3EAMA

An open-pore structure of a bacterial pentameric ligand-gated ion channel
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title X-ray structure of a pentameric ligand-gated ion channel in an apparently open conformation.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3eamA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3eamA01
5HEJA 3U8MA 2Y54A 5TVCA 2LM2A 2BYNA 2YMDA 1I9BA 2BG9C 3WTMA 4IL9A 4DBMA 5BRXA 2BG9B 5IUXA 5BP0A 2KSRA 4QH5A 5J5IA 2LKHA 3RI5A 3RIAA 1OEDC 2YMEA 2Y58A 5AFMA 5FJVA 1OEDB 5AFKA 2XQ9A 5JMEA 4HFBA 3P4WA 3U8JA 4ZR6A 4COFA 3SQ9A 3WTJA 3WTOA 3UU6A 2M6IA 2PH9A 5CO5A 3ZDGA 4UM3S 2WNJA 5LXBA 4ILCA 4HFIA 5LG3A 2W8GA 4UXUA 2XZ6A 2WNCA 5KE4A 4LMLA 2QC1B 2PGZA 1UV6A 3SH1A 4QH1A 5HCMA 4F8HA 3ZKRA 2UZ6A 4HQPA 2WZYA 3JADA 2Y7YA 4QAAA 3T4MA 4ZRUA 3EHZA 3P50A 2LLYA 5L47A 5CFBA 4HFDA 3UU3A 2XYSA 3IGQA 4IREA 3ZDHA 3WTHA 5J5GA 4ZK1A 4B5DA 2WNLA 4UM3A 3UQ4A 2XNUA 4EZ1A 4HFEA 5BW2A 3UU8A 5J0ZA 4UY2A 3RQWA 2XQ8A 4ZJSA 4LMKA 2XNTA 2C9TA 4AFHA 4QACA 2XQAA 4NPPA 3UQ7A 4Z91A 2BR8A 2X00A 3TLVA 3UUBA 5J5HA 2XQ5A 4ZJTA 3UU4A 5AFMB 2BYPA 2ZJVA 5AFHA 4XK9A 4Z90A 2XQ4A 3JAFA 3UU5A 2WN9A 2YOEA 3WTNA 5KZUA 4X5TA 5HEOA 2BR7A 3SIOA 3SQ6A 3PMZA 4QH4A 4ILAA 4AFTA 4BQTA 2BYSA 2BJ0A 3GUAA 5AFLA 3RHWA 4TWDA 4A97A 4IL4A 4LMJA 4A98A 3U8NA 2ZJUA 2XQ6A 3TLSA 2X00D 5AFJA 3WIPA 4ZK4A 2BG9A 4WV9A 5AINA 5L4EA 4UM1A 2XQ7A 3JAEA 4TNVA 4AFGA 4ALXA 3RQUA 5J5FA 5AFNA 1OEDA 3EAMA 5HCJA 2M6BA 2YKSA 2XZ5A 2YN6A 4ZZBA 3WTLA 4ZZCA 3TLTA 4FRRA 2MAWA 2XQ3A 3EI0A 4UM3P 4BFQA 4TWFA 2BG9E 5L4HA 3C84A 2W8FA 4HFCA 2BYQA 3RIFA 3TLUA 4NZBA 3U8LA 1OEDE 4TWHA 1UX2A 2Y57A 3C79A 4D01A 2LKGA 3LSVA 4TNWA 2XYTA 2Y56A 1UW6A 4QABA 4PIRA 5HEGA 4HFHA 3U8KA 3WTKA 3PEOA 4ILBA 4XHEA 5SYOA 5HEHA 3TLWA 2XNVA 2VL0A 2BYRA 5HEUA 3WTIA
chains in the Genus database with same CATH superfamily
3U8MA 2A2FX 3I0OA 3LBXA 4LFCT 1E1HB 4L0RA 5H6RB 1NENA 1OEDC 2I6HA 4EZ4A 2I0MA 4DR4T 4O4HE 3MJXA 4PFPA 2VKHA 4EYUA 5EK4A 5LG3A 3PUVF 5KE4A 3UUNA 3UULA 2FUPA 2YK0A 2V6YB 2HH7A 2PFVA 4ZOLE 3ZDHA 3EABA 3P4QA 1ZEEA 3Q5DA 4IDOA 2G0UA 1DU2A 2DWKA 4U2YA 3O1HA 5J5HA 1ZV4X 2ZM6T 4JI4T 2XQ4A 4EZHA 3AE3A 3JAFA 4U33A 4O4JE 4YY3T 1US7B 2HPLA 4TWDA 4YHJA 5LGTB 2FJDA 4PK5A 4YSXA 3AE9A 4JI0T 2QYWA 5FNVE 4EGWA 2QA7A 2YKSA 2YN6A 1S94A 3FBLA 3WTLA 4ZZCA 3ZC1A 3I1AA 4JUYA 3HKDE 3C79A 1G8XA 3BQKA 2EHOA 2LKGA 4TNWA 2XYTA 2Y56A 5A1LA 5HEGA 2XZEA 3ETUA 5HAXA 2XJ7A 2K5BB 4ZI2C 2XY8B 2FJEA 2BS3A 3RIAA 3N9OA 4O2BE 3FBZA 2Y6XA 3RC3A 3F2EA 4CXWA 3Q5XA 2CMRA 4N78D 4OYKA 1W09A 2XAGB 3H37A 2WNCA 4H9NC 2V8SV 1WR0A 4HFVA 1D0ZA 2NOXA 2VB6A 2YINA 3VKHA 3LK3B 3M3ZB 2H7VC 4KMCA 2LLYA 1FIOA 3QC9A 5DJQC 2BDEA 5J5GA 3UQ4A 2X0YA 2OA5A 5JRCA 2C9TA 3AA1B 4IE0A 2XSAA 4YHHT 2XQYA 4ZJTA 4GYSA 3LFMA 2WQYA 3BK9A 3ETVA 3WI3A 3EVYA 5CGMA 3RC8A 3CWZB 2VKOA 2XQ6A 5AFJA 4AXPA 3LK42 2CBIA 3QK6A 4JI1T 3OTOT 2CE7A 5HCJA 4AKLA 2UU9T 2MPKA 4HWDA 4ZS3A 2MAWA 2IMLA 4TWFA 1HNZT 2X9HA 1VCTA 2BYQA 1UX5A 1ZKEA 4YT0A 1OEDE 3RYFE 4YXDA 1MMAA 3P8CD 5L2LA 3IBPA 1CUNA 4ZHQE 3R84B 4PK4A 1D0YA 2FJBA 2PTFA 4FJOA 1HF8A 1XNQT 1WFDA 2P9BA 4KHZF 2VURA 1IBMT 3CX8B 3WAJA 4AQFC 2LT3A 1OXZA 3WTOA 3C4XA 2DI4A 4DR5T 1Z8UA 2LSGA 3OBVE 5KMGP 1UV6A 2JMHA 5AQQB 3BQLA 4TX5A 3C98B 2W66A 3CQGB 5AQKB 4H9SE 3W15B 3N5LA 4J2CA 3VRAA 4LF4T 2XQAA 2NW8A 4HN9A 3ZYMA 2IC9A 4KHPT 1H7CA 1QUUA 1UGOA 5KZUA 4PFOA 4OX9T 2UUCT 3AEEA 4KBMB 2E9XC 4DUZT 5LG4A 4GKJT 3ZJ1A 3KDSE 4OHFA 2W63A 4DO0A 3KBUA 2VQET 4ZK4A 3AECA 4AFGA 3RQUA 4UEMA 1SA0E 2K24A 1S35A 5FL0A 2X51A 2XHEB 4DR1T 2D5UA 4DUYT 1JNRA 2X9XA 3GN5B 3IA3A 3MXZA 3FZFB 5C8YE 3U3IA 2I59A 4PIRA 1IJ6A 4XHEA 4IE7A 3PUQA 4EB6E 4P1NA 2J4GA 3EUHA 3PUZF 4CI2B 4I43B 4DR3T 1U5PA 2KT9A 4LF8T 1X79A 5AFKA 2E5VA 3U8JA 2JQKA 4WYVA 3SQ9A 2XAFB 4DV6T 2VVNA 4LMLA 4CZZB 2CHNA 4DV1T 2QC1B 