2BYSA

Crystal structure of achbp from aplysia californica in complex with lobeline
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
205
Chain Sequence
b'SQANLMRLKSDLFNRSYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN
publication title Structures of Aplysia Achbp Complexes with Nicotinic Agonists and Antagonists Reveal Distinctive Binding Interfaces and Conformations.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 205
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bysA00
4WV9A 2Y7YA 4QH1A 3TLWA 2PH9A 3WTNA 4ZK4A 4UY2A 5J0ZA 2W8FA 2YMDA 4Z90A 3UU8A 2XYSA 5J5IA 2XQ9A 5CO5A 2VL0A 3ZDGA 3UU6A 3WTOA 2BYSA 2Y57A 3LSVA 5HCMA 4BFQA 4HFCA 3WTJA 4B5DA 5SYOA 4BQTA 3UQ7A 3WTLA 3U8NA 5HEHA 4LMJA 3U8LA 3RIFA 2BG9B 3JAEA 5AFHA 5BP0A 5AFMB 4UXUA 2YOEA 5HEUA 4A98A 5HCJA 3ZKRA 4UM3S 3RQWA 3P50A 1UV6A 2Y58A 5AFJA 3WTKA 3RIAA 3UU5A 4IL4A 4IL9A 5L4EA 4X5TA 2X00A 5J5HA 2UZ6A 4ILBA 3TLUA 2ZJVA 3GUAA 5JMEA 2QC1B 4ILCA 2XQ8A 2BG9C 4QH4A 4TNWA 3T4MA 3RQUA 3SQ9A 2X00D 2BG9E 4HFBA 5AFNA 2W8GA 3UUBA 5J5GA 3JADA 3EAMA 2BYQA 5AINA 3PEOA 4QABA 5L47A 3WTIA 2XQ6A 2BR7A 3SQ6A 4DBMA 4XHEA 5HEGA 4XK9A 5IUXA 4HFHA 2BR8A 1UX2A 4QAAA 3WTMA 4EZ1A 4F8HA 2XQAA 4COFA 4QH5A 3C79A 5LG3A 4ZZCA 2XNVA 3RI5A 4ZRUA 2Y56A 3TLTA 3PMZA 3UU3A 3SH1A 5BRXA 1I9BA 2XZ5A 2ZJUA 2WNJA 4D01A 4Z91A 5FJVA 4ZJTA 4FRRA 4ZJSA 4TWHA 1UW6A 5J5FA 2BYRA 3U8JA 4UM1A 4UM3P 2BG9A 4UM3A 2BYPA 2BYNA 5AFMA 2YN6A 4AFGA 4AFHA 3C84A 4TWDA 3EI0A 2PGZA 3U8MA 2XQ3A 4IREA 3WTHA 5BW2A 3SIOA 4NPPA 2BJ0A 4A97A 3WIPA 5AFLA 3TLSA 2XZ6A 3U8KA 5HEJA 5TVCA 5LXBA 4QACA 3RHWA 2Y54A 5KE4A 2XNTA 2WNLA 3IGQA 3P4WA 3UU4A 3EHZA 2WN9A 5HEOA 2XNUA 5AFKA 5CFBA 2XQ5A 5KZUA 3TLVA 4LMKA 3UQ4A 3JAFA 2C9TA 2XQ7A 4TWFA 4AFTA 2WNCA 4LMLA 4NZBA 4ZR6A 5L4HA 4ZK1A 2YKSA 4HFDA 4HQPA 4TNVA 4HFEA 4ALXA 4ZZBA 4PIRA 2XYTA 2XQ4A 4HFIA 3ZDHA 4ILAA 2WZYA 2YMEA
chains in the Genus database with same CATH superfamily
