2BYSA

Crystal structure of achbp from aplysia californica in complex with lobeline
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
205
Chain Sequence
SQANLMRLKSDLFNRSYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords ACETYLCHOLINE-BINDING PROTEIN
publication title Structures of Aplysia Achbp Complexes with Nicotinic Agonists and Antagonists Reveal Distinctive Binding Interfaces and Conformations.
pubmed doi rcsb
source organism Aplysia californica
total genus 48
structure length 205
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bysA00
4QACA 3U8MA 3RQWA 5J5FA 2XZ6A 3WTNA 4LMLA 3TLSA 3TLVA 4UM3A 3UU5A 2PGZA 2BYQA 2WNJA 4ZJTA 4EZ1A 4UY2A 5J5IA 4ZK1A 4UXUA 3WTJA 2WN9A 4ZZCA 2X00A 2XNVA 4HFDA 4TNVA 2W8FA 3LSVA 2BYPA 4TWHA 2XQ3A 4PIRA 4IL9A 3IGQA 3UU6A 4A97A 3JAFA 4QH5A 3TLWA 2BG9E 5CFBA 3WTLA 4B5DA 4UM3P 3EHZA 4AFHA 2VL0A 5LG3A 2BYNA 4HFEA 3RIAA 4TWFA 5IUXA 2ZJUA 4BFQA 4ILBA 3UU4A 3WIPA 2XYSA 5JMEA 4UM3S 3TLUA 4NZBA 2Y58A 3UQ7A 2YMDA 4X5TA 4XK9A 3JADA 2Y57A 4HFHA 4ILCA 4Z90A 5HEUA 2UZ6A 2XQ6A 2XYTA 4HFIA 2XQAA 4DBMA 5L47A 5HEGA 5HCJA 4QH1A 2XQ4A 5AFMB 3ZDGA 5L4EA 2YN6A 4BQTA 2YMEA 5HEJA 2BJ0A 2Y7YA 5J5HA 3WTMA 3WTIA 1I9BA 2BYSA 3P4WA 4TNWA 2XNTA 3RIFA 3SH1A 5AFJA 3RQUA 4TWDA 4QABA 4ZZBA 2ZJVA 3SQ9A 5AFHA 2XNUA 1UW6A 5KZUA 5HEHA 2BG9C 5LXBA 4ZK4A 3C79A 4IREA 3PEOA 4UM1A 5CO5A 4AFTA 2XZ5A 3PMZA 5AINA 3EI0A 5KE4A 4Z91A 3RHWA 3ZDHA 2C9TA 4ILAA 4F8HA 5BP0A 5L4HA 5AFNA 2PH9A 5HEOA 2XQ9A 3GUAA 2WNCA 2QC1B 4ZJSA 5TVCA 3U8NA 3ZKRA 4AFGA 2Y56A 5AFLA 3UUBA 4ALXA 4LMKA 5AFMA 2WZYA 3EAMA 2Y54A 4IL4A 2BR7A 4QH4A 3SQ6A 4XHEA 4WV9A 4HFBA 2X00D 2BYRA 5SYOA 5BRXA 4QAAA 5HCMA 3SIOA 5AFKA 3UU8A 3UU3A 2YKSA 5J0ZA 3RI5A 3U8LA 3U8JA 3P50A 4LMJA 3WTHA 2XQ8A 3C84A 3JAEA 2XQ5A 4NPPA 4HFCA 4A98A 2BG9B 2W8GA 3WTOA 2BG9A 3T4MA 4FRRA 3U8KA 3TLTA 4D01A 4ZR6A 2WNLA 5J5GA 5FJVA 5BW2A 3UQ4A 4HQPA 2XQ7A 2YOEA 1UV6A 1UX2A 4COFA 4ZRUA 3WTKA 2BR8A
chains in the Genus database with same CATH superfamily