3WAKA 4F8HA 2WZYA 2C0SA 4FI5A 2R6GF 3FZKB 2ZM0A 1HR0T 3U78A 4PJNA 1FEWA 2ES0A 2A9UA 1M62A 1Z0PA 3RIUC 2Y48B 3DP7A 3RRCA 2SPCA 4DV4T 3KVAA 3VR9A 4YLHA 5CA1E 3AEFA 2NR4A 1AJ3A 4TV9E 2YDSA 2N1GA 4HE8A 4QXHB 4ZI2D 3SQ6A 1W0AA 1UK5A 4Q25A 4LMJA 3ANWA 2V6YA 2CWYA 5JDHA 5H6QB 5LP6E 3C84A 5AQTB 5LB7B 3KV6A 5LBQB 2Y57A 2VK9A 5LCYA 3ZCJA 5JREA 1YQ3A 2C5IT 3N2KE 3N9MA 2HHHT 4IDPA 3ONXA 4TV8E 5AQSB 2E8IA 3A5XA 3HI2A 5CA0E 4IL9A 2YEVC 5IUXA 2KSRA 2KLQA 5FL1A 3ONJA 3PJAJ 5JMEA 4HGAA 3IF8B 5IYZE 5EK3A 5CO5A 4U72A 4HFIA 1KK7A 1V9DA 4IE5A 1HNXT 4LF7T 3JADA 2Y7YA 4E7SA 2H88A 3AEDA 3R6NA 4IDZA 5LOVE 2XASB 2PG8A 2V7MA 3K1SA 4ISSA 4PW8A 4ZK1A 4DIDB 3UU8A 3AXJA 4ZJSA 4WBOA 3T1YT 3A8YC 4Z91A 3EDVA 3I9WA 2JPFA 4JI8T 2BYPA 4ZS2A 2MYSA 1JNZA 2VKJA 3PMZA 3OPCA 3L39A 5AFLA 1KFYA 2H89A 3GA8A 3AE5A 3P4SA 4A98A 2C5JA 2CXDA 1WCRA 2YDQA 3F57A 3GMIA 3X1DA 5FP3A 3FHNA 5FVLA 1HFAA 4ILUA 2LJLA 3ESLA 3Q5EA 4IDNA 3C4WA 3O9XA 4G63A 2X0HA 4XAXB 3AA7B 4JI2T 2E9XA 5ABFA 3E08A 2NTYA 5TVCA 2LM2A 4DBMA 3C64A 4I50E 1OWAA 2CPTA 5KXJA 1QLBA 4WNKA 4ISTA 2E9XD 2W8GA 2XZ6A 1WYBA 2IDOB 4AKRB 4KI0F 5AQRB 2PGZA 2UUAT 2UUBT 2N2NA 3RLFF 1NWMX 4HFDA 5JR9B 4QXBB 1HTJF 4OFZA 1BR0A 4UM3A 3AEBA 5J0ZA 2BR8A 2BS2A 2JIWA 2WB5A 5LJMA 4CN4A 3QB5K 2DHRA 5DABA 3PUSA 4CXYA 2YOEA 2BR7A 2LHRA 5LA6E 4YSYA 1D1BA 3MZKB 3CIRA 1QSDA 2AXDS 5HXEA 3HR0A 5C3JA 5JDLA 3U8NA 2XM2A 2ZJUA 3P4RA 1XNRT 2BG9A 1WR6A 2XQ7A 4ALXA 5JVDE 3CQXC 3SRZA 2OV9A 2XAHB 2CHOA 5FYMA 4BJMA 2KZ7B 1VRBA 5L3GB 4F6RC 1HNWT 1D1AA 5LHGB 2XNVA 1W9RA 5DQWA 3O1IA 4B6XA 3NZQA 1SUMB 3ZSTA 2LSIA 3L09A 3KINB 2UXBT 3AA6B 2FJAA 4WZXA 4G2AA 3P4WA 5LMNT 2WMNA 3MKDA 3HKCE 3ZDGA 5LXBA 4ILCA 4GYRA 3ZT7A 2MOZA 3OYXA 2Q9QB 5JDGA 5EK2A 2ACZA 5HCMA 2V5DA 3N2OA 2XSBA 3DJBA 4OK0A 3H3MA 4AKIA 5JR9C 1HG2A 2V6XA 1XMQT 4I4TE 2BS4A 1WLXA 5LNKA 3F31A 4HWFA 4JYAT 4UY2A 3RQWA 2XQ8A 4ASKA 4LMKA 2DLRA 2W4XA 1J5ET 4HWCA 5F8PA 3IEEA 5AFMB 4YTMA 4DBRA 4HWHA 1N34T 4QX8B 3ZSSA 4H9RC 4GOUA 4WV9A 1YQ4A 3PUYF 3RKGA 2IUBA 5HXRA 3PUXF 5BR8T 2V5CA 3UUMA 4LFBT 1R8IA 2ZM2A 4L9IA 4FRRA 4UF0B 4YJ2E 2MBGA 3K8PC 3M65A 3VU7H 2W8FA 2LE8A 4LFAT 4K0KT 1O3XA 5LGUB 2BVLA 5LGNB 3SOLA 2CM0A 3TLWA 2E5LT 3WTIA 1BR2A 3OVUA 3JCFA 3N9PA 2YDRA 4B3ST 1XZYA 3HKBE 2LKHA 3RI5A 3QB5A 4KP3C 5FJVA 3HA4A 4IHJE 4DR6T 1T72A 1Y01A 2VVSA 3Q9DA 3LJCA 3AAIA 2XM1A 4DMWA 2DWGA 2Q9QC 2UXXB 4BJNA 3B5MA 3I0QA 4U3CA 3GWHA 3P50A 3DTOA 5JDMA 5L47A 3WTHA 2WNLA 2ODUA 3K3OA 4H9QC 5LYJE 3LBXB 4AQYT 3UQ7A 1YKEB 3AE4A 4YSZA 1J5WA 1CHUA 1MNEA 3FXDB 5AFHA 4XK9A 4WW0A 2CXFA 3WTNA 2XTLA 5AQOB 4O4LE 5ABHA 2BYSA 4X64T 4A97A 5BMVE 4QWNB 1XDOA 3JAEA 1OEDA 5FVKA 2WCAA 2JRKA 3NRXA 5CB4E 3CX6B 2BKNA 1W0BA 4DV5T 3FZMB 3RIFA 3TLUA 4NZBA 2WMOA 2F4VT 4NXNT 1UX2A 3ZCIA 4K0UA 4OYJA 3LDQB 4TN7B 2V7JA 4YJ3E 1IZNB 2QRXA 2XAJB 5TAOA 4WBNE 4MHCA 1J1JA 2KNDA 4QH5A 2K48A 3AVSA 2M6IA 1YW0A 2WDRA 3PU8A 1XDPA 4DV3T 1FMVA 2EHOB 5LJNA 1LVFA 5HXCA 3EHZA 4H9OC 2XYSA 4A56A 3UU3A 4B3RT 3H3AA 2VL8A 4PJJA 3QNUA 1N32T 4JI7T 2JQHA 3K3QC 2XPKA 4H63H 3TLVA 4NXMT 3FZHB 5JDQA 3RGLA 3SFDA 5HEOA 3OYZA 4CQIA 1LRZA 4ILAA 3C51A 4CI3B 3Q5WA 5M4YA 2VQFT 5AINA 2KMFA 2A72A 3SWHA 4AKHA 1HG5A 4JBWF 2J47A 4LF9T 3EI0A 5LHIB 4KX6A 5HYAA 3S4UA 4IIJE 4AQGA 1U4QA 4M1PA 1G73A 2JQ9A 1WYCA 5SYOA 4AIUA 4NUVA 2VL0A 3OKQA 1E7PA 5HEJA 3IHRA 1KNRA 5LMUT 3V5UA 4E7ZA 5HWXA 5J5IA 2HN1A 4HEAA 1HX8A 5JTGA 2D0UA 3AEGA 3O4XE 3P7IA 2ACXA 4UXUA 2V26A 1HX1B 2K9AA 2EHOC 4EAHA 4QXCB 5AQFB 3NKZA 3SS1A 4B5DA 2LSYA 4EZ1A 1XWMA 3RYIE 2KINB 4P09A 1NEKA 4JEUB 2BKPA 2X00A 5AQJB 2H3RA 5L3DB 4EYYR 2IHR1 4HTEA 5AQVB 4QH4A 4X1KE 2BJ0A 5AQLB 2X00D 2MTQA 4EV6A 3KV9A 2DNXA 1SHZC 3AVRA 2UXDT 2K3WA 2X68A 4AQFA 4ZEYA 3TLTA 2LSJA 4UM3P 2HN2A 4JEHB 5L3BB 4PAGA 4U74A 3LSVA 2CA5A 1BR4A 3MACA 3L8RA 3AE1A 4O2AE 2C5KT 3RH3A 5E0OA 3HL6A 1NAFA 3N9NA 5L3EB 