2WN9A

Crystal structure of aplysia achbp in complex with 4-0h-dmxba
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
209
structure length
209
Chain Sequence
LHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural determinants for interaction of partial agonists with acetylcholine binding protein and neuronal alpha7 nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Aplysia californica
total genus 50
structure length 209
sequence length 209
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wn9A00
4FRRA 4D01A 3WTLA 3RIAA 2WNJA 2W8FA 3UU6A 3SH1A 3WTOA 3U8JA 2XQ7A 2X00A 4HFHA 4AFGA 4HFIA 4IL9A 4A97A 4UM1A 3EHZA 2YMEA 3JAEA 4QAAA 4F8HA 5AFMB 2BYRA 3TLVA 2BR8A 4IL4A 5IUXA 2XNUA 4QH4A 3T4MA 5BW2A 3UU4A 4TNVA 5HEOA 4TNWA 3UU5A 2BYNA 2BG9C 3IGQA 2ZJVA 4X5TA 3U8LA 2YMDA 5J5HA 2Y54A 5J5GA 3TLTA 3UU3A 3WTNA 4BFQA 5KE4A 5AFKA 5KZUA 2XQ6A 4TWDA 4ZK4A 4NPPA 2C9TA 5AFJA 4TWFA 5HCMA 5HCJA 3WTIA 4HFCA 4ZK1A 4HFEA 2BG9A 4ILBA 4ILCA 2XQ8A 3UUBA 2XYTA 3PMZA 5FJVA 4AFTA 4HFDA 2XQ3A 3WTMA 3RIFA 3UQ7A 4UM3S 4Z90A 2XNTA 2BG9E 3PEOA 4QABA 3JADA 5AFNA 2WNLA 2X00D 2BR7A 3EAMA 4ZJSA 4BQTA 4QH5A 5JMEA 2YN6A 2Y7YA 1UX2A 1UV6A 3UU8A 2BG9B 2XYSA 4PIRA 2XNVA 2XZ6A 5HEJA 4ALXA 2XQ9A 2ZJUA 4COFA 1I9BA 5HEGA 5AINA 2Y58A 3SQ9A 4LMLA 3TLUA 5L4EA 2Y57A 3WTKA 3U8MA 3WTHA 3C84A 4XK9A 4IREA 4UM3A 5AFHA 2XZ5A 2QC1B 2BYQA 5J5IA 1UW6A 3GUAA 3EI0A 4ZZCA 2Y56A 5L4HA 3SIOA 3C79A 4EZ1A 4HQPA 4ZJTA 5LG3A 5SYOA 3SQ6A 4ILAA 3WTJA 4AFHA 3P50A 4QACA 4WV9A 2YOEA 5HEUA 3ZKRA 4NZBA 5L47A 4Z91A 3RI5A 3RHWA 3LSVA 2WNCA 3RQWA 4ZZBA 5AFLA 2PH9A 3RQUA 2BJ0A 3JAFA 5LXBA 4ZR6A 4XHEA 2VL0A 3UQ4A 5J0ZA 2WZYA 3U8KA 4TWHA 3U8NA 2BYPA 4DBMA 3P4WA 2UZ6A 4QH1A 5BP0A 4A98A 3ZDHA 2W8GA 2YKSA 5TVCA 4UXUA 5CFBA 5J5FA 5CO5A 4UM3P 4ZRUA 5HEHA 4B5DA 2XQ4A 3TLSA 3ZDGA 2BYSA 2PGZA 2WN9A 2XQ5A 2XQAA 4UY2A 5AFMA 3TLWA 4LMJA 4LMKA 4HFBA 5BRXA 3WIPA
chains in the Genus database with same CATH superfamily