4QACA 3U8MA 3RQWA 5J5FA 2XZ6A 3WTNA 4LMLA 3TLSA 3TLVA 4UM3A 3UU5A 2PGZA 2BYQA 2WNJA 4ZJTA 4EZ1A 4UY2A 5J5IA 4ZK1A 4UXUA 3WTJA 2WN9A 4ZZCA 2X00A 2XNVA 4HFDA 4TNVA 2W8FA 3LSVA 2BYPA 4TWHA 2XQ3A 4PIRA 4IL9A 3IGQA 3UU6A 4A97A 3JAFA 4QH5A 3TLWA 2BG9E 5CFBA 3WTLA 4B5DA 4UM3P 3EHZA 4AFHA 2VL0A 5LG3A 2BYNA 4HFEA 3RIAA 4TWFA 5IUXA 2ZJUA 4BFQA 4ILBA 3UU4A 3WIPA 2XYSA 5JMEA 4UM3S 3TLUA 4NZBA 2Y58A 3UQ7A 2YMDA 4X5TA 4XK9A 3JADA 2Y57A 4HFHA 4ILCA 4Z90A 5HEUA 2UZ6A 2XQ6A 2XYTA 4HFIA 2XQAA 4DBMA 5L47A 5HEGA 5HCJA 4QH1A 2XQ4A 5AFMB 3ZDGA 5L4EA 2YN6A 4BQTA 2YMEA 5HEJA 2BJ0A 2Y7YA 5J5HA 3WTMA 3WTIA 1I9BA 2BYSA 3P4WA 4TNWA 2XNTA 3RIFA 3SH1A 5AFJA 3RQUA 4TWDA 4QABA 4ZZBA 2ZJVA 3SQ9A 5AFHA 2XNUA 1UW6A 5KZUA 5HEHA 2BG9C 5LXBA 4ZK4A 3C79A 4IREA 3PEOA 4UM1A 5CO5A 4AFTA 2XZ5A 3PMZA 5AINA 3EI0A 5KE4A 4Z91A 3RHWA 3ZDHA 2C9TA 4ILAA 4F8HA 5BP0A 5L4HA 5AFNA 2PH9A 5HEOA 2XQ9A 3GUAA 2WNCA 2QC1B 4ZJSA 5TVCA 3U8NA 3ZKRA 4AFGA 2Y56A 5AFLA 3UUBA 4ALXA 4LMKA 5AFMA 2WZYA 3EAMA 2Y54A 4IL4A 2BR7A 4QH4A 3SQ6A 4XHEA 4WV9A 4HFBA 2X00D 2BYRA 5SYOA 5BRXA 4QAAA 5HCMA 3SIOA 5AFKA 3UU8A 3UU3A 2YKSA 5J0ZA 3RI5A 3U8LA 3U8JA 3P50A 4LMJA 3WTHA 2XQ8A 3C84A 3JAEA 2XQ5A 4NPPA 4HFCA 4A98A 2BG9B 2W8GA 3WTOA 2BG9A 3T4MA 4FRRA 3U8KA 3TLTA 4D01A 4ZR6A 2WNLA 5J5GA 5FJVA 5BW2A 3UQ4A 4HQPA 2XQ7A 2YOEA 1UV6A 1UX2A 4COFA 4ZRUA 3WTKA 2BR8A
chains in the Genus database with same CATH topology
4QACA 3U8MA 3RQWA 5J5FA 2XZ6A 3WTNA 4LMLA 3TLSA 3TLVA 4UM3A 3UU5A 2PGZA 2BYQA 2WNJA 4ZJTA 4EZ1A 4UY2A 5J5IA 4ZK1A 4UXUA 3WTJA 2WN9A 4ZZCA 2X00A 2XNVA 4HFDA 4TNVA 2W8FA 3LSVA 2BYPA 4TWHA 2XQ3A 4PIRA 4IL9A 3IGQA 3UU6A 4A97A 3JAFA 4QH5A 3TLWA 2BG9E 5CFBA 3WTLA 4B5DA 4UM3P 3EHZA 4AFHA 2VL0A 5LG3A 2BYNA 4HFEA 3RIAA 4TWFA 5IUXA 2ZJUA 4BFQA 4ILBA 3UU4A 3WIPA 2XYSA 5JMEA 4UM3S 3TLUA 4NZBA 2Y58A 3UQ7A 2YMDA 4X5TA 4XK9A 3JADA 2Y57A 4HFHA 4ILCA 4Z90A 5HEUA 2UZ6A 2XQ6A 2XYTA 4HFIA 2XQAA 4DBMA 5L47A 5HEGA 5HCJA 4QH1A 2XQ4A 5AFMB 3ZDGA 5L4EA 2YN6A 4BQTA 2YMEA 5HEJA 2BJ0A 2Y7YA 5J5HA 3WTMA 3WTIA 1I9BA 2BYSA 3P4WA 4TNWA 2XNTA 3RIFA 3SH1A 5AFJA 3RQUA 4TWDA 4QABA 4ZZBA 2ZJVA 3SQ9A 5AFHA 2XNUA 1UW6A 5KZUA 5HEHA 2BG9C 5LXBA 4ZK4A 3C79A 4IREA 3PEOA 4UM1A 5CO5A 4AFTA 2XZ5A 3PMZA 5AINA 3EI0A 5KE4A 4Z91A 3RHWA 3ZDHA 2C9TA 4ILAA 4F8HA 5BP0A 5L4HA 5AFNA 2PH9A 5HEOA 2XQ9A 3GUAA 2WNCA 2QC1B 4ZJSA 5TVCA 3U8NA 3ZKRA 4AFGA 2Y56A 5AFLA 3UUBA 4ALXA 4LMKA 5AFMA 2WZYA 3EAMA 2Y54A 4IL4A 2BR7A 4QH4A 