4EZ1A

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with alpha-conotoxin buia
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
203
Chain Sequence
LHSQANLMRLKSDLMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Pairwise interaction of alpha-conotoxin BuIA Pro6 with the beta subunit of nicotinic acetylcholine receptor
rcsb
source organism Aplysia californica
molecule tags Choline binding protein/toxin
total genus 50
structure length 203
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ez1A00
4A98A 4BFQA 3IGQA 4HFIA 5HEGA 5HEOA 4ZJTA 3RQUA 4TWFA 4TNVA 5AINA 3UQ4A 4IL9A 2PGZA 5L47A 4ILAA 3ZDGA 2BG9B 3RHWA 2QC1B 2XYTA 3U8NA 5LG3A 3PEOA 4ZR6A 5JMEA 2BYPA 4ILBA 3WTOA 4EZ1A 4XHEA 3U8LA 3WTJA 5AFMB 3C79A 4BQTA 4D01A 2BR7A 3P50A 4UM3A 2Y54A 4UM1A 3RIAA 3JAFA 5KE4A 5HEHA 5HCMA 4HFDA 4QH1A 2BJ0A 3UU5A 2XNTA 2XQ7A 3UU8A 4Z91A 3P4WA 4HFHA 2XYSA 5HCJA 5AFJA 3WTNA 4AFHA 3JADA 4HFEA 3WTHA 4WV9A 4QH5A 3U8KA 5KZUA 3EHZA 4IL4A 1UW6A 4DBMA 2ZJVA 3LSVA 2WNLA 5AFHA 4COFA 2XQ6A 4B5DA 5HEJA 4HFBA 4TWDA 3ZDHA 4UM3P 2BG9E 4AFGA 3SQ6A 5BW2A 2BG9C 5CO5A 5TVCA 5AFLA 5J5HA 5LXBA 5J0ZA 4IREA 5IUXA 4QAAA 3UU4A 1I9BA 2BYQA 3GUAA 5J5GA 2X00D 2XQ4A 3UQ7A 2XNUA 2W8FA 4UM3S 2XQ5A 2UZ6A 3SIOA 4HQPA 4NPPA 5J5IA 2YOEA 2YN6A 2XQ3A 3EI0A 4LMLA 3RIFA 3EAMA 3WIPA 4ALXA 2XQ8A 4LMKA 4Z90A 5BP0A 3RI5A 3T4MA 2WN9A 2XQ9A 4LMJA 3U8MA 4A97A 2PH9A 3RQWA 2YMEA 5L4HA 4QH4A 5AFNA 2WNCA 4FRRA 3WTLA 5AFMA 4TWHA 2XZ5A 3UUBA 3UU6A 4NZBA 2WZYA 2W8GA 3UU3A 2X00A 2XQAA 5AFKA 3TLVA 3SQ9A 5FJVA 3U8JA 5HEUA 5BRXA 2BYRA 4TNWA 1