4FRRA 4D01A 3WTLA 3RIAA 2WNJA 2W8FA 3UU6A 3SH1A 3WTOA 3U8JA 2XQ7A 2X00A 4HFHA 4AFGA 4HFIA 4IL9A 4A97A 4UM1A 3EHZA 2YMEA 3JAEA 4QAAA 4F8HA 5AFMB 2BYRA 3TLVA 2BR8A 4IL4A 5IUXA 2XNUA 4QH4A 3T4MA 5BW2A 3UU4A 4TNVA 5HEOA 4TNWA 3UU5A 2BYNA 2BG9C 3IGQA 2ZJVA 4X5TA 3U8LA 2YMDA 5J5HA 2Y54A 5J5GA 3TLTA 3UU3A 3WTNA 4BFQA 5KE4A 5AFKA 5KZUA 2XQ6A 4TWDA 4ZK4A 4NPPA 2C9TA 5AFJA 4TWFA 5HCMA 5HCJA 3WTIA 4HFCA 4ZK1A 4HFEA 2BG9A 4ILBA 4ILCA 2XQ8A 3UUBA 2XYTA 3PMZA 5FJVA 4AFTA 4HFDA 2XQ3A 3WTMA 3RIFA 3UQ7A 4UM3S 4Z90A 2XNTA 2BG9E 3PEOA 4QABA 3JADA 5AFNA 2WNLA 2X00D 2BR7A 3EAMA 4ZJSA 4BQTA 4QH5A 5JMEA 2YN6A 2Y7YA 1UX2A 1UV6A 3UU8A 2BG9B 2XYSA 4PIRA 2XNVA 2XZ6A 5HEJA 4ALXA 2XQ9A 2ZJUA 4COFA 1I9BA 5HEGA 5AINA 2Y58A 3SQ9A 4LMLA 3TLUA 5L4EA 2Y57A 3WTKA 3U8MA 3WTHA 3C84A 4XK9A 4IREA 4UM3A 5AFHA 2XZ5A 2QC1B 2BYQA 5J5IA 1UW6A 3GUAA 3EI0A 4ZZCA 2Y56A 5L4HA 3SIOA 3C79A 4EZ1A 4HQPA 4ZJTA 5LG3A 5SYOA 3SQ6A 4ILAA 3WTJA 4AFHA 3P50A 4QACA 4WV9A 2YOEA 5HEUA 3ZKRA 4NZBA 5L47A 4Z91A 3RI5A 3RHWA 3LSVA 2WNCA 3RQWA 4ZZBA 5AFLA 2PH9A 3RQUA 2BJ0A 3JAFA 5LXBA 4ZR6A 4XHEA 2VL0A 3UQ4A 5J0ZA 2WZYA 3U8KA 4TWHA 3U8NA 2BYPA 4DBMA 3P4WA 2UZ6A 4QH1A 5BP0A 4A98A 3ZDHA 2W8GA 2YKSA 5TVCA 4UXUA 5CFBA 5J5FA 5CO5A 4UM3P 4ZRUA 5HEHA 4B5DA 2XQ4A 3TLSA 3ZDGA 2BYSA 2PGZA 2WN9A 2XQ5A 2XQAA 4UY2A 5AFMA 3TLWA 4LMJA 4LMKA 4HFBA 5BRXA 3WIPA
chains in the Genus database with same CATH topology
4FRRA 4D01A 3WTLA 3RIAA 2WNJA 2W8FA 3UU6A 3SH1A 3WTOA 3U8JA 2XQ7A 2X00A 4HFHA 4AFGA 4HFIA 4IL9A 4A97A 4UM1A 3EHZA 2YMEA 3JAEA 4QAAA 4F8HA 5AFMB 2BYRA 3TLVA 2BR8A 4IL4A 5IUXA 2XNUA 4QH4A 3T4MA 5BW2A 3UU4A 4TNVA 5HEOA 4TNWA 3UU5A 2BYNA 2BG9C 3IGQA 2ZJVA 4X5TA 3U8LA 2YMDA 5J5HA 2Y54A 5J5GA 3TLTA 3UU3A 3WTNA 4BFQA 5KE4A 5AFKA 5KZUA 2XQ6A 4TWDA 4ZK4A 4NPPA 2C9TA 5AFJA 4TWFA 5HCMA 5HCJA 3WTIA 4HFCA 4ZK1A 4HFEA 2BG9A 4ILBA 4ILCA 2XQ8A 3UUBA 2XYTA 3PMZA 5FJVA 4AFTA 4HFDA 2XQ3A 3WTMA 3RIFA 3UQ7A 4UM3S 4Z90A 2XNTA 2BG9E 3PEOA 4QABA 3JADA 5AFNA 2WNLA 2X00D 2BR7A 3EAMA 4ZJSA 4BQTA 4QH5A 5JMEA 2YN6A 2Y7YA 1UX2A 1UV6A 3UU8A 2BG9B 2XYSA 4PIRA 2XNVA 2XZ6A 5HEJA 4ALXA 2XQ9A 2ZJUA 4COFA 1I9BA 5HEGA 5AINA 2Y58A 3SQ9A 4LMLA 3TLUA 5L4EA 2Y57A 3WTKA 3U8MA 3WTHA 3C84A 4XK9A 4IREA 4UM3A 5AFHA 2XZ5A 2QC1B 2BYQA 5J5IA 1UW6A 3GUAA 3EI0A 4ZZCA 2Y56A 5L4HA 3SIOA 3C79A 4EZ1A 4HQPA 4ZJTA 5LG3A 5SYOA 3SQ6A 4ILAA 3WTJA 4AFHA 3P50A 4QACA 4WV9A 2YOEA 5HEUA 3ZKRA 4NZBA 5L47A 4Z91A 3RI5A 3RHWA 3LSVA 2WNCA 3RQWA 4ZZBA 5AFLA 