO A;  3I0Q A;  3LK3 B;  3EDV A;  2XY8 B;  2N9D A;  3AA0 B;  4NZB A;  2YMD A;  4AFT A;  4GK0 E;  3CWZ B;  4AQF A;  2DWK A;  4H63 V;  3WTM A;  1BR2 A;  3EHZ A;  4B6X A;  3HKE E;  2NWB A;  5HEH A;  4I55 E;  2XQ5 A;  2UUC T;  3ZLI A;  3U8L A;  3ZT7 A;  3AAA B;  1J5E T;  3MA9 A;  1XWM A;  3ZYL A;  1FIO A;  3X1D A;  4LFB T;  5HEG A;  5AQI B;  4AIU A;  2WNJ A;  4JLE A;  3CX7 B;  3ZYM A;  3LBX A;  4QXH B;  5FYM A;  2V6Y B;  3RX6 A;  1N36 T;  2BYS A;  5SYO A;  3SQ6 A;  4ADZ A;  5ADX L;  2XYS A;  3RRC A;  2BVM A;  1OED C;  4QX8 B;  1HF8 A;  3QB5 A;  2GK9 A;  3UUX B;  1CUN A;  1JNR A;  4C90 A;  3SOL A;  4IDQ A;  1IZN B;  5JQG E;  2MTQ A;  3N2G E;  1W09 A;  2CRB A;  2BS2 A;  2VK9 A;  2ES0 A;  4UV8 B;  3WTK A;  4COF A;  2V7M A;  3Q5W A;  1KFY A;  4U2Y A;  3PUV F;  4NXN T;  1OED E;  5LXB A;  3NRY A;  3E08 A;  4TX5 A;  2YIN A;  5LBM A;  2BG9 A;  2M6B A;  3EAB A;  4Z8X A;  4X62 T;  3T1H T;  1UUS A;  2XQ4 A;  4U3C A;  1HX8 A;  1NAF A;  4DR2 T;  2LSI A;  4KP3 C;  2LSY A;  3CML A;  4HWI B;  2HPJ A;  2VQF T;  2XAS B;  3PDY A;  1SE7 A;  4LF4 T;  1XNQ T;  5J2U E;  2V6X A;  2Y48 B;  3PJA A;  4EYU A;  5A1L A;  4AFG A;  1DU2 A;  5FMN A;  4J2C A;  2D9D A;  4UVA B;  2XAQ B;  3V5U A;  2UU9 T;  1SHZ C;  2LSK A;  3SFD A;  3U78 A;  4A98 A;  2UXC T;  4ZXL A;  5HCM A;  4ZS2 A;  1XZY A;  4AKL A;  4ISS A;  2BYN A;  4P0A A;  4ZI2 D;  1UCU A;  4ILB A;  2NW7 A;  2HPL A;  3TLV A;  4FRR A;  3P4Q A;  3AEE A;  2LOS A;  5FY7 A;  3JCF A;  2M6I A;  1VOM A;  4PIR A;  2UXX B;  5L3D B;  2Q9Q B;  4PFO A;  3VRB A; 
#chains in the Genus database with same CATH homology
 3RQU A;  2BJ0 A;  2Y54 A;  4QAC A;  5AFN A;  2YME A;  5BP0 A;  2LLY A;  5L47 A;  5AFH A;  2XQ7 A;  4B5D A;  2XNT A;  2W8G A;  2XNV A;  5IUX A;  4HFE A;  4ZZC A;  3SH1 A;  2X00 D;  1UV6 A;  4UM3 A;  2PH9 A;  4QH5 A;  3WTK A;  4ALX A;  5JME A;  5J0Z A;  3UU6 A;  4COF A;  3RIA A;  2W8F A;  2LKG A;  3P50 A;  3TLU A;  4BQT A;  4IL4 A;  4HFD A;  1UX2 A;  2Y7Y A;  2LKH A;  4TWH A;  3P4W A;  3UQ7 A;  4QAA A;  3LSV A;  4DBM A;  5BW2 A;  5AFK A;  2XQA A;  3GUA A;  4NZB A;  1OED E;  2BYP A;  2YMD A;  2BYR A;  4AFT A;  5LXB A;  5FJV A;  5HEJ A;  2WNC A;  2XYT A;  4HFI A;  5HCJ A;  4UM3 P;  5J5G A;  3WTJ A;  5KZU A;  3ZKR A;  3WTM A;  3IGQ A;  2BG9 A;  2M6B A;  3EHZ A;  4HFB A;  4AFH A;  5L4E A;  3PMZ A;  2XZ6 A;  2XQ4 A;  4A97 A;  4WV9 A;  4ILA A;  2XQ3 A;  2LM2 A;  5HEH A;  2XQ6 A;  2Y58 A;  3WTN A;  2Y56 A;  3RI5 A;  4QH4 A;  3UU5 A;  3UUB A;  2X00 A;  3C84 A;  3UU4 A;  4LML A;  3WTO A;  3JAF A;  4HFH A;  4HQP A;  2ZJV A;  5J5H A;  2XQ5 A;  2QC1 B;  4ZK4 A;  4IRE A;  3U8L A;  5AFM A;  3SIO A;  4ZZB A;  5AIN A;  2BYQ A;  2MAW A;  2C9T A;  4TWD A;  3WTL A;  2YOE A;  2YKS A;  5AFJ A;  2XQ8 A;  3UQ4 A;  5J5F A;  4XHE A;  3ZDG A;  3JAE A;  2WNL A;  4HFC A;  2Y57 A;  3WTI A;  2WN9 A;  4AFG A;  4ZJT A;  5CFB A;  1UW6 A;  2BG9 E;  4ILC A;  3SQ9 A;  3T4M A;  5HEG A;  4ZR6 A;  1OED B;  4Z91 A;  4Z90 A;  1OED A;  2VL0 A;  4ZRU A;  2XQ9 A;  5LG3 A;  3U8J A;  2WNJ A;  4A98 A;  2XZ5 A;  3U8K A;  4EZ1 A;  3UU3 A;  5HCM A;  5BRX A;  5J5I A;  4NPP A;  3RHW A;  2XNU A;  3U8M A;  1I9B A;  3PEO A;  4TNV A;  2BYS A;  4D01 A;  2BYN A;  4XK9 A;  4F8H A;  4X5T A;  3C79 A;  4UM3 S;  5SYO A;  4QH1 A;  3SQ6 A;  2ZJU A;  4LMK A;  4ZJS A;  3EAM A;  4UXU A;  2XYS A;  3RQW A;  2WZY A;  2PGZ A;  1OED C;  4BFQ A;  3JAD A;  4TWF A;  4ILB A;  3WTH A;  3TLS A;  3EI0 A;  3UU8 A;  5AFM B;  5HEU A;  4IL9 A;  3TLV A;  4TNW A;  4FRR A;  4UY2 A;  2BG9 C;  5L4H A;  2BR7 A;  3U8N A;  5CO5 A;  2YN6 A;  3WIP A;  2BG9 B;  4LMJ A;  5AFL A;  2M6I A;  3ZDH A;  5TVC A;  3TLW A;  2KSR A;  3TLT A;  5KE4 A;  4PIR A;  4QAB A;  5HEO A;  2BR8 A;  4UM1 A;  3RIF A;  2UZ6 A;  4ZK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...