2WN9A

Crystal structure of aplysia achbp in complex with 4-0h-dmxba
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
209
structure length
209
Chain Sequence
LHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural determinants for interaction of partial agonists with acetylcholine binding protein and neuronal alpha7 nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 50
structure length 209
sequence length 209
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wn9A00
4AFHA 2Y58A 2YMDA 4Z91A 2XQAA 2WNCA 3ZKRA 3UQ7A 4ZJSA 4XHEA 2XQ6A 4AFTA 3P50A 1UW6A 5CO5A 3TLSA 5AFLA 4BQTA 4QABA 2XQ9A 5AINA 4HFHA 2X00D 3EAMA 3WTJA 4ZK1A 2XQ8A 3PMZA 4QAAA 5AFMA 1UX2A 4NPPA 4LMJA 4UM1A 2XZ5A 4FRRA 2WNJA 2BG9B 3WTNA 3T4MA 3C79A 2BJ0A 4BFQA 4TWFA 5AFJA 3U8KA 5BP0A 5JMEA 4A98A 2Y57A 4PIRA 4ZZBA 2BG9E 2XYTA 3PEOA 3RIFA 2XQ7A 5J5HA 4HFEA 4B5DA 2WZYA 4UXUA 4ZR6A 2ZJVA 3TLUA 5FJVA 5LG3A 3WTLA 2C9TA 2BYSA 3RQWA 4HQPA 5HEHA 4X5TA 1UV6A 4LMLA 3WTIA 5AFHA 3SQ9A 5HCJA 5BRXA 5IUXA 4UM3A 2QC1B 4DBMA 5SYOA 2BYPA 5HEUA 4WV9A 3RQUA 3UU4A 2YMEA 3IGQA 5CFBA 4TWDA 2W8FA 3JAEA 3RI5A 3TLVA 3U8NA 3UU5A 3RHWA 2PGZA 5AFMB 2Y54A 4ZRUA 4HFCA 4TNWA 2XZ6A 2BG9C 5KZUA 2XNTA 2XYSA 4TNVA 3UU8A 3TLWA 3LSVA 3UU3A 3WTHA 3EHZA 2W8GA 4IL9A 3SIOA 5AFKA 5BW2A 4ALXA 5L4HA 4F8HA 3JAFA 4AFGA 5HEJA 3WTOA 2WN9A 2VL0A 2YOEA 3WTKA 2UZ6A 3C84A 3UU6A 3JADA 2BYNA 3WIPA 3UUBA 4ZJTA 4ILCA 4ILBA 5J5FA 1I9BA 5AFNA 4QH1A 3SQ6A 5J5GA 3ZDGA 5L47A 2X00A 2BYQA 2XNVA 5L4EA 5J5IA 4LMKA 4NZBA 2XQ4A 4HFIA 4HFBA 4A97A 4D01A 3U8JA 2XNUA 2BYRA 3U8LA 4XK9A 4QH4A 4IREA 4ZK4A 3EI0A 5HEGA 3UQ4A 3P4WA 5TVCA 5J0ZA 2BG9A 2YKSA 2Y56A 3TLTA 5KE4A 2XQ3A 2Y7YA 2BR7A 4HFDA 5HEOA 4IL4A 2YN6A 2PH9A 4TWHA 2BR8A 4ZZCA 2WNLA 4QACA 2XQ5A 4UY2A 4ILAA 3GUAA 4Z90A 3U8MA 5LXBA 4UM3P 5HCMA 3SH1A 3ZDHA 3WTMA 4EZ1A 3RIAA 4QH5A 4COFA 2ZJUA 4UM3S
chains in the Genus database with same CATH superfamily