4WV9A 2Y7YA 4QH1A 3TLWA 2PH9A 3WTNA 4ZK4A 4UY2A 5J0ZA 2W8FA 2YMDA 4Z90A 3UU8A 2XYSA 5J5IA 2XQ9A 5CO5A 2VL0A 3ZDGA 3UU6A 3WTOA 2BYSA 2Y57A 3LSVA 5HCMA 4BFQA 4HFCA 3WTJA 4B5DA 5SYOA 4BQTA 3UQ7A 3WTLA 3U8NA 5HEHA 4LMJA 3U8LA 3RIFA 2BG9B 3JAEA 5AFHA 5BP0A 5AFMB 4UXUA 2YOEA 5HEUA 4A98A 5HCJA 3ZKRA 4UM3S 3RQWA 3P50A 1UV6A 2Y58A 5AFJA 3WTKA 3RIAA 3UU5A 4IL4A 4IL9A 5L4EA 4X5TA 2X00A 5J5HA 2UZ6A 4ILBA 3TLUA 2ZJVA 3GUAA 5JMEA 2QC1B 4ILCA 2XQ8A 2BG9C 4QH4A 4TNWA 3T4MA 3RQUA 3SQ9A 2X00D 2BG9E 4HFBA 5AFNA 2W8GA 3UUBA 5J5GA 3JADA 3EAMA 2BYQA 5AINA 3PEOA 4QABA 5L47A 3WTIA 2XQ6A 2BR7A 3SQ6A 4DBMA 4XHEA 5HEGA 4XK9A 5IUXA 4HFHA 2BR8A 1UX2A 4QAAA 3WTMA 4EZ1A 4F8HA 2XQAA 4COFA 4QH5A 3C79A 5LG3A 4ZZCA 2XNVA 3RI5A 4ZRUA 2Y56A 3TLTA 3PMZA 3UU3A 3SH1A 5BRXA 1I9BA 2XZ5A 2ZJUA 2WNJA 4D01A 4Z91A 5FJVA 4ZJTA 4FRRA 4ZJSA 4TWHA 1UW6A 5J5FA 2BYRA 3U8JA 4UM1A 4UM3P 2BG9A 4UM3A 2BYPA 2BYNA 5AFMA 2YN6A 4AFGA 4AFHA 3C84A 4TWDA 3EI0A 2PGZA 3U8MA 2XQ3A 4IREA 3WTHA 5BW2A 3SIOA 4NPPA 2BJ0A 4A97A 3WIPA 5AFLA 3TLSA 2XZ6A 3U8KA 5HEJA 5TVCA 5LXBA 4QACA 3RHWA 2Y54A 5KE4A 2XNTA 2WNLA 3IGQA 3P4WA 3UU4A 3EHZA 2WN9A 5HEOA 2XNUA 5AFKA 5CFBA 2XQ5A 5KZUA 3TLVA 4LMKA 3UQ4A 3JAFA 2C9TA 2XQ7A 4TWFA 4AFTA 2WNCA 4LMLA 4NZBA 4ZR6A 5L4HA 4ZK1A 2YKSA 4HFDA 4HQPA 4TNVA 4HFEA 4ALXA 4ZZBA 4PIRA 2XYTA 2XQ4A 4HFIA 3ZDHA 4ILAA 2WZYA 2YMEA
chains in the Genus database with same CATH topology
4WV9A 2Y7YA 4QH1A 3TLWA 2PH9A 3WTNA 4ZK4A 4UY2A 5J0ZA 2W8FA 2YMDA 4Z90A 3UU8A 2XYSA 5J5IA 2XQ9A 5CO5A 2VL0A 3ZDGA 3UU6A 3WTOA 2BYSA 2Y57A 3LSVA 5HCMA 4BFQA 4HFCA 3WTJA 4B5DA 5SYOA 4BQTA 3UQ7A 3WTLA 3U8NA 5HEHA 4LMJA 3U8LA 3RIFA 2BG9B 3JAEA 5AFHA 5BP0A 5AFMB 4UXUA 2YOEA 5HEUA 4A98A 5HCJA 3ZKRA 4UM3S 3RQWA 3P50A 1UV6A 2Y58A 5AFJA 3WTKA 3RIAA 3UU5A 4IL4A 4IL9A 5L4EA 4X5TA 2X00A 5J5HA 2UZ6A 4ILBA 3TLUA 2ZJVA 3GUAA 5JMEA 2QC1B 4ILCA 2XQ8A 2BG9C 4QH4A 4TNWA 3T4MA 3RQUA 3SQ9A 2X00D 2BG9E 4HFBA 5AFNA 2W8GA 3UUBA 5J5GA 3JADA 3EAMA 2BYQA 5AINA 3PEOA 4QABA 5L47A 3WTIA 2XQ6A 2BR7A 3SQ6A 4DBMA 4XHEA 5HEGA 4XK9A 5IUXA 4HFHA 2BR8A 1UX2A 4QAAA 3WTMA 4EZ1A 4F8HA 2XQAA 4COFA 4QH5A 3C79A 5LG3A 4ZZCA 2XNVA 3RI5A 4ZRUA 2Y56A 3TLTA 3PMZA 3UU3A 3SH1A 5BRXA 1I9BA 2XZ5A 2ZJUA 2WNJA 4D01A 4Z91A 5FJVA 4ZJTA 4FRRA 4ZJSA 4TWHA 1UW6A 5J5FA 2BYRA 3U8JA 4UM1A 4UM3P 2BG9A 4UM3A 2BYPA 2BYNA 5AFMA 2YN6A 4AFGA 4AFHA 3C84A 4TWDA 3EI0A 2PGZA 3U8MA 2XQ3A 4IREA 3WTHA 5BW2A 3SIOA 4NPPA 2BJ0A 4A97A 3WIPA 5AFLA 3TLSA 2XZ6A 3U8KA 5HEJA 5TVCA 