3SQ6A 4XHEA 4WV9A 4HFBA 2X00D 2BYRA 5SYOA 5BRXA 4QAAA 5HCMA 3SIOA 5AFKA 3UU8A 3UU3A 2YKSA 5J0ZA 3RI5A 3U8LA 3U8JA 3P50A 4LMJA 3WTHA 2XQ8A 3C84A 3JAEA 2XQ5A 4NPPA 4HFCA 4A98A 2BG9B 2W8GA 3WTOA 2BG9A 3T4MA 4FRRA 3U8KA 3TLTA 4D01A 4ZR6A 2WNLA 5J5GA 5FJVA 5BW2A 3UQ4A 4HQPA 2XQ7A 2YOEA 1UV6A 1UX2A 4COFA 4ZRUA 3WTKA 2BR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAC A;  3U8M A;  3RQW A;  5J5F A;  2XZ6 A;  3WTN A;  4LML A;  3TLS A;  3TLV A;  4UM3 A;  3UU5 A;  2PGZ A;  2BYQ A;  2WNJ A;  4ZJT A;  4EZ1 A;  4UY2 A;  5J5I A;  4ZK1 A;  4UXU A;  3WTJ A;  2WN9 A;  4ZZC A;  2X00 A;  2XNV A;  4HFD A;  4TNV A;  2W8F A;  3LSV A;  2BYP A;  4TWH A;  2XQ3 A;  4PIR A;  4IL9 A;  3IGQ A;  3UU6 A;  4A97 A;  3JAF A;  4QH5 A;  3TLW A;  2BG9 E;  5CFB A;  3WTL A;  4B5D A;  4UM3 P;  3EHZ A;  4AFH A;  2VL0 A;  5LG3 A;  2BYN A;  4HFE A;  3RIA A;  4TWF A;  5IUX A;  2ZJU A;  4BFQ A;  4ILB A;  3UU4 A;  3WIP A;  2XYS A;  5JME A;  4UM3 S;  3TLU A;  4NZB A;  2Y58 A;  3UQ7 A;  2YMD A;  4X5T A;  4XK9 A;  3JAD A;  2Y57 A;  4HFH A;  4ILC A;  4Z90 A;  5HEU A;  2UZ6 A;  2XQ6 A;  2XYT A;  4HFI A;  2XQA A;  4DBM A;  5L47 A;  5HEG A;  5HCJ A;  4QH1 A;  2XQ4 A;  5AFM B;  3ZDG A;  5L4E A;  2YN6 A;  4BQT A;  2YME A;  5HEJ A;  2BJ0 A;  2Y7Y A;  5J5H A;  3WTM A;  3WTI A;  1I9B A;  2BYS A;  3P4W A;  4TNW A;  2XNT A;  3RIF A;  3SH1 A;  5AFJ A;  3RQU A;  4TWD A;  4QAB A;  4ZZB A;  2ZJV A;  3SQ9 A;  5AFH A;  2XNU A;  1UW6 A;  5KZU A;  5HEH A;  2BG9 C;  5LXB A;  4ZK4 A;  3C79 A;  4IRE A;  3PEO A;  4UM1 A;  5CO5 A;  4AFT A;  2XZ5 A;  3PMZ A;  5AIN A;  3EI0 A;  5KE4 A;  4Z91 A;  3RHW A;  3ZDH A;  2C9T A;  4ILA A;  4F8H A;  5BP0 A;  5L4H A;  5AFN A;  2PH9 A;  5HEO A;  2XQ9 A;  3GUA A;  2WNC A;  2QC1 B;  4ZJS A;  5TVC A;  3U8N A;  3ZKR A;  4AFG A;  2Y56 A;  5AFL A;  3UUB A;  4ALX A;  4LMK A;  5AFM A;  2WZY A;  3EAM A;  2Y54 A;  4IL4 A;  2BR7 A;  4QH4 A;  3SQ6 A;  4XHE A;  4WV9 A;  4HFB A;  2X00 D;  2BYR A;  5SYO A;  5BRX A;  4QAA A;  5HCM A;  3SIO A;  5AFK A;  3UU8 A;  3UU3 A;  2YKS A;  5J0Z A;  3RI5 A;  3U8L A;  3U8J A;  3P50 A;  4LMJ A;  3WTH A;  2XQ8 A;  3C84 A;  3JAE A;  2XQ5 A;  4NPP A;  4HFC A;  4A98 A;  2BG9 B;  2W8G A;  3WTO A;  2BG9 A;  3T4M A;  4FRR A;  3U8K A;  3TLT A;  4D01 A;  4ZR6 A;  2WNL A;  5J5G A;  5FJV A;  5BW2 A;  3UQ4 A;  4HQP A;  2XQ7 A;  2YOE A;  1UV6 A;  1UX2 A;  4COF A;  4ZRU A;  3WTK A;  2BR8 A; 