4AFHA 2Y58A 2YMDA 4Z91A 2XQAA 2WNCA 3ZKRA 3UQ7A 4ZJSA 4XHEA 2XQ6A 4AFTA 3P50A 1UW6A 5CO5A 3TLSA 5AFLA 4BQTA 4QABA 2XQ9A 5AINA 4HFHA 2X00D 3EAMA 3WTJA 4ZK1A 2XQ8A 3PMZA 4QAAA 5AFMA 1UX2A 4NPPA 4LMJA 4UM1A 2XZ5A 4FRRA 2WNJA 2BG9B 3WTNA 3T4MA 3C79A 2BJ0A 4BFQA 4TWFA 5AFJA 3U8KA 5BP0A 5JMEA 4A98A 2Y57A 4PIRA 4ZZBA 2BG9E 2XYTA 3PEOA 3RIFA 2XQ7A 5J5HA 4HFEA 4B5DA 2WZYA 4UXUA 4ZR6A 2ZJVA 3TLUA 5FJVA 5LG3A 3WTLA 2C9TA 2BYSA 3RQWA 4HQPA 5HEHA 4X5TA 1UV6A 4LMLA 3WTIA 5AFHA 3SQ9A 5HCJA 5BRXA 5IUXA 4UM3A 2QC1B 4DBMA 5SYOA 2BYPA 5HEUA 4WV9A 3RQUA 3UU4A 2YMEA 3IGQA 5CFBA 4TWDA 2W8FA 3JAEA 3RI5A 3TLVA 3U8NA 3UU5A 3RHWA 2PGZA 5AFMB 2Y54A 4ZRUA 4HFCA 4TNWA 2XZ6A 2BG9C 5KZUA 2XNTA 2XYSA 4TNVA 3UU8A 3TLWA 3LSVA 3UU3A 3WTHA 3EHZA 2W8GA 4IL9A 3SIOA 5AFKA 5BW2A 4ALXA 5L4HA 4F8HA 3JAFA 4AFGA 5HEJA 3WTOA 2WN9A 2VL0A 2YOEA 3WTKA 2UZ6A 3C84A 3UU6A 3JADA 2BYNA 3WIPA 3UUBA 4ZJTA 4ILCA 4ILBA 5J5FA 1I9BA 5AFNA 4QH1A 3SQ6A 5J5GA 3ZDGA 5L47A 2X00A 2BYQA 2XNVA 5L4EA 5J5IA 4LMKA 4NZBA 2XQ4A 4HFIA 4HFBA 4A97A 4D01A 3U8JA 2XNUA 2BYRA 3U8LA 4XK9A 4QH4A 4IREA 4ZK4A 3EI0A 5HEGA 3UQ4A 3P4WA 5TVCA 5J0ZA 2BG9A 2YKSA 2Y56A 3TLTA 5KE4A 2XQ3A 2Y7YA 2BR7A 4HFDA 5HEOA 4IL4A 2YN6A 2PH9A 4TWHA 2BR8A 4ZZCA 2WNLA 4QACA 2XQ5A 4UY2A 4ILAA 3GUAA 4Z90A 3U8MA 5LXBA 4UM3P 5HCMA 3SH1A 3ZDHA 3WTMA 4EZ1A 3RIAA 4QH5A 4COFA 2ZJUA 4UM3S
chains in the Genus database with same CATH topology
4AFHA 2Y58A 2YMDA 4Z91A 2XQAA 2WNCA 3ZKRA 3UQ7A 4ZJSA 4XHEA 2XQ6A 4AFTA 3P50A 1UW6A 5CO5A 3TLSA 5AFLA 4BQTA 4QABA 2XQ9A 5AINA 4HFHA 2X00D 3EAMA 3WTJA 4ZK1A 2XQ8A 3PMZA 4QAAA 5AFMA 1UX2A 4NPPA 4LMJA 4UM1A 2XZ5A 4FRRA 2WNJA 2BG9B 3WTNA 3T4MA 3C79A 2BJ0A 4BFQA 4TWFA 5AFJA 3U8KA 5BP0A 5JMEA 4A98A 2Y57A 4PIRA 4ZZBA 2BG9E 2XYTA 3PEOA 3RIFA 2XQ7A 5J5HA 4HFEA 4B5DA 2WZYA 4UXUA 4ZR6A 2ZJVA 3TLUA 5FJVA 5LG3A 3WTLA 2C9TA 2BYSA 3RQWA 4HQPA 5HEHA 4X5TA 1UV6A 4LMLA 3WTIA 5AFHA 3SQ9A 5HCJA 5BRXA 5IUXA 4UM3A 2QC1B 4DBMA 5SYOA 2BYPA 5HEUA 4WV9A 3RQUA 3UU4A 2YMEA 3IGQA 5CFBA 4TWDA 2W8FA 3JAEA 3RI5A 3TLVA 3U8NA 3UU5A 3RHWA 2PGZA 5AFMB 2Y54A 4ZRUA 4HFCA 4TNWA 2XZ6A 2BG9C 5KZUA 2XNTA 2XYSA 4TNVA 3UU8A 3TLWA 3LSVA 3UU3A 3WTHA 3EHZA 2W8GA 4IL9A 3SIOA 5AFKA 5BW2A 4ALXA 5L4HA 4F8HA 3JAFA 4AFGA 5HEJA 3WTOA 2WN9A 2VL0A 2YOEA 3WTKA 2UZ6A 3C84A 3UU6A 3JADA 2BYNA 3WIPA 3UUBA 4ZJTA 4ILCA 4ILBA 5J5FA 1I9BA 5AFNA 4QH1A 3SQ6A 5J5GA 3ZDGA 5L47A 2X00A 2BYQA 2XNVA 5L4EA 5J5IA 4LMKA 4NZBA 2XQ4A 4HFIA 4HFBA 4A97A 4D01A 3U8JA 2XNUA 2BYRA 3U8LA 4XK9A 