2PH9A 3RQUA 2BJ0A 3JAFA 5LXBA 4ZR6A 4XHEA 2VL0A 3UQ4A 5J0ZA 2WZYA 3U8KA 4TWHA 3U8NA 2BYPA 4DBMA 3P4WA 2UZ6A 4QH1A 5BP0A 4A98A 3ZDHA 2W8GA 2YKSA 5TVCA 4UXUA 5CFBA 5J5FA 5CO5A 4UM3P 4ZRUA 5HEHA 4B5DA 2XQ4A 3TLSA 3ZDGA 2BYSA 2PGZA 2WN9A 2XQ5A 2XQAA 4UY2A 5AFMA 3TLWA 4LMJA 4LMKA 4HFBA 5BRXA 3WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRR A;  4D01 A;  3WTL A;  3RIA A;  2WNJ A;  2W8F A;  3UU6 A;  3SH1 A;  3WTO A;  3U8J A;  2XQ7 A;  2X00 A;  4HFH A;  4AFG A;  4HFI A;  4IL9 A;  4A97 A;  4UM1 A;  3EHZ A;  2YME A;  3JAE A;  4QAA A;  4F8H A;  5AFM B;  2BYR A;  3TLV A;  2BR8 A;  4IL4 A;  5IUX A;  2XNU A;  4QH4 A;  3T4M A;  5BW2 A;  3UU4 A;  4TNV A;  5HEO A;  4TNW A;  3UU5 A;  2BYN A;  2BG9 C;  3IGQ A;  2ZJV A;  4X5T A;  3U8L A;  2YMD A;  5J5H A;  2Y54 A;  5J5G A;  3TLT A;  3UU3 A;  3WTN A;  4BFQ A;  5KE4 A;  5AFK A;  5KZU A;  2XQ6 A;  4TWD A;  4ZK4 A;  4NPP A;  2C9T A;  5AFJ A;  4TWF A;  5HCM A;  5HCJ A;  3WTI A;  4HFC A;  4ZK1 A;  4HFE A;  2BG9 A;  4ILB A;  4ILC A;  2XQ8 A;  3UUB A;  2XYT A;  3PMZ A;  5FJV A;  4AFT A;  4HFD A;  2XQ3 A;  3WTM A;  3RIF A;  3UQ7 A;  4UM3 S;  4Z90 A;  2XNT A;  2BG9 E;  3PEO A;  4QAB A;  3JAD A;  5AFN A;  2WNL A;  2X00 D;  2BR7 A;  3EAM A;  4ZJS A;  4BQT A;  4QH5 A;  5JME A;  2YN6 A;  2Y7Y A;  1UX2 A;  1UV6 A;  3UU8 A;  2BG9 B;  2XYS A;  4PIR A;  2XNV A;  2XZ6 A;  5HEJ A;  4ALX A;  2XQ9 A;  2ZJU A;  4COF A;  1I9B A;  5HEG A;  5AIN A;  2Y58 A;  3SQ9 A;  4LML A;  3TLU A;  5L4E A;  2Y57 A;  3WTK A;  3U8M A;  3WTH A;  3C84 A;  4XK9 A;  4IRE A;  4UM3 A;  5AFH A;  2XZ5 A;  2QC1 B;  2BYQ A;  5J5I A;  1UW6 A;  3GUA A;  3EI0 A;  4ZZC A;  2Y56 A;  5L4H A;  3SIO A;  3C79 A;  4EZ1 A;  4HQP A;  4ZJT A;  5LG3 A;  5SYO A;  3SQ6 A;  4ILA A;  3WTJ A;  4AFH A;  3P50 A;  4QAC A;  4WV9 A;  2YOE A;  5HEU A;  3ZKR A;  4NZB A;  5L47 A;  4Z91 A;  3RI5 A;  3RHW A;  3LSV A;  2WNC A;  3RQW A;  4ZZB A;  5AFL A;  2PH9 A;  3RQU A;  2BJ0 A;  3JAF A;  5LXB A;  4ZR6 A;  4XHE A;  2VL0 A;  3UQ4 A;  5J0Z A;  2WZY A;  3U8K A;  4TWH A;  3U8N A;  2BYP A;  4DBM A;  3P4W A;  2UZ6 A;  4QH1 A;  5BP0 A;  4A98 A;  3ZDH A;  2W8G A;  2YKS A;  5TVC A;  4UXU A;  5CFB A;  5J5F A;  5CO5 A;  4UM3 P;  4ZRU A;  5HEH A;  4B5D A;  2XQ4 A;  3TLS A;  3ZDG A;  2BYS A;  2PGZ A;  2WN9 A;  2XQ5 A;  2XQA A;  4UY2 A;  5AFM A;  3TLW A;  4LMJ A;  4LMK A;  4HFB A;  5BRX A;  3WIP A; 