#chains in the Genus database with same CATH topology
 4QAC A;  3U8M A;  3RQW A;  5J5F A;  2XZ6 A;  3WTN A;  4LML A;  3TLS A;  3TLV A;  4UM3 A;  3UU5 A;  2PGZ A;  2BYQ A;  2WNJ A;  4ZJT A;  4EZ1 A;  4UY2 A;  5J5I A;  4ZK1 A;  4UXU A;  3WTJ A;  2WN9 A;  4ZZC A;  2X00 A;  2XNV A;  4HFD A;  4TNV A;  2W8F A;  3LSV A;  2BYP A;  4TWH A;  2XQ3 A;  4PIR A;  4IL9 A;  3IGQ A;  3UU6 A;  4A97 A;  3JAF A;  4QH5 A;  3TLW A;  2BG9 E;  5CFB A;  3WTL A;  4B5D A;  4UM3 P;  3EHZ A;  4AFH A;  2VL0 A;  5LG3 A;  2BYN A;  4HFE A;  3RIA A;  4TWF A;  5IUX A;  2ZJU A;  4BFQ A;  4ILB A;  3UU4 A;  3WIP A;  2XYS A;  5JME A;  4UM3 S;  3TLU A;  4NZB A;  2Y58 A;  3UQ7 A;  2YMD A;  4X5T A;  4XK9 A;  3JAD A;  2Y57 A;  4HFH A;  4ILC A;  4Z90 A;  5HEU A;  2UZ6 A;  2XQ6 A;  2XYT A;  4HFI A;  2XQA A;  4DBM A;  5L47 A;  5HEG A;  5HCJ A;  4QH1 A;  2XQ4 A;  5AFM B;  3ZDG A;  5L4E A;  2YN6 A;  4BQT A;  2YME A;  5HEJ A;  2BJ0 A;  2Y7Y A;  5J5H A;  3WTM A;  3WTI A;  1I9B A;  2BYS A;  3P4W A;  4TNW A;  2XNT A;  3RIF A;  3SH1 A;  5AFJ A;  3RQU A;  4TWD A;  4QAB A;  4ZZB A;  2ZJV A;  3SQ9 A;  5AFH A;  2XNU A;  1UW6 A;  5KZU A;  5HEH A;  2BG9 C;  5LXB A;  4ZK4 A;  3C79 A;  4IRE A;  3PEO A;  4UM1 A;  5CO5 A;  4AFT A;  2XZ5 A;  3PMZ A;  5AIN A;  3EI0 A;  5KE4 A;  4Z91 A;  3RHW A;  3ZDH A;  2C9T A;  4ILA A;  4F8H A;  5BP0 A;  5L4H A;  5AFN A;  2PH9 A;  5HEO A;  2XQ9 A;  3GUA A;  2WNC A;  2QC1 B;  4ZJS A;  5TVC A;  3U8N A;  3ZKR A;  4AFG A;  2Y56 A;  5AFL A;  3UUB A;  4ALX A;  4LMK A;  5AFM A;  2WZY A;  3EAM A;  2Y54 A;  4IL4 A;  2BR7 A;  4QH4 A;  3SQ6 A;  4XHE A;  4WV9 A;  4HFB A;  2X00 D;  2BYR A;  5SYO A;  5BRX A;  4QAA A;  5HCM A;  3SIO A;  5AFK A;  3UU8 A;  3UU3 A;  2YKS A;  5J0Z A;  3RI5 A;  3U8L A;  3U8J A;  3P50 A;  4LMJ A;  3WTH A;  2XQ8 A;  3C84 A;  3JAE A;  2XQ5 A;  4NPP A;  4HFC A;  4A98 A;  2BG9 B;  2W8G A;  3WTO A;  2BG9 A;  3T4M A;  4FRR A;  3U8K A;  3TLT A;  4D01 A;  4ZR6 A;  2WNL A;  5J5G A;  5FJV A;  5BW2 A;  3UQ4 A;  4HQP A;  2XQ7 A;  2YOE A;  1UV6 A;  1UX2 A;  4COF A;  4ZRU A;  3WTK A;  2BR8 A; 