4QH4A 4IREA 4ZK4A 3EI0A 5HEGA 3UQ4A 3P4WA 5TVCA 5J0ZA 2BG9A 2YKSA 2Y56A 3TLTA 5KE4A 2XQ3A 2Y7YA 2BR7A 4HFDA 5HEOA 4IL4A 2YN6A 2PH9A 4TWHA 2BR8A 4ZZCA 2WNLA 4QACA 2XQ5A 4UY2A 4ILAA 3GUAA 4Z90A 3U8MA 5LXBA 4UM3P 5HCMA 3SH1A 3ZDHA 3WTMA 4EZ1A 3RIAA 4QH5A 4COFA 2ZJUA 4UM3S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFH A;  2Y58 A;  2YMD A;  4Z91 A;  2XQA A;  2WNC A;  3ZKR A;  3UQ7 A;  4ZJS A;  4XHE A;  2XQ6 A;  4AFT A;  3P50 A;  1UW6 A;  5CO5 A;  3TLS A;  5AFL A;  4BQT A;  4QAB A;  2XQ9 A;  5AIN A;  4HFH A;  2X00 D;  3EAM A;  3WTJ A;  4ZK1 A;  2XQ8 A;  3PMZ A;  4QAA A;  5AFM A;  1UX2 A;  4NPP A;  4LMJ A;  4UM1 A;  2XZ5 A;  4FRR A;  2WNJ A;  2BG9 B;  3WTN A;  3T4M A;  3C79 A;  2BJ0 A;  4BFQ A;  4TWF A;  5AFJ A;  3U8K A;  5BP0 A;  5JME A;  4A98 A;  2Y57 A;  4PIR A;  4ZZB A;  2BG9 E;  2XYT A;  3PEO A;  3RIF A;  2XQ7 A;  5J5H A;  4HFE A;  4B5D A;  2WZY A;  4UXU A;  4ZR6 A;  2ZJV A;  3TLU A;  5FJV A;  5LG3 A;  3WTL A;  2C9T A;  2BYS A;  3RQW A;  4HQP A;  5HEH A;  4X5T A;  1UV6 A;  4LML A;  3WTI A;  5AFH A;  3SQ9 A;  5HCJ A;  5BRX A;  5IUX A;  4UM3 A;  2QC1 B;  4DBM A;  5SYO A;  2BYP A;  5HEU A;  4WV9 A;  3RQU A;  3UU4 A;  2YME A;  3IGQ A;  5CFB A;  4TWD A;  2W8F A;  3JAE A;  3RI5 A;  3TLV A;  3U8N A;  3UU5 A;  3RHW A;  2PGZ A;  5AFM B;  2Y54 A;  4ZRU A;  4HFC A;  4TNW A;  2XZ6 A;  2BG9 C;  5KZU A;  2XNT A;  2XYS A;  4TNV A;  3UU8 A;  3TLW A;  3LSV A;  3UU3 A;  3WTH A;  3EHZ A;  2W8G A;  4IL9 A;  3SIO A;  5AFK A;  5BW2 A;  4ALX A;  5L4H A;  4F8H A;  3JAF A;  4AFG A;  5HEJ A;  3WTO A;  2WN9 A;  2VL0 A;  2YOE A;  3WTK A;  2UZ6 A;  3C84 A;  3UU6 A;  3JAD A;  2BYN A;  3WIP A;  3UUB A;  4ZJT A;  4ILC A;  4ILB A;  5J5F A;  1I9B A;  5AFN A;  4QH1 A;  3SQ6 A;  5J5G A;  3ZDG A;  5L47 A;  2X00 A;  2BYQ A;  2XNV A;  5L4E A;  5J5I A;  4LMK A;  4NZB A;  2XQ4 A;  4HFI A;  4HFB A;  4A97 A;  4D01 A;  3U8J A;  2XNU A;  2BYR A;  3U8L A;  4XK9 A;  4QH4 A;  4IRE A;  4ZK4 A;  3EI0 A;  5HEG A;  3UQ4 A;  3P4W A;  5TVC A;  5J0Z A;  2BG9 A;  2YKS A;  2Y56 A;  3TLT A;  5KE4 A;  2XQ3 A;  2Y7Y A;  2BR7 A;  4HFD A;  5HEO A;  4IL4 A;  2YN6 A;  2PH9 A;  4TWH A;  2BR8 A;  4ZZC A;  2WNL A;  4QAC A;  2XQ5 A;  4UY2 A;  4ILA A;  3GUA A;  4Z90 A;  3U8M A;  5LXB A;  4UM3 P;  5HCM A;  3SH1 A;  3ZDH A;  3WTM A;  4EZ1 A;  3RIA A;  4QH5 A;  4COF A;  2ZJU A;  4UM3 S; 