2BYRA 2D0TA 1MIWA 4B3MT 1E2AA 5AQUB 4V1Av 1B7TA 4CN1A 3ZLIA 1BR1A 4QKNA 2WDVA 5KDMC 3CKDA 3BQIA 2H7OA 3ABVA 3AEAA 2L3LA 4NIQA 1LVKA 3ZYLA 4HFEA 5JDFA 2LOSA 3E0ZA 3N9LA 2XNTA 1I6ZA 2WDQA 3UUBA 3VHLA 3AE7A 4JI6T 2VASA 5IWAT 2ZJVA 2WY2A 3UU5A 3D0TA 1UUSA 3T1HT 3J9X1 4EIWA 3TKLB 4DR7T 4LF5T 1LKXA 2X9YA 4TNVA 5ABEA 1ZOYA 3G06A 4HWIB 2VKDA 3ZT5A 3ZN0B 3J7Yq 3AE2A 4BFQA 3FB2A 2LEHA 3FZLB 1ZHCA 4ZI7E 1XMOT 4QABA 3U8KA 4DVDA 4ILBA 2W00A 2WZHA 4UVCB 2X0LB 5FMNA 5ETWA 3ZYKA 3UT5E 1YKHB 4JI5T 3FXEB 1WRDA 1IBLT 5BRXA 3ANWB 5BP0A 3RYCE 3RIUA 2V7LA 4B3TT 3ZN1B 2XQ9A 1MIYA 3KBTA 4IE6A 2WNJA 4UV8B 2W0GA 1L0VA 4IGUA 2ODVA 1KF6A 4UR9A 2BZBA 2WU5A 5AQGB 2LHNA 4JI3T 2UZ6A 4UXNB 4U2ZA 4UVAB 5FXWA 3AAAB 2JQQA 4O4IE 4IREA 1GQEA 3N9QA 2XNUA 3GN5A 4U7YA 5CJ5A 2NTXA 3PV0F 5J2TE 4AFHA 3CVRA 4MLKA 4QACA 4PJMA 3UU4A 3PURA 4Z90A 3O1JA 3ONLC 3JC6C 4DBQA 5C2TA 3ZMTB 2WBLA 4AFTA 4Z8XA 3UUXB 3KV4A 3ZPOA 3ZEFB 2WS3A 1MIVA 2IC6A 4IE4A 4ZZBA 4BAYB 5L3FB 4MALA 2Z6EA 5AQPB 2EHOD 3AXJB 4A5XA 1FJGT 2IW5B 3U8LA 4MBQA 2X66A 3PUGA 3MK7C 4ZI3C 2X67A 3KFWX 4C90A 5HEUA 3ZT6A 2B76A 2V7IA 3PUAA 5J1GA 3ZC0A 2YMDA 1IAPA 4QHOA 3VKGA 2BBHA 3PU3A 1MMGA 1D0XA 1Y64B 4GK0E 2PH9A 1SE7A 4DV0T 5DQVA 4HKAA 3NZPA 2WSSV 3UFEA 4PNIA 5CFBA 5FY0A 3PE0A 4GK5E 2E9XB 1FMWA 5ABFB 2WWVA 5BW2A 2LRKA 4NPPA 5FY7A 4DR2T 3RYHE 5FKYA 3CK6A 1T8BA 2PBIA 4X5TA 2W61A 4YTNA 2CEAA 2YU1A 3GUAA 2D2SA 4IL4A 2XUEA 2Y8DA 3TLSA 5L4EA 2QVAA 4UM1A 5L3CB 1N36T 2CLYB 3B13A 1T98A 3VR8A 2WAUA 3K3NA 2NW9A 2XQ3A 2LSKA 3N2GE 2WM9A 4X65T 1KNZA 4C91A 4GIWA 2AE9A 1MMDA 2J62A 3ZMUB 2YU2A 2KWIB 3SFEA 4H9PC 5HEHA 3B57A 3HKEE 5FXZA 2Y54A 2BYNA 5IHYA 5EZYE 3WTMA 5JQGE 2BG9B 2RA1A 2D9DA 5JH7E 4QX7B 1VCSA 5AQNB 4X1IE 2YMEA 3RRWA 4H63V 5J2UE 3ZMVB 5AFUL 2FBWA 2CWOA 4DNDA 2LRLA 2CBJA 3PJAA 4QH1A 4DV2T 5FXVA 4ZRUA 2WZIA 3PUWF 3ZMZB 2L9QA 5ABGA 5KX5E 2B1EA 2WP9A 4KUMB 1I94T 3C4ZA 4MFRA 3AAEB 2ZMAA 3WIPA 4ERRA 1YXRA 3A7MA 2CLYC 2W67A 3PTRB 2XAQB 2XZ5A 4I55E 1YD8G 4TZ4C 3T8OA 3UFGA 4XBFB 3LG7A 4HFHA 3WTKA 2N9DA 5JR9A 3RPUA 4U31A 2UXCT 4U7IA 3L3PA 4JLEA 2BG9C 1VOMA 2WWUA 4AISA 3RX6A 4NUUA 5JRCB 1IJ5A 2NW7A 3JC6D 3VRBA 4ZR6A 4COFA 3WTJA 5HXSA 4X20E 1X9BA 3I9YA 5FXXA 2JMKA 3OJAA 3SH1A 4ADZA 2RP4A 2CRBA 1MMNA 4EEDA 3KVBA 2JJ9A 1KEYA 5ADXL 2PJQA 4UIGA 3AE6A 5GONE 1UCUA 4PJLA 4ZI3D 2NP9A 2XQ5A 4AKGA 3CMLA 4X66T 5LBMA 2GK9A 2LOPA 2DL1A 3SIOA 5JDNA 5F5WA 5F3JA 3CX7B 3AA0B 2E2AA 2LM9A 2W2UA 4L5GA 3NBXX 2ZLYA 4P0AA 5LHHB 3AE8A 5AFNA 3NWIA 3CPZA 4DV7T 4EOZB 2M67A 4EEBA 4LF6T 5FY1A 4HFCA 2Q9QA 4PK6A 5LXTE 4D01A 4YTPA 2UXNB 4BA9A 1IBKT 3ZMSB 3LK2B 2L8KA 3QOFA 3C50A 4CXXA 1KNPA 2BKOA 1MNDA 3ZJ2A 4XZCA 2Q9QD 1I9BA 2IAKA 2BBJA 1HCIA 2ZM8A 2X9WA 1T7SA 2Y58A 3RF1A 5AFMA 1OEDB 2CXLA 4HFBA 3NVOA 4IDQA 4X62T 4EXTA 3UU6A 4CN6A 2V1DB 4UM3S 3KV5A 3EDUA 4JV5T 1N33T 4O8SA 2HPJA 2NWBA 1EZ3A 3UTKA 3E22E 3ZKRA 4HQPA 2DCFA 4QAAA 2V7KA 3T4MA 3NRYA 4AI6A 3CQCB 3IGQA 2VWAA 2KXPB 2A3DA 4UF0A 1M7KA 4DMVA 4UELA 3MA9A 4ZXLA 5HWYA 2OLTA 4ANJA 1UURA 3RKOA 4TUYE 5AQIB 4CI1B 2BVMA 5HXHA 2J1DG 2W62A 2WN9A 1ZP0A 4UVBB 4BQTA 2QGSA 1D1CA 4P0BA 2CCQA 3RHWA 4YFSA 4GKKT 3P4PA 2IIUA 4UV9B 5J5FA 2RPAA 3EAMA 1HS7A 2M6BA 5AQHB 4I0UA 3QUJA 2BG9E 2WU2A 5L4HA 3AB3B 3Q2MA 4TWHA 5AQMB 1UW6A 2KWHA 4X1YE 3PDYA 3PEOA 3V5SA 1UX4A 4IT4A
chains in the Genus database with same CATH topology