5LXBA 4QACA 3RHWA 2Y54A 5KE4A 2XNTA 2WNLA 3IGQA 3P4WA 3UU4A 3EHZA 2WN9A 5HEOA 2XNUA 5AFKA 5CFBA 2XQ5A 5KZUA 3TLVA 4LMKA 3UQ4A 3JAFA 2C9TA 2XQ7A 4TWFA 4AFTA 2WNCA 4LMLA 4NZBA 4ZR6A 5L4HA 4ZK1A 2YKSA 4HFDA 4HQPA 4TNVA 4HFEA 4ALXA 4ZZBA 4PIRA 2XYTA 2XQ4A 4HFIA 3ZDHA 4ILAA 2WZYA 2YMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV9 A;  2Y7Y A;  4QH1 A;  3TLW A;  2PH9 A;  3WTN A;  4ZK4 A;  4UY2 A;  5J0Z A;  2W8F A;  2YMD A;  4Z90 A;  3UU8 A;  2XYS A;  5J5I A;  2XQ9 A;  5CO5 A;  2VL0 A;  3ZDG A;  3UU6 A;  3WTO A;  2BYS A;  2Y57 A;  3LSV A;  5HCM A;  4BFQ A;  4HFC A;  3WTJ A;  4B5D A;  5SYO A;  4BQT A;  3UQ7 A;  3WTL A;  3U8N A;  5HEH A;  4LMJ A;  3U8L A;  3RIF A;  2BG9 B;  3JAE A;  5AFH A;  5BP0 A;  5AFM B;  4UXU A;  2YOE A;  5HEU A;  4A98 A;  5HCJ A;  3ZKR A;  4UM3 S;  3RQW A;  3P50 A;  1UV6 A;  2Y58 A;  5AFJ A;  3WTK A;  3RIA A;  3UU5 A;  4IL4 A;  4IL9 A;  5L4E A;  4X5T A;  2X00 A;  5J5H A;  2UZ6 A;  4ILB A;  3TLU A;  2ZJV A;  3GUA A;  5JME A;  2QC1 B;  4ILC A;  2XQ8 A;  2BG9 C;  4QH4 A;  4TNW A;  3T4M A;  3RQU A;  3SQ9 A;  2X00 D;  2BG9 E;  4HFB A;  5AFN A;  2W8G A;  3UUB A;  5J5G A;  3JAD A;  3EAM A;  2BYQ A;  5AIN A;  3PEO A;  4QAB A;  5L47 A;  3WTI A;  2XQ6 A;  2BR7 A;  3SQ6 A;  4DBM A;  4XHE A;  5HEG A;  4XK9 A;  5IUX A;  4HFH A;  2BR8 A;  1UX2 A;  4QAA A;  3WTM A;  4EZ1 A;  4F8H A;  2XQA A;  4COF A;  4QH5 A;  3C79 A;  5LG3 A;  4ZZC A;  2XNV A;  3RI5 A;  4ZRU A;  2Y56 A;  3TLT A;  3PMZ A;  3UU3 A;  3SH1 A;  5BRX A;  1I9B A;  2XZ5 A;  2ZJU A;  2WNJ A;  4D01 A;  4Z91 A;  5FJV A;  4ZJT A;  4FRR A;  4ZJS A;  4TWH A;  1UW6 A;  5J5F A;  2BYR A;  3U8J A;  4UM1 A;  4UM3 P;  2BG9 A;  4UM3 A;  2BYP A;  2BYN A;  5AFM A;  2YN6 A;  4AFG A;  4AFH A;  3C84 A;  4TWD A;  3EI0 A;  2PGZ A;  3U8M A;  2XQ3 A;  4IRE A;  3WTH A;  5BW2 A;  3SIO A;  4NPP A;  2BJ0 A;  4A97 A;  3WIP A;  5AFL A;  3TLS A;  2XZ6 A;  3U8K A;  5HEJ A;  5TVC A;  5LXB A;  4QAC A;  3RHW A;  2Y54 A;  5KE4 A;  2XNT A;  2WNL A;  3IGQ A;  3P4W A;  3UU4 A;  3EHZ A;  2WN9 A;  5HEO A;  2XNU A;  5AFK A;  5CFB A;  2XQ5 A;  5KZU A;  3TLV A;  4LMK A;  3UQ4 A;  3JAF A;  2C9T A;  2XQ7 A;  4TWF A;  4AFT A;  2WNC A;  4LML A;  4NZB A;  4ZR6 A;  5L4H A;  4ZK1 A;  2YKS A;  4HFD A;  4HQP A;  4TNV A;  4HFE A;  4ALX A;  4ZZB A;  4PIR A;  2XYT A;  2XQ4 A;  4HFI A;  3ZDH A;  4ILA A;  2WZY A;  2YME A; 