#chains in the Genus database with same CATH topology
 4AFH A;  2Y58 A;  2YMD A;  4Z91 A;  2XQA A;  2WNC A;  3ZKR A;  3UQ7 A;  4ZJS A;  4XHE A;  2XQ6 A;  4AFT A;  3P50 A;  1UW6 A;  5CO5 A;  3TLS A;  5AFL A;  4BQT A;  4QAB A;  2XQ9 A;  5AIN A;  4HFH A;  2X00 D;  3EAM A;  3WTJ A;  4ZK1 A;  2XQ8 A;  3PMZ A;  4QAA A;  5AFM A;  1UX2 A;  4NPP A;  4LMJ A;  4UM1 A;  2XZ5 A;  4FRR A;  2WNJ A;  2BG9 B;  3WTN A;  3T4M A;  3C79 A;  2BJ0 A;  4BFQ A;  4TWF A;  5AFJ A;  3U8K A;  5BP0 A;  5JME A;  4A98 A;  2Y57 A;  4PIR A;  4ZZB A;  2BG9 E;  2XYT A;  3PEO A;  3RIF A;  2XQ7 A;  5J5H A;  4HFE A;  4B5D A;  2WZY A;  4UXU A;  4ZR6 A;  2ZJV A;  3TLU A;  5FJV A;  5LG3 A;  3WTL A;  2C9T A;  2BYS A;  3RQW A;  4HQP A;  5HEH A;  4X5T A;  1UV6 A;  4LML A;  3WTI A;  5AFH A;  3SQ9 A;  5HCJ A;  5BRX A;  5IUX A;  4UM3 A;  2QC1 B;  4DBM A;  5SYO A;  2BYP A;  5HEU A;  4WV9 A;  3RQU A;  3UU4 A;  2YME A;  3IGQ A;  5CFB A;  4TWD A;  2W8F A;  3JAE A;  3RI5 A;  3TLV A;  3U8N A;  3UU5 A;  3RHW A;  2PGZ A;  5AFM B;  2Y54 A;  4ZRU A;  4HFC A;  4TNW A;  2XZ6 A;  2BG9 C;  5KZU A;  2XNT A;  2XYS A;  4TNV A;  3UU8 A;  3TLW A;  3LSV A;  3UU3 A;  3WTH A;  3EHZ A;  2W8G A;  4IL9 A;  3SIO A;  5AFK A;  5BW2 A;  4ALX A;  5L4H A;  4F8H A;  3JAF A;  4AFG A;  5HEJ A;  3WTO A;  2WN9 A;  2VL0 A;  2YOE A;  3WTK A;  2UZ6 A;  3C84 A;  3UU6 A;  3JAD A;  2BYN A;  3WIP A;  3UUB A;  4ZJT A;  4ILC A;  4ILB A;  5J5F A;  1I9B A;  5AFN A;  4QH1 A;  3SQ6 A;  5J5G A;  3ZDG A;  5L47 A;  2X00 A;  2BYQ A;  2XNV A;  5L4E A;  5J5I A;  4LMK A;  4NZB A;  2XQ4 A;  4HFI A;  4HFB A;  4A97 A;  4D01 A;  3U8J A;  2XNU A;  2BYR A;  3U8L A;  4XK9 A;  4QH4 A;  4IRE A;  4ZK4 A;  3EI0 A;  5HEG A;  3UQ4 A;  3P4W A;  5TVC A;  5J0Z A;  2BG9 A;  2YKS A;  2Y56 A;  3TLT A;  5KE4 A;  2XQ3 A;  2Y7Y A;  2BR7 A;  4HFD A;  5HEO A;  4IL4 A;  2YN6 A;  2PH9 A;  4TWH A;  2BR8 A;  4ZZC A;  2WNL A;  4QAC A;  2XQ5 A;  4UY2 A;  4ILA A;  3GUA A;  4Z90 A;  3U8M A;  5LXB A;  4UM3 P;  5HCM A;  3SH1 A;  3ZDH A;  3WTM A;  4EZ1 A;  3RIA A;  4QH5 A;  4COF A;  2ZJU A;  4UM3 S; 