5HEJA 3U8MA 2Y54A 5TVCA 2LM2A 2BYNA 2YMDA 1I9BA 2BG9C 3WTMA 4IL9A 4DBMA 5BRXA 2BG9B 5IUXA 5BP0A 2KSRA 4QH5A 5J5IA 2LKHA 3RI5A 3RIAA 1OEDC 2YMEA 2Y58A 5AFMA 5FJVA 1OEDB 5AFKA 2XQ9A 5JMEA 4HFBA 3P4WA 3U8JA 4ZR6A 4COFA 3SQ9A 3WTJA 3WTOA 3UU6A 2M6IA 2PH9A 5CO5A 3ZDGA 4UM3S 2WNJA 5LXBA 4ILCA 4HFIA 5LG3A 2W8GA 4UXUA 2XZ6A 2WNCA 5KE4A 4LMLA 2QC1B 2PGZA 1UV6A 3SH1A 4QH1A 5HCMA 4F8HA 3ZKRA 2UZ6A 4HQPA 2WZYA 3JADA 2Y7YA 4QAAA 3T4MA 4ZRUA 3EHZA 3P50A 2LLYA 5L47A 5CFBA 4HFDA 3UU3A 2XYSA 3IGQA 4IREA 3ZDHA 3WTHA 5J5GA 4ZK1A 4B5DA 2WNLA 4UM3A 3UQ4A 2XNUA 4EZ1A 4HFEA 5BW2A 3UU8A 5J0ZA 4UY2A 3RQWA 2XQ8A 4ZJSA 4LMKA 2XNTA 2C9TA 4AFHA 4QACA 2XQAA 4NPPA 3UQ7A 4Z91A 2BR8A 2X00A 3TLVA 3UUBA 5J5HA 2XQ5A 4ZJTA 3UU4A 5AFMB 2BYPA 2ZJVA 5AFHA 4XK9A 4Z90A 2XQ4A 3JAFA 3UU5A 2WN9A 2YOEA 3WTNA 5KZUA 4X5TA 5HEOA 2BR7A 3SIOA 3SQ6A 3PMZA 4QH4A 4ILAA 4AFTA 4BQTA 2BYSA 2BJ0A 3GUAA 5AFLA 3RHWA 4TWDA 4A97A 4IL4A 4LMJA 4A98A 3U8NA 2ZJUA 2XQ6A 3TLSA 2X00D 5AFJA 3WIPA 4ZK4A 2BG9A 4WV9A 5AINA 5L4EA 4UM1A 2XQ7A 3JAEA 4TNVA 4AFGA 4ALXA 3RQUA 5J5FA 5AFNA 1OEDA 3EAMA 5HCJA 2M6BA 2YKSA 2XZ5A 2YN6A 4ZZBA 3WTLA 4ZZCA 3TLTA 4FRRA 2MAWA 2XQ3A 3EI0A 4UM3P 4BFQA 4TWFA 2BG9E 5L4HA 3C84A 2W8FA 4HFCA 2BYQA 3RIFA 3TLUA 4NZBA 3U8LA 1OEDE 4TWHA 1UX2A 2Y57A 3C79A 4D01A 2LKGA 3LSVA 4TNWA 2XYTA 2Y56A 1UW6A 4QABA 4PIRA 5HEGA 4HFHA 3U8KA 3WTKA 3PEOA 4ILBA 4XHEA 5SYOA 5HEHA 3TLWA 2XNVA 2VL0A 2BYRA 5HEUA 3WTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEJ A;  3U8M A;  2Y54 A;  5TVC A;  2LM2 A;  2BYN A;  2YMD A;  1I9B A;  2BG9 C;  3WTM A;  4IL9 A;  4DBM A;  5BRX A;  2BG9 B;  5IUX A;  5BP0 A;  2KSR A;  4QH5 A;  5J5I A;  2LKH A;  3RI5 A;  3RIA A;  1OED C;  2YME A;  2Y58 A;  5AFM A;  5FJV A;  1OED B;  5AFK A;  2XQ9 A;  5JME A;  4HFB A;  3P4W A;  3U8J A;  4ZR6 A;  4COF A;  3SQ9 A;  3WTJ A;  3WTO A;  3UU6 A;  2M6I A;  2PH9 A;  5CO5 A;  3ZDG A;  4UM3 S;  2WNJ A;  5LXB A;  4ILC A;  4HFI A;  5LG3 A;  2W8G A;  4UXU A;  2XZ6 A;  2WNC A;  5KE4 A;  4LML A;  2QC1 B;  2PGZ A;  1UV6 A;  3SH1 A;  4QH1 A;  5HCM A;  4F8H A;  3ZKR A;  2UZ6 A;  4HQP A;  2WZY A;  3JAD A;  2Y7Y A;  4QAA A;  3T4M A;  4ZRU A;  3EHZ A;  3P50 A;  2LLY A;  5L47 A;  5CFB A;  4HFD A;  3UU3 A;  2XYS A;  3IGQ A;  4IRE A;  3ZDH A;  3WTH A;  5J5G A;  4ZK1 A;  4B5D A;  2WNL A;  4UM3 A;  3UQ4 A;  2XNU A;  4EZ1 A;  4HFE A;  5BW2 A;  3UU8 A;  5J0Z A;  4UY2 A;  3RQW A;  2XQ8 A;  4ZJS A;  4LMK A;  2XNT A;  2C9T A;  4AFH A;  4QAC A;  2XQA A;  4NPP A;  3UQ7 A;  4Z91 A;  2BR8 A;  2X00 A;  3TLV A;  3UUB A;  5J5H A;  2XQ5 A;  4ZJT A;  3UU4 A;  5AFM B;  2BYP A;  2ZJV A;  5AFH A;  4XK9 A;  4Z90 A;  2XQ4 A;  3JAF A;  3UU5 A;  2WN9 A;  2YOE A;  3WTN A;  5KZU A;  4X5T A;  5HEO A;  2BR7 A;  3SIO A;  3SQ6 A;  3PMZ A;  4QH4 A;  4ILA A;  4AFT A;  4BQT A;  2BYS A;  2BJ0 A;  3GUA A;  5AFL A;  3RHW A;  4TWD A;  4A97 A;  4IL4 A;  4LMJ A;  4A98 A;  3U8N A;  2ZJU A;  2XQ6 A;  3TLS A;  2X00 D;  5AFJ A;  3WIP A;  4ZK4 A;  2BG9 A;  4WV9 A;  5AIN A;  5L4E A;  4UM1 A;  2XQ7 A;  3JAE A;  4TNV A;  4AFG A;  4ALX A;  3RQU A;  5J5F A;  5AFN A;  1OED A;  3EAM A;  5HCJ A;  2M6B A;  2YKS A;  2XZ5 A;  2YN6 A;  4ZZB A;  3WTL A;  4ZZC A;  3TLT A;  4FRR A;  2MAW A;  2XQ3 A;  3EI0 A;  4UM3 P;  4BFQ A;  4TWF A;  2BG9 E;  5L4H A;  3C84 A;  2W8F A;  4HFC A;  2BYQ A;  3RIF A;  3TLU A;  4NZB A;  3U8L A;  1OED E;  4TWH A;  1UX2 A;  2Y57 A;  3C79 A;  4D01 A;  2LKG A;  3LSV A;  4TNW A;  2XYT A;  2Y56 A;  1UW6 A;  4QAB A;  4PIR A;  5HEG A;  4HFH A;  3U8K A;  3WTK A;  3PEO A;  4ILB A;  4XHE A;  5SYO A;  5HEH A;  3TLW A;  2XNV A;  2VL0 A;  2BYR A;  5HEU A;  3WTI A; 
#chains in the Genus database with same CATH topology
 3U8M A;  2A2F X;  3I0O A;  3LBX A;  4LFC T;  1E1H B;  4L0R A;  5H6R B;  1NEN A;  1OED C;  2I6H A;  4EZ4 A;  2I0M A;  4DR4 T;  4O4H E;  3MJX A;  4PFP A;  2VKH A;  4EYU A;  5EK4 A;  5LG3 A;  3PUV F;  5KE4 A;  3UUN A;  3UUL A;  2FUP A;  2YK0 A;  2V6Y B;  2HH7 A;  2PFV A;  4ZOL E;  3ZDH A;  3EAB A;  3P4Q A;  1ZEE A;  3Q5D A;  4IDO A;  2G0U A;  1DU2 A;  2DWK A;  4U2Y A;  3O1H A;  5J5H A;  1ZV4 X;  2ZM6 T;  4JI4 T;  2XQ4 A;  4EZH A;  3AE3 A;  3JAF A;  4U33 A;  4O4J E;  4YY3 T;  1US7 B;  2HPL A;  4TWD A;  4YHJ A;  5LGT B;  2FJD A;  4PK5 A;  4YSX A;  