#chains in the Genus database with same CATH topology
 4WV9 A;  2Y7Y A;  4QH1 A;  3TLW A;  2PH9 A;  3WTN A;  4ZK4 A;  4UY2 A;  5J0Z A;  2W8F A;  2YMD A;  4Z90 A;  3UU8 A;  2XYS A;  5J5I A;  2XQ9 A;  5CO5 A;  2VL0 A;  3ZDG A;  3UU6 A;  3WTO A;  2BYS A;  2Y57 A;  3LSV A;  5HCM A;  4BFQ A;  4HFC A;  3WTJ A;  4B5D A;  5SYO A;  4BQT A;  3UQ7 A;  3WTL A;  3U8N A;  5HEH A;  4LMJ A;  3U8L A;  3RIF A;  2BG9 B;  3JAE A;  5AFH A;  5BP0 A;  5AFM B;  4UXU A;  2YOE A;  5HEU A;  4A98 A;  5HCJ A;  3ZKR A;  4UM3 S;  3RQW A;  3P50 A;  1UV6 A;  2Y58 A;  5AFJ A;  3WTK A;  3RIA A;  3UU5 A;  4IL4 A;  4IL9 A;  5L4E A;  4X5T A;  2X00 A;  5J5H A;  2UZ6 A;  4ILB A;  3TLU A;  2ZJV A;  3GUA A;  5JME A;  2QC1 B;  4ILC A;  2XQ8 A;  2BG9 C;  4QH4 A;  4TNW A;  3T4M A;  3RQU A;  3SQ9 A;  2X00 D;  2BG9 E;  4HFB A;  5AFN A;  2W8G A;  3UUB A;  5J5G A;  3JAD A;  3EAM A;  2BYQ A;  5AIN A;  3PEO A;  4QAB A;  5L47 A;  3WTI A;  2XQ6 A;  2BR7 A;  3SQ6 A;  4DBM A;  4XHE A;  5HEG A;  4XK9 A;  5IUX A;  4HFH A;  2BR8 A;  1UX2 A;  4QAA A;  3WTM A;  4EZ1 A;  4F8H A;  2XQA A;  4COF A;  4QH5 A;  3C79 A;  5LG3 A;  4ZZC A;  2XNV A;  3RI5 A;  4ZRU A;  2Y56 A;  3TLT A;  3PMZ A;  3UU3 A;  3SH1 A;  5BRX A;  1I9B A;  2XZ5 A;  2ZJU A;  2WNJ A;  4D01 A;  4Z91 A;  5FJV A;  4ZJT A;  4FRR A;  4ZJS A;  4TWH A;  1UW6 A;  5J5F A;  2BYR A;  3U8J A;  4UM1 A;  4UM3 P;  2BG9 A;  4UM3 A;  2BYP A;  2BYN A;  5AFM A;  2YN6 A;  4AFG A;  4AFH A;  3C84 A;  4TWD A;  3EI0 A;  2PGZ A;  3U8M A;  2XQ3 A;  4IRE A;  3WTH A;  5BW2 A;  3SIO A;  4NPP A;  2BJ0 A;  4A97 A;  3WIP A;  5AFL A;  3TLS A;  2XZ6 A;  3U8K A;  5HEJ A;  5TVC A;  5LXB A;  4QAC A;  3RHW A;  2Y54 A;  5KE4 A;  2XNT A;  2WNL A;  3IGQ A;  3P4W A;  3UU4 A;  3EHZ A;  2WN9 A;  5HEO A;  2XNU A;  5AFK A;  5CFB A;  2XQ5 A;  5KZU A;  3TLV A;  4LMK A;  3UQ4 A;  3JAF A;  2C9T A;  2XQ7 A;  4TWF A;  4AFT A;  2WNC A;  4LML A;  4NZB A;  4ZR6 A;  5L4H A;  4ZK1 A;  2YKS A;  4HFD A;  4HQP A;  4TNV A;  4HFE A;  4ALX A;  4ZZB A;  4PIR A;  2XYT A;  2XQ4 A;  4HFI A;  3ZDH A;  4ILA A;  2WZY A;  2YME A; 