#chains in the Genus database with same CATH homology
 4QAC A;  3U8M A;  3RQW A;  5J5F A;  2XZ6 A;  3WTN A;  4LML A;  3TLS A;  3TLV A;  4UM3 A;  3UU5 A;  2PGZ A;  2BYQ A;  2WNJ A;  4ZJT A;  4EZ1 A;  4UY2 A;  5J5I A;  4ZK1 A;  4UXU A;  3WTJ A;  2WN9 A;  4ZZC A;  2X00 A;  2XNV A;  4HFD A;  4TNV A;  2W8F A;  3LSV A;  2BYP A;  4TWH A;  2XQ3 A;  4PIR A;  4IL9 A;  3IGQ A;  3UU6 A;  4A97 A;  3JAF A;  4QH5 A;  3TLW A;  2BG9 E;  5CFB A;  3WTL A;  4B5D A;  4UM3 P;  3EHZ A;  4AFH A;  2VL0 A;  5LG3 A;  2BYN A;  4HFE A;  3RIA A;  4TWF A;  5IUX A;  2ZJU A;  4BFQ A;  4ILB A;  3UU4 A;  3WIP A;  2XYS A;  5JME A;  4UM3 S;  3TLU A;  4NZB A;  2Y58 A;  3UQ7 A;  2YMD A;  4X5T A;  4XK9 A;  3JAD A;  2Y57 A;  4HFH A;  4ILC A;  4Z90 A;  5HEU A;  2UZ6 A;  2XQ6 A;  2XYT A;  4HFI A;  2XQA A;  4DBM A;  5L47 A;  5HEG A;  5HCJ A;  4QH1 A;  2XQ4 A;  5AFM B;  3ZDG A;  5L4E A;  2YN6 A;  4BQT A;  2YME A;  5HEJ A;  2BJ0 A;  2Y7Y A;  5J5H A;  3WTM A;  3WTI A;  1I9B A;  2BYS A;  3P4W A;  4TNW A;  2XNT A;  3RIF A;  3SH1 A;  5AFJ A;  3RQU A;  4TWD A;  4QAB A;  4ZZB A;  2ZJV A;  3SQ9 A;  5AFH A;  2XNU A;  1UW6 A;  5KZU A;  5HEH A;  2BG9 C;  5LXB A;  4ZK4 A;  3C79 A;  4IRE A;  3PEO A;  4UM1 A;  5CO5 A;  4AFT A;  2XZ5 A;  3PMZ A;  5AIN A;  3EI0 A;  5KE4 A;  4Z91 A;  3RHW A;  3ZDH A;  2C9T A;  4ILA A;  4F8H A;  5BP0 A;  5L4H A;  5AFN A;  2PH9 A;  5HEO A;  2XQ9 A;  3GUA A;  2WNC A;  2QC1 B;  4ZJS A;  5TVC A;  3U8N A;  3ZKR A;  4AFG A;  2Y56 A;  5AFL A;  3UUB A;  4ALX A;  4LMK A;  5AFM A;  2WZY A;  3EAM A;  2Y54 A;  4IL4 A;  2BR7 A;  4QH4 A;  3SQ6 A;  4XHE A;  4WV9 A;  4HFB A;  2X00 D;  2BYR A;  5SYO A;  5BRX A;  4QAA A;  5HCM A;  3SIO A;  5AFK A;  3UU8 A;  3UU3 A;  2YKS A;  5J0Z A;  3RI5 A;  3U8L A;  3U8J A;  3P50 A;  4LMJ A;  3WTH A;  2XQ8 A;  3C84 A;  3JAE A;  2XQ5 A;  4NPP A;  4HFC A;  4A98 A;  2BG9 B;  2W8G A;  3WTO A;  2BG9 A;  3T4M A;  4FRR A;  3U8K A;  3TLT A;  4D01 A;  4ZR6 A;  2WNL A;  5J5G A;  5FJV A;  5BW2 A;  3UQ4 A;  4HQP A;  2XQ7 A;  2YOE A;  1UV6 A;  1UX2 A;  4COF A;  4ZRU A;  3WTK A;  2BR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...