3AE9 A;  4JI0 T;  2QYW A;  5FNV E;  4EGW A;  2QA7 A;  2YKS A;  2YN6 A;  1S94 A;  3FBL A;  3WTL A;  4ZZC A;  3ZC1 A;  3I1A A;  4JUY A;  3HKD E;  3C79 A;  1G8X A;  3BQK A;  2EHO A;  2LKG A;  4TNW A;  2XYT A;  2Y56 A;  5A1L A;  5HEG A;  2XZE A;  3ETU A;  5HAX A;  2XJ7 A;  2K5B B;  4ZI2 C;  2XY8 B;  2FJE A;  2BS3 A;  3RIA A;  3N9O A;  4O2B E;  3FBZ A;  2Y6X A;  3RC3 A;  3F2E A;  4CXW A;  3Q5X A;  2CMR A;  4N78 D;  4OYK A;  1W09 A;  2XAG B;  3H37 A;  2WNC A;  4H9N C;  2V8S V;  1WR0 A;  4HFV A;  1D0Z A;  2NOX A;  2VB6 A;  2YIN A;  3VKH A;  3LK3 B;  3M3Z B;  2H7V C;  4KMC A;  2LLY A;  1FIO A;  3QC9 A;  5DJQ C;  2BDE A;  5J5G A;  3UQ4 A;  2X0Y A;  2OA5 A;  5JRC A;  2C9T A;  3AA1 B;  4IE0 A;  2XSA A;  4YHH T;  2XQY A;  4ZJT A;  4GYS A;  3LFM A;  2WQY A;  3BK9 A;  3ETV A;  3WI3 A;  3EVY A;  5CGM A;  3RC8 A;  3CWZ B;  2VKO A;  2XQ6 A;  5AFJ A;  4AXP A;  3LK4 2;  2CBI A;  3QK6 A;  4JI1 T;  3OTO T;  2CE7 A;  5HCJ A;  4AKL A;  2UU9 T;  2MPK A;  4HWD A;  4ZS3 A;  2MAW A;  2IML A;  4TWF A;  1HNZ T;  2X9H A;  1VCT A;  2BYQ A;  1UX5 A;  1ZKE A;  4YT0 A;  1OED E;  3RYF E;  4YXD A;  1MMA A;  3P8C D;  5L2L A;  3IBP A;  1CUN A;  4ZHQ E;  3R84 B;  4PK4 A;  1D0Y A;  2FJB A;  2PTF A;  4FJO A;  1HF8 A;  1XNQ T;  1WFD A;  2P9B A;  4KHZ F;  2VUR A;  1IBM T;  3CX8 B;  3WAJ A;  4AQF C;  2LT3 A;  1OXZ A;  3WTO A;  3C4X A;  2DI4 A;  4DR5 T;  1Z8U A;  2LSG A;  3OBV E;  5KMG P;  1UV6 A;  2JMH A;  5AQQ B;  3BQL A;  4TX5 A;  3C98 B;  2W66 A;  3CQG B;  5AQK B;  4H9S E;  3W15 B;  3N5L A;  4J2C A;  3VRA A;  4LF4 T;  2XQA A;  2NW8 A;  4HN9 A;  3ZYM A;  2IC9 A;  4KHP T;  1H7C A;  1QUU A;  1UGO A;  5KZU A;  4PFO A;  4OX9 T;  2UUC T;  3AEE A;  4KBM B;  2E9X C;  4DUZ T;  5LG4 A;  4GKJ T;  3ZJ1 A;  3KDS E;  4OHF A;  2W63 A;  4DO0 A;  3KBU A;  2VQE T;  4ZK4 A;  3AEC A;  4AFG A;  3RQU A;  4UEM A;  1SA0 E;  2K24 A;  1S35 A;  5FL0 A;  2X51 A;  2XHE B;  4DR1 T;  2D5U A;  4DUY T;  1JNR A;  2X9X A;  3GN5 B;  3IA3 A;  3MXZ A;  3FZF B;  5C8Y E;  3U3I A;  2I59 A;  4PIR A;  1IJ6 A;  4XHE A;  4IE7 A;  3PUQ A;  4EB6 E;  4P1N A;  2J4G A;  3EUH A;  3PUZ F;  4CI2 B;  4I43 B;  4DR3 T;  1U5P A;  2KT9 A;  4LF8 T;  1X79 A;  5AFK A;  2E5V A;  3U8J A;  2JQK A;  4WYV A;  3SQ9 A;  2XAF B;  4DV6 T;  2VVN A;  4LML A;  4CZZ B;  2CHN A;  4DV1 T;  2QC1 B;  3WAK A;  4F8H A;  2WZY A;  2C0S A;  4FI5 A;  2R6G F;  3FZK B;  2ZM0 A;  1HR0 T;  3U78 A;  4PJN A;  1FEW A;  2ES0 A;  2A9U A;  1M62 A;  1Z0P A;  3RIU C;  2Y48 B;  3DP7 A;  3RRC A;  2SPC A;  4DV4 T;  3KVA A;  3VR9 A;  4YLH A;  5CA1 E;  3AEF A;  2NR4 A;  1AJ3 A;  4TV9 E;  2YDS A;  2N1G A;  4HE8 A;  4QXH B;  4ZI2 D;  3SQ6 A;  1W0A A;  1UK5 A;  4Q25 A;  4LMJ A;  3ANW A;  2V6Y A;  2CWY A;  5JDH A;  5H6Q B;  5LP6 E;  3C84 A;  5AQT B;  5LB7 B;  3KV6 A;  5LBQ B;  2Y57 A;  2VK9 A;  5LCY A;  3ZCJ A;  5JRE A;  1YQ3 A;  2C5I T;  3N2K E;  3N9M A;  2HHH T;  4IDP A;  3ONX A;  4TV8 E;  5AQS B;  2E8I A;  3A5X A;  3HI2 A;  5CA0 E;  4IL9 A;  2YEV C;  5IUX A;  2KSR A;  2KLQ A;  5FL1 A;  3ONJ A;  3PJA J;  5JME A;  4HGA A;  3IF8 B;  5IYZ E;  5EK3 A;  5CO5 A;  4U72 A;  4HFI A;  1KK7 A;  1V9D A;  4IE5 A;  1HNX T;  4LF7 T;  3JAD A;  2Y7Y A;  4E7S A;  2H88 A;  3AED A;  3R6N A;  4IDZ A;  5LOV E;  2XAS B;  2PG8 A;  2V7M A;  3K1S A;  4ISS A;  4PW8 A;  4ZK1 A;  4DID B;  3UU8 A;  3AXJ A;  4ZJS A;  4WBO A;  3T1Y T;  3A8Y C;  4Z91 A;  3EDV A;  3I9W A;  2JPF A;  4JI8 T;  2BYP A;  4ZS2 A;  2MYS A;  1JNZ A;  2VKJ A;  3PMZ A;  3OPC A;  3L39 A;  5AFL A;  1KFY A;  2H89 A;  3GA8 A;  3AE5 A;  3P4S A;  4A98 A;  2C5J A;  2CXD A;  1WCR A;  2YDQ A;  3F57 A;  3GMI A;  3X1D A;  5FP3 A;  3FHN A;  5FVL A;  1HFA A;  4ILU A;  2LJL A;  3ESL A;  3Q5E A;  4IDN A;  3C4W A;  3O9X A;  4G63 A;  2X0H A;  4XAX B;  3AA7 B;  4JI2 T;  2E9X A;  