#chains in the Genus database with same CATH homology
 4WV9 A;  2Y7Y A;  4QH1 A;  3TLW A;  2PH9 A;  3WTN A;  4ZK4 A;  4UY2 A;  5J0Z A;  2W8F A;  2YMD A;  4Z90 A;  3UU8 A;  2XYS A;  5J5I A;  2XQ9 A;  5CO5 A;  2VL0 A;  3ZDG A;  3UU6 A;  3WTO A;  2BYS A;  2Y57 A;  3LSV A;  5HCM A;  4BFQ A;  4HFC A;  3WTJ A;  4B5D A;  5SYO A;  4BQT A;  3UQ7 A;  3WTL A;  3U8N A;  5HEH A;  4LMJ A;  3U8L A;  3RIF A;  2BG9 B;  3JAE A;  5AFH A;  5BP0 A;  5AFM B;  4UXU A;  2YOE A;  5HEU A;  4A98 A;  5HCJ A;  3ZKR A;  4UM3 S;  3RQW A;  3P50 A;  1UV6 A;  2Y58 A;  5AFJ A;  3WTK A;  3RIA A;  3UU5 A;  4IL4 A;  4IL9 A;  5L4E A;  4X5T A;  2X00 A;  5J5H A;  2UZ6 A;  4ILB A;  3TLU A;  2ZJV A;  3GUA A;  5JME A;  2QC1 B;  4ILC A;  2XQ8 A;  2BG9 C;  4QH4 A;  4TNW A;  3T4M A;  3RQU A;  3SQ9 A;  2X00 D;  2BG9 E;  4HFB A;  5AFN A;  2W8G A;  3UUB A;  5J5G A;  3JAD A;  3EAM A;  2BYQ A;  5AIN A;  3PEO A;  4QAB A;  5L47 A;  3WTI A;  2XQ6 A;  2BR7 A;  3SQ6 A;  4DBM A;  4XHE A;  5HEG A;  4XK9 A;  5IUX A;  4HFH A;  2BR8 A;  1UX2 A;  4QAA A;  3WTM A;  4EZ1 A;  4F8H A;  2XQA A;  4COF A;  4QH5 A;  3C79 A;  5LG3 A;  4ZZC A;  2XNV A;  3RI5 A;  4ZRU A;  2Y56 A;  3TLT A;  3PMZ A;  3UU3 A;  3SH1 A;  5BRX A;  1I9B A;  2XZ5 A;  2ZJU A;  2WNJ A;  4D01 A;  4Z91 A;  5FJV A;  4ZJT A;  4FRR A;  4ZJS A;  4TWH A;  1UW6 A;  5J5F A;  2BYR A;  3U8J A;  4UM1 A;  4UM3 P;  2BG9 A;  4UM3 A;  2BYP A;  2BYN A;  5AFM A;  2YN6 A;  4AFG A;  4AFH A;  3C84 A;  4TWD A;  3EI0 A;  2PGZ A;  3U8M A;  2XQ3 A;  4IRE A;  3WTH A;  5BW2 A;  3SIO A;  4NPP A;  2BJ0 A;  4A97 A;  3WIP A;  5AFL A;  3TLS A;  2XZ6 A;  3U8K A;  5HEJ A;  5TVC A;  5LXB A;  4QAC A;  3RHW A;  2Y54 A;  5KE4 A;  2XNT A;  2WNL A;  3IGQ A;  3P4W A;  3UU4 A;  3EHZ A;  2WN9 A;  5HEO A;  2XNU A;  5AFK A;  5CFB A;  2XQ5 A;  5KZU A;  3TLV A;  4LMK A;  3UQ4 A;  3JAF A;  2C9T A;  2XQ7 A;  4TWF A;  4AFT A;  2WNC A;  4LML A;  4NZB A;  4ZR6 A;  5L4H A;  4ZK1 A;  2YKS A;  4HFD A;  4HQP A;  4TNV A;  4HFE A;  4ALX A;  4ZZB A;  4PIR A;  2XYT A;  2XQ4 A;  4HFI A;  3ZDH A;  4ILA A;  2WZY A;  2YME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...