#chains in the Genus database with same CATH homology
 4AFH A;  2Y58 A;  2YMD A;  4Z91 A;  2XQA A;  2WNC A;  3ZKR A;  3UQ7 A;  4ZJS A;  4XHE A;  2XQ6 A;  4AFT A;  3P50 A;  1UW6 A;  5CO5 A;  3TLS A;  5AFL A;  4BQT A;  4QAB A;  2XQ9 A;  5AIN A;  4HFH A;  2X00 D;  3EAM A;  3WTJ A;  4ZK1 A;  2XQ8 A;  3PMZ A;  4QAA A;  5AFM A;  1UX2 A;  4NPP A;  4LMJ A;  4UM1 A;  2XZ5 A;  4FRR A;  2WNJ A;  2BG9 B;  3WTN A;  3T4M A;  3C79 A;  2BJ0 A;  4BFQ A;  4TWF A;  5AFJ A;  3U8K A;  5BP0 A;  5JME A;  4A98 A;  2Y57 A;  4PIR A;  4ZZB A;  2BG9 E;  2XYT A;  3PEO A;  3RIF A;  2XQ7 A;  5J5H A;  4HFE A;  4B5D A;  2WZY A;  4UXU A;  4ZR6 A;  2ZJV A;  3TLU A;  5FJV A;  5LG3 A;  3WTL A;  2C9T A;  2BYS A;  3RQW A;  4HQP A;  5HEH A;  4X5T A;  1UV6 A;  4LML A;  3WTI A;  5AFH A;  3SQ9 A;  5HCJ A;  5BRX A;  5IUX A;  4UM3 A;  2QC1 B;  4DBM A;  5SYO A;  2BYP A;  5HEU A;  4WV9 A;  3RQU A;  3UU4 A;  2YME A;  3IGQ A;  5CFB A;  4TWD A;  2W8F A;  3JAE A;  3RI5 A;  3TLV A;  3U8N A;  3UU5 A;  3RHW A;  2PGZ A;  5AFM B;  2Y54 A;  4ZRU A;  4HFC A;  4TNW A;  2XZ6 A;  2BG9 C;  5KZU A;  2XNT A;  2XYS A;  4TNV A;  3UU8 A;  3TLW A;  3LSV A;  3UU3 A;  3WTH A;  3EHZ A;  2W8G A;  4IL9 A;  3SIO A;  5AFK A;  5BW2 A;  4ALX A;  5L4H A;  4F8H A;  3JAF A;  4AFG A;  5HEJ A;  3WTO A;  2WN9 A;  2VL0 A;  2YOE A;  3WTK A;  2UZ6 A;  3C84 A;  3UU6 A;  3JAD A;  2BYN A;  3WIP A;  3UUB A;  4ZJT A;  4ILC A;  4ILB A;  5J5F A;  1I9B A;  5AFN A;  4QH1 A;  3SQ6 A;  5J5G A;  3ZDG A;  5L47 A;  2X00 A;  2BYQ A;  2XNV A;  5L4E A;  5J5I A;  4LMK A;  4NZB A;  2XQ4 A;  4HFI A;  4HFB A;  4A97 A;  4D01 A;  3U8J A;  2XNU A;  2BYR A;  3U8L A;  4XK9 A;  4QH4 A;  4IRE A;  4ZK4 A;  3EI0 A;  5HEG A;  3UQ4 A;  3P4W A;  5TVC A;  5J0Z A;  2BG9 A;  2YKS A;  2Y56 A;  3TLT A;  5KE4 A;  2XQ3 A;  2Y7Y A;  2BR7 A;  4HFD A;  5HEO A;  4IL4 A;  2YN6 A;  2PH9 A;  4TWH A;  2BR8 A;  4ZZC A;  2WNL A;  4QAC A;  2XQ5 A;  4UY2 A;  4ILA A;  3GUA A;  4Z90 A;  3U8M A;  5LXB A;  4UM3 P;  5HCM A;  3SH1 A;  3ZDH A;  3WTM A;  4EZ1 A;  3RIA A;  4QH5 A;  4COF A;  2ZJU A;  4UM3 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...