5ABF A;  3E08 A;  2NTY A;  5TVC A;  2LM2 A;  4DBM A;  3C64 A;  4I50 E;  1OWA A;  2CPT A;  5KXJ A;  1QLB A;  4WNK A;  4IST A;  2E9X D;  2W8G A;  2XZ6 A;  1WYB A;  2IDO B;  4AKR B;  4KI0 F;  5AQR B;  2PGZ A;  2UUA T;  2UUB T;  2N2N A;  3RLF F;  1NWM X;  4HFD A;  5JR9 B;  4QXB B;  1HTJ F;  4OFZ A;  1BR0 A;  4UM3 A;  3AEB A;  5J0Z A;  2BR8 A;  2BS2 A;  2JIW A;  2WB5 A;  5LJM A;  4CN4 A;  3QB5 K;  2DHR A;  5DAB A;  3PUS A;  4CXY A;  2YOE A;  2BR7 A;  2LHR A;  5LA6 E;  4YSY A;  1D1B A;  3MZK B;  3CIR A;  1QSD A;  2AXD S;  5HXE A;  3HR0 A;  5C3J A;  5JDL A;  3U8N A;  2XM2 A;  2ZJU A;  3P4R A;  1XNR T;  2BG9 A;  1WR6 A;  2XQ7 A;  4ALX A;  5JVD E;  3CQX C;  3SRZ A;  2OV9 A;  2XAH B;  2CHO A;  5FYM A;  4BJM A;  2KZ7 B;  1VRB A;  5L3G B;  4F6R C;  1HNW T;  1D1A A;  5LHG B;  2XNV A;  1W9R A;  5DQW A;  3O1I A;  4B6X A;  3NZQ A;  1SUM B;  3ZST A;  2LSI A;  3L09 A;  3KIN B;  2UXB T;  3AA6 B;  2FJA A;  4WZX A;  4G2A A;  3P4W A;  5LMN T;  2WMN A;  3MKD A;  3HKC E;  3ZDG A;  5LXB A;  4ILC A;  4GYR A;  3ZT7 A;  2MOZ A;  3OYX A;  2Q9Q B;  5JDG A;  5EK2 A;  2ACZ A;  5HCM A;  2V5D A;  3N2O A;  2XSB A;  3DJB A;  4OK0 A;  3H3M A;  4AKI A;  5JR9 C;  1HG2 A;  2V6X A;  1XMQ T;  4I4T E;  2BS4 A;  1WLX A;  5LNK A;  3F31 A;  4HWF A;  4JYA T;  4UY2 A;  3RQW A;  2XQ8 A;  4ASK A;  4LMK A;  2DLR A;  2W4X A;  1J5E T;  4HWC A;  5F8P A;  3IEE A;  5AFM B;  4YTM A;  4DBR A;  4HWH A;  1N34 T;  4QX8 B;  3ZSS A;  4H9R C;  4GOU A;  4WV9 A;  1YQ4 A;  3PUY F;  3RKG A;  2IUB A;  5HXR A;  3PUX F;  5BR8 T;  2V5C A;  3UUM A;  4LFB T;  1R8I A;  2ZM2 A;  4L9I A;  4FRR A;  4UF0 B;  4YJ2 E;  2MBG A;  3K8P C;  3M65 A;  3VU7 H;  2W8F A;  2LE8 A;  4LFA T;  4K0K T;  1O3X A;  5LGU B;  2BVL A;  5LGN B;  3SOL A;  2CM0 A;  3TLW A;  2E5L T;  3WTI A;  1BR2 A;  3OVU A;  3JCF A;  3N9P A;  2YDR A;  4B3S T;  1XZY A;  3HKB E;  2LKH A;  3RI5 A;  3QB5 A;  4KP3 C;  5FJV A;  3HA4 A;  4IHJ E;  4DR6 T;  1T72 A;  1Y01 A;  2VVS A;  3Q9D A;  3LJC A;  3AAI A;  2XM1 A;  4DMW A;  2DWG A;  2Q9Q C;  2UXX B;  4BJN A;  3B5M A;  3I0Q A;  4U3C A;  3GWH A;  3P50 A;  3DTO A;  5JDM A;  5L47 A;  3WTH A;  2WNL A;  2ODU A;  3K3O A;  4H9Q C;  5LYJ E;  3LBX B;  4AQY T;  3UQ7 A;  1YKE B;  3AE4 A;  4YSZ A;  1J5W A;  1CHU A;  1MNE A;  3FXD B;  5AFH A;  4XK9 A;  4WW0 A;  2CXF A;  3WTN A;  2XTL A;  5AQO B;  4O4L E;  5ABH A;  2BYS A;  4X64 T;  4A97 A;  5BMV E;  4QWN B;  1XDO A;  3JAE A;  1OED A;  5FVK A;  2WCA A;  2JRK A;  3NRX A;  5CB4 E;  3CX6 B;  2BKN A;  1W0B A;  4DV5 T;  3FZM B;  3RIF A;  3TLU A;  4NZB A;  2WMO A;  2F4V T;  4NXN T;  1UX2 A;  3ZCI A;  4K0U A;  4OYJ A;  3LDQ B;  4TN7 B;  2V7J A;  4YJ3 E;  1IZN B;  2QRX A;  2XAJ B;  5TAO A;  4WBN E;  4MHC A;  1J1J A;  2KND A;  4QH5 A;  2K48 A;  3AVS A;  2M6I A;  1YW0 A;  2WDR A;  3PU8 A;  1XDP A;  4DV3 T;  1FMV A;  2EHO B;  5LJN A;  1LVF A;  5HXC A;  3EHZ A;  4H9O C;  2XYS A;  4A56 A;  3UU3 A;  4B3R T;  3H3A A;  2VL8 A;  4PJJ A;  3QNU A;  1N32 T;  4JI7 T;  2JQH A;  3K3Q C;  2XPK A;  4H63 H;  3TLV A;  4NXM T;  3FZH B;  5JDQ A;  3RGL A;  3SFD A;  5HEO A;  3OYZ A;  4CQI A;  1LRZ A;  4ILA A;  3C51 A;  4CI3 B;  3Q5W A;  5M4Y A;  2VQF T;  5AIN A;  2KMF A;  2A72 A;  3SWH A;  4AKH A;  1HG5 A;  4JBW F;  2J47 A;  4LF9 T;  3EI0 A;  5LHI B;  4KX6 A;  5HYA A;  3S4U A;  4IIJ E;  4AQG A;  1U4Q A;  4M1P A;  1G73 A;  2JQ9 A;  1WYC A;  5SYO A;  4AIU A;  4NUV A;  2VL0 A;  3OKQ A;  1E7P A;  5HEJ A;  3IHR A;  1KNR A;  5LMU T;  3V5U A;  4E7Z A;  5HWX A;  5J5I A;  2HN1 A;  4HEA A;  1HX8 A;  5JTG A;  2D0U A;  3AEG A;  3O4X E;  3P7I A;  2ACX A;  4UXU A;  2V26 A;  1HX1 B;  2K9A A;  2EHO C;  4EAH A;  4QXC B;  5AQF B;  3NKZ A;  3SS1 A;  4B5D A;  2LSY A;  4EZ1 A;  1XWM A;  3RYI E;  2KIN B;  4P09 A;  1NEK A;  4JEU B;  2BKP A;  2X00 