#chains in the Genus database with same CATH topology
 4FRR A;  4D01 A;  3WTL A;  3RIA A;  2WNJ A;  2W8F A;  3UU6 A;  3SH1 A;  3WTO A;  3U8J A;  2XQ7 A;  2X00 A;  4HFH A;  4AFG A;  4HFI A;  4IL9 A;  4A97 A;  4UM1 A;  3EHZ A;  2YME A;  3JAE A;  4QAA A;  4F8H A;  5AFM B;  2BYR A;  3TLV A;  2BR8 A;  4IL4 A;  5IUX A;  2XNU A;  4QH4 A;  3T4M A;  5BW2 A;  3UU4 A;  4TNV A;  5HEO A;  4TNW A;  3UU5 A;  2BYN A;  2BG9 C;  3IGQ A;  2ZJV A;  4X5T A;  3U8L A;  2YMD A;  5J5H A;  2Y54 A;  5J5G A;  3TLT A;  3UU3 A;  3WTN A;  4BFQ A;  5KE4 A;  5AFK A;  5KZU A;  2XQ6 A;  4TWD A;  4ZK4 A;  4NPP A;  2C9T A;  5AFJ A;  4TWF A;  5HCM A;  5HCJ A;  3WTI A;  4HFC A;  4ZK1 A;  4HFE A;  2BG9 A;  4ILB A;  4ILC A;  2XQ8 A;  3UUB A;  2XYT A;  3PMZ A;  5FJV A;  4AFT A;  4HFD A;  2XQ3 A;  3WTM A;  3RIF A;  3UQ7 A;  4UM3 S;  4Z90 A;  2XNT A;  2BG9 E;  3PEO A;  4QAB A;  3JAD A;  5AFN A;  2WNL A;  2X00 D;  2BR7 A;  3EAM A;  4ZJS A;  4BQT A;  4QH5 A;  5JME A;  2YN6 A;  2Y7Y A;  1UX2 A;  1UV6 A;  3UU8 A;  2BG9 B;  2XYS A;  4PIR A;  2XNV A;  2XZ6 A;  5HEJ A;  4ALX A;  2XQ9 A;  2ZJU A;  4COF A;  1I9B A;  5HEG A;  5AIN A;  2Y58 A;  3SQ9 A;  4LML A;  3TLU A;  5L4E A;  2Y57 A;  3WTK A;  3U8M A;  3WTH A;  3C84 A;  4XK9 A;  4IRE A;  4UM3 A;  5AFH A;  2XZ5 A;  2QC1 B;  2BYQ A;  5J5I A;  1UW6 A;  3GUA A;  3EI0 A;  4ZZC A;  2Y56 A;  5L4H A;  3SIO A;  3C79 A;  4EZ1 A;  4HQP A;  4ZJT A;  5LG3 A;  5SYO A;  3SQ6 A;  4ILA A;  3WTJ A;  4AFH A;  3P50 A;  4QAC A;  4WV9 A;  2YOE A;  5HEU A;  3ZKR A;  4NZB A;  5L47 A;  4Z91 A;  3RI5 A;  3RHW A;  3LSV A;  2WNC A;  3RQW A;  4ZZB A;  5AFL A;  2PH9 A;  3RQU A;  2BJ0 A;  3JAF A;  5LXB A;  4ZR6 A;  4XHE A;  2VL0 A;  3UQ4 A;  5J0Z A;  2WZY A;  3U8K A;  4TWH A;  3U8N A;  2BYP A;  4DBM A;  3P4W A;  2UZ6 A;  4QH1 A;  5BP0 A;  4A98 A;  3ZDH A;  2W8G A;  2YKS A;  5TVC A;  4UXU A;  5CFB A;  5J5F A;  5CO5 A;  4UM3 P;  4ZRU A;  5HEH A;  4B5D A;  2XQ4 A;  3TLS A;  3ZDG A;  2BYS A;  2PGZ A;  2WN9 A;  2XQ5 A;  2XQA A;  4UY2 A;  5AFM A;  3TLW A;  4LMJ A;  4LMK A;  4HFB A;  5BRX A;  3WIP A; 