A;  5AQJ B;  2H3R A;  5L3D B;  4EYY R;  2IHR 1;  4HTE A;  5AQV B;  4QH4 A;  4X1K E;  2BJ0 A;  5AQL B;  2X00 D;  2MTQ A;  4EV6 A;  3KV9 A;  2DNX A;  1SHZ C;  3AVR A;  2UXD T;  2K3W A;  2X68 A;  4AQF A;  4ZEY A;  3TLT A;  2LSJ A;  4UM3 P;  2HN2 A;  4JEH B;  5L3B B;  4PAG A;  4U74 A;  3LSV A;  2CA5 A;  1BR4 A;  3MAC A;  3L8R A;  3AE1 A;  4O2A E;  2C5K T;  3RH3 A;  5E0O A;  3HL6 A;  1NAF A;  3N9N A;  5L3E B;  2BYR A;  2D0T A;  1MIW A;  4B3M T;  1E2A A;  5AQU B;  4V1A v;  1B7T A;  4CN1 A;  3ZLI A;  1BR1 A;  4QKN A;  2WDV A;  5KDM C;  3CKD A;  3BQI A;  2H7O A;  3ABV A;  3AEA A;  2L3L A;  4NIQ A;  1LVK A;  3ZYL A;  4HFE A;  5JDF A;  2LOS A;  3E0Z A;  3N9L A;  2XNT A;  1I6Z A;  2WDQ A;  3UUB A;  3VHL A;  3AE7 A;  4JI6 T;  2VAS A;  5IWA T;  2ZJV A;  2WY2 A;  3UU5 A;  3D0T A;  1UUS A;  3T1H T;  3J9X 1;  4EIW A;  3TKL B;  4DR7 T;  4LF5 T;  1LKX A;  2X9Y A;  4TNV A;  5ABE A;  1ZOY A;  3G06 A;  4HWI B;  2VKD A;  3ZT5 A;  3ZN0 B;  3J7Y q;  3AE2 A;  4BFQ A;  3FB2 A;  2LEH A;  3FZL B;  1ZHC A;  4ZI7 E;  1XMO T;  4QAB A;  3U8K A;  4DVD A;  4ILB A;  2W00 A;  2WZH A;  4UVC B;  2X0L B;  5FMN A;  5ETW A;  3ZYK A;  3UT5 E;  1YKH B;  4JI5 T;  3FXE B;  1WRD A;  1IBL T;  5BRX A;  3ANW B;  5BP0 A;  3RYC E;  3RIU A;  2V7L A;  4B3T T;  3ZN1 B;  2XQ9 A;  1MIY A;  3KBT A;  4IE6 A;  2WNJ A;  4UV8 B;  2W0G A;  1L0V A;  4IGU A;  2ODV A;  1KF6 A;  4UR9 A;  2BZB A;  2WU5 A;  5AQG B;  2LHN A;  4JI3 T;  2UZ6 A;  4UXN B;  4U2Z A;  4UVA B;  5FXW A;  3AAA B;  2JQQ A;  4O4I E;  4IRE A;  1GQE A;  3N9Q A;  2XNU A;  3GN5 A;  4U7Y A;  5CJ5 A;  2NTX A;  3PV0 F;  5J2T E;  4AFH A;  3CVR A;  4MLK A;  4QAC A;  4PJM A;  3UU4 A;  3PUR A;  4Z90 A;  3O1J A;  3ONL C;  3JC6 C;  4DBQ A;  5C2T A;  3ZMT B;  2WBL A;  4AFT A;  4Z8X A;  3UUX B;  3KV4 A;  3ZPO A;  3ZEF B;  2WS3 A;  1MIV A;  2IC6 A;  4IE4 A;  4ZZB A;  4BAY B;  5L3F B;  4MAL A;  2Z6E A;  5AQP B;  2EHO D;  3AXJ B;  4A5X A;  1FJG T;  2IW5 B;  3U8L A;  4MBQ A;  2X66 A;  3PUG A;  3MK7 C;  4ZI3 C;  2X67 A;  3KFW X;  4C90 A;  5HEU A;  3ZT6 A;  2B76 A;  2V7I A;  3PUA A;  5J1G A;  3ZC0 A;  2YMD A;  1IAP A;  4QHO A;  3VKG A;  2BBH A;  3PU3 A;  1MMG A;  1D0X A;  1Y64 B;  4GK0 E;  2PH9 A;  1SE7 A;  4DV0 T;  5DQV A;  4HKA A;  3NZP A;  2WSS V;  3UFE A;  4PNI A;  5CFB A;  5FY0 A;  3PE0 A;  4GK5 E;  2E9X B;  1FMW A;  5ABF B;  2WWV A;  5BW2 A;  2LRK A;  4NPP A;  5FY7 A;  4DR2 T;  3RYH E;  5FKY A;  3CK6 A;  1T8B A;  2PBI A;  4X5T A;  2W61 A;  4YTN A;  2CEA A;  2YU1 A;  3GUA A;  2D2S A;  4IL4 A;  2XUE A;  2Y8D A;  3TLS A;  5L4E A;  2QVA A;  4UM1 A;  5L3C B;  1N36 T;  2CLY B;  3B13 A;  1T98 A;  3VR8 A;  2WAU A;  3K3N A;  2NW9 A;  2XQ3 A;  2LSK A;  3N2G E;  2WM9 A;  4X65 T;  1KNZ A;  4C91 A;  4GIW A;  2AE9 A;  1MMD A;  2J62 A;  3ZMU B;  2YU2 A;  2KWI B;  3SFE A;  4H9P C;  5HEH A;  3B57 A;  3HKE E;  5FXZ A;  2Y54 A;  2BYN A;  5IHY A;  5EZY E;  3WTM A;  5JQG E;  2BG9 B;  2RA1 A;  2D9D A;  5JH7 E;  4QX7 B;  1VCS A;  5AQN B;  4X1I E;  2YME A;  3RRW A;  4H63 V;  5J2U E;  3ZMV B;  5AFU L;  2FBW A;  2CWO A;  4DND A;  2LRL A;  2CBJ A;  3PJA A;  4QH1 A;  4DV2 T;  5FXV A;  4ZRU A;  2WZI A;  3PUW F;  3ZMZ B;  2L9Q A;  5ABG A;  5KX5 E;  2B1E A;  2WP9 A;  4KUM B;  1I94 T;  3C4Z A;  4MFR A;  3AAE B;  2ZMA A;  3WIP A;  4ERR A;  1YXR A;  3A7M A;  2CLY C;  2W67 A;  3PTR B;  2XAQ B;  2XZ5 A;  4I55 E;  1YD8 G;  4TZ4 C;  3T8O A;  3UFG A;  4XBF B;  3LG7 A;  4HFH A;  3WTK A;  2N9D A;  5JR9 A;  3RPU A;  4U31 A;  2UXC T;  4U7I A;  3L3P A;  4JLE A;  2BG9 C;  1VOM A;  2WWU A;  4AIS A;  3RX6 A;  4NUU A;  5JRC B;  1IJ5 A;  2NW7 A;  3JC6 D;  3VRB A;  4ZR6 A;  4COF A;  3WTJ A;  5HXS A;  4X20 E;  1X9B A;  3I9Y A;  5FXX A;  2JMK A;  3OJA A;  3SH1 A;  4ADZ A;  2RP4 A;  2CRB A;  1MMN A;  4EED A;  3KVB A;  2JJ9 A;  1KEY A;  5ADX L;  2PJQ A;  4UIG A;  3AE6 A;  5GON E;  1UCU A;  4PJL A;  4ZI3 D;  2NP9 A;  2XQ5 A;  4AKG A;  3CML A;  4X66 T;  5LBM A;  2GK9 A;  2LOP A;  2DL1 A;  3SIO A;  5JDN A;  5F5W A;  5F3J A;  3CX7 B;  3AA0 B;  2E2A A;  2LM9 A;  2W2U A;  4L5G A;  3NBX X;  2ZLY A;  4P0A A;  5LHH B;  3AE8 A;  5AFN A;  3NWI A;  3CPZ A;  4DV7 T;  4EOZ B;  2M67 A;  4EEB A;  4LF6 T;  5FY1 A;  4HFC A;  2Q9Q A;  4PK6 A;  5LXT E;  4D01 A;  4YTP A;  2UXN B;  4BA9 A;  1IBK T;  3ZMS B;  3LK2 B;  2L8K A;  3QOF A;  3C50 A;  4CXX A;  1KNP A;  2BKO A;  1MND A;  3ZJ2 A;  4XZC A;  2Q9Q D;  1I9B A;  2IAK A;  2BBJ A;  1HCI A;  2ZM8 A;  2X9W A;  1T7S A;  2Y58 A;  3RF1 A;  5AFM A;  1OED B;  2CXL A;  4HFB A;  3NVO A;  4IDQ A;  4X62 T;  4EXT A;  3UU6 A;  4CN6 A;  2V1D B;  4UM3 S;  3KV5 A;  3EDU A;  4JV5 T;  1N33 T;  4O8S A;  2HPJ A;  2NWB A;  1EZ3 A;  3UTK A;  3E22 E;  3ZKR A;  4HQP A;  2DCF A;  4QAA A;  2V7K A;  3T4M A;  3NRY A;  4AI6 A;  3CQC B;  3IGQ A;  2VWA A;  2KXP B;  2A3D A;  4UF0 A;  1M7K A;  4DMV A;  4UEL A;  3MA9 A;  4ZXL A;  5HWY A;  2OLT A;  4ANJ A;  1UUR A;  3RKO A;  4TUY E;  5AQI B;  4CI1 B;  2BVM A;  5HXH A;  2J1D G;  2W62 A;  2WN9 A;  1ZP0 A;  4UVB B;  4BQT A;  2QGS A;  1D1C A;  4P0B A;  2CCQ A;  3RHW A;  4YFS A;  4GKK T;  3P4P A;  2IIU A;  4UV9 B;  5J5F A;  2RPA A;  3EAM A;  1HS7 A;  2M6B A;  5AQH B;  4I0U A;  3QUJ A;  2BG9 E;  2WU2 A;  5L4H A;  3AB3 B;  3Q2M A;  4TWH A;  5AQM B;  1UW6 A;  2KWH A;  4X1Y E;  3PDY A;  3PEO A;  3V5S A;  1UX4 A;  4IT4 A; 
#chains in the Genus database with same CATH homology
 5HEJ A;  3U8M A;  2Y54 A;  5TVC A;  2LM2 A;  2BYN A;  2YMD A;  1I9B A;  2BG9 C;  3WTM A;  4IL9 A;  4DBM A;  5BRX A;  2BG9 B;  5IUX A;  5BP0 A;  2KSR A;  4QH5 A;  5J5I A;  2LKH A;  3RI5 A;  3RIA A;  1OED C;  2YME A;  2Y58 A;  5AFM A;  5FJV A;  1OED B;  5AFK A;  2XQ9 A;  5JME A;  4HFB A;  3P4W A;  3U8J A;  4ZR6 A;  4COF A;  3SQ9 A;  3WTJ A;  3WTO A;  3UU6 A;  2M6I A;  2PH9 A;  5CO5 A;  3ZDG A;  4UM3 S;  2WNJ A;  5LXB A;  4ILC A;  4HFI A;  5LG3 A;  2W8G A;  4UXU A;  2XZ6 A;  2WNC A;  5KE4 A;  4LML A;  2QC1 B;  2PGZ A;  1UV6 A;  3SH1 A;  4QH1 A;  5HCM A;  4F8H A;  3ZKR A;  2UZ6 A;  4HQP A;  2WZY A;  3JAD A;  2Y7Y A;  4QAA A;  3T4M A;  4ZRU A;  3EHZ A;  3P50 A;  2LLY A;  5L47 A;  5CFB A;  4HFD A;  3UU3 A;  2XYS A;  3IGQ A;  4IRE A;  3ZDH A;  3WTH A;  5J5G A;  4ZK1 A;  4B5D A;  2WNL A;  4UM3 A;  3UQ4 A;  2XNU A;  4EZ1 A;  4HFE A;  5BW2 A;  3UU8 A;  5J0Z A;  4UY2 A;  3RQW A;  2XQ8 A;  4ZJS A;  4LMK A;  2XNT A;  2C9T A;  4AFH A;  4QAC A;  2XQA A;  4NPP A;  3UQ7 A;  4Z91 A;  2BR8 A;  2X00 A;  3TLV A;  3UUB A;  5J5H A;  2XQ5 A;  4ZJT A;  3UU4 A;  5AFM B;  2BYP A;  2ZJV A;  5AFH A;  4XK9 A;  4Z90 A;  2XQ4 A;  3JAF A;  3UU5 A;  2WN9 A;  2YOE A;  3WTN A;  5KZU A;  4X5T A;  5HEO A;  2BR7 A;  3SIO A;  3SQ6 A;  3PMZ A;  4QH4 A;  4ILA A;  4AFT A;  4BQT A;  2BYS A;  2BJ0 A;  3GUA A;  5AFL A;  3RHW A;  4TWD A;  4A97 A;  4IL4 A;  4LMJ A;  4A98 A;  3U8N A;  2ZJU A;  2XQ6 A;  3TLS A;  2X00 D;  5AFJ A;  3WIP A;  4ZK4 A;  2BG9 A;  4WV9 A;  5AIN A;  5L4E A;  4UM1 A;  2XQ7 A;  3JAE A;  4TNV A;  4AFG A;  4ALX A;  3RQU A;  5J5F A;  5AFN A;  1OED A;  3EAM A;  5HCJ A;  2M6B A;  2YKS A;  2XZ5 A;  2YN6 A;  4ZZB A;  3WTL A;  4ZZC A;  3TLT A;  4FRR A;  2MAW A;  2XQ3 A;  3EI0 A;  4UM3 P;  4BFQ A;  4TWF A;  2BG9 E;  5L4H A;  3C84 A;  2W8F A;  4HFC A;  2BYQ A;  3RIF A;  3TLU A;  4NZB A;  3U8L A;  1OED E;  4TWH A;  1UX2 A;  2Y57 A;  3C79 A;  4D01 A;  2LKG A;  3LSV A;  4TNW A;  2XYT A;  2Y56 A;  1UW6 A;  4QAB A;  4PIR A;  5HEG A;  4HFH A;  3U8K A;  3WTK A;  3PEO A;  4ILB A;  4XHE A;  5SYO A;  5HEH A;  3TLW A;  2XNV A;  2VL0 A;  2BYR A;  5HEU A;  3WTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...