#chains in the Genus database with same CATH homology
 4FRR A;  4D01 A;  3WTL A;  3RIA A;  2WNJ A;  2W8F A;  3UU6 A;  3SH1 A;  3WTO A;  3U8J A;  2XQ7 A;  2X00 A;  4HFH A;  4AFG A;  4HFI A;  4IL9 A;  4A97 A;  4UM1 A;  3EHZ A;  2YME A;  3JAE A;  4QAA A;  4F8H A;  5AFM B;  2BYR A;  3TLV A;  2BR8 A;  4IL4 A;  5IUX A;  2XNU A;  4QH4 A;  3T4M A;  5BW2 A;  3UU4 A;  4TNV A;  5HEO A;  4TNW A;  3UU5 A;  2BYN A;  2BG9 C;  3IGQ A;  2ZJV A;  4X5T A;  3U8L A;  2YMD A;  5J5H A;  2Y54 A;  5J5G A;  3TLT A;  3UU3 A;  3WTN A;  4BFQ A;  5KE4 A;  5AFK A;  5KZU A;  2XQ6 A;  4TWD A;  4ZK4 A;  4NPP A;  2C9T A;  5AFJ A;  4TWF A;  5HCM A;  5HCJ A;  3WTI A;  4HFC A;  4ZK1 A;  4HFE A;  2BG9 A;  4ILB A;  4ILC A;  2XQ8 A;  3UUB A;  2XYT A;  3PMZ A;  5FJV A;  4AFT A;  4HFD A;  2XQ3 A;  3WTM A;  3RIF A;  3UQ7 A;  4UM3 S;  4Z90 A;  2XNT A;  2BG9 E;  3PEO A;  4QAB A;  3JAD A;  5AFN A;  2WNL A;  2X00 D;  2BR7 A;  3EAM A;  4ZJS A;  4BQT A;  4QH5 A;  5JME A;  2YN6 A;  2Y7Y A;  1UX2 A;  1UV6 A;  3UU8 A;  2BG9 B;  2XYS A;  4PIR A;  2XNV A;  2XZ6 A;  5HEJ A;  4ALX A;  2XQ9 A;  2ZJU A;  4COF A;  1I9B A;  5HEG A;  5AIN A;  2Y58 A;  3SQ9 A;  4LML A;  3TLU A;  5L4E A;  2Y57 A;  3WTK A;  3U8M A;  3WTH A;  3C84 A;  4XK9 A;  4IRE A;  4UM3 A;  5AFH A;  2XZ5 A;  2QC1 B;  2BYQ A;  5J5I A;  1UW6 A;  3GUA A;  3EI0 A;  4ZZC A;  2Y56 A;  5L4H A;  3SIO A;  3C79 A;  4EZ1 A;  4HQP A;  4ZJT A;  5LG3 A;  5SYO A;  3SQ6 A;  4ILA A;  3WTJ A;  4AFH A;  3P50 A;  4QAC A;  4WV9 A;  2YOE A;  5HEU A;  3ZKR A;  4NZB A;  5L47 A;  4Z91 A;  3RI5 A;  3RHW A;  3LSV A;  2WNC A;  3RQW A;  4ZZB A;  5AFL A;  2PH9 A;  3RQU A;  2BJ0 A;  3JAF A;  5LXB A;  4ZR6 A;  4XHE A;  2VL0 A;  3UQ4 A;  5J0Z A;  2WZY A;  3U8K A;  4TWH A;  3U8N A;  2BYP A;  4DBM A;  3P4W A;  2UZ6 A;  4QH1 A;  5BP0 A;  4A98 A;  3ZDH A;  2W8G A;  2YKS A;  5TVC A;  4UXU A;  5CFB A;  5J5F A;  5CO5 A;  4UM3 P;  4ZRU A;  5HEH A;  4B5D A;  2XQ4 A;  3TLS A;  3ZDG A;  2BYS A;  2PGZ A;  2WN9 A;  2XQ5 A;  2XQA A;  4UY2 A;  5AFM A;  3TLW A;  4LMJ A;  4LMK A;  4HFB A;  5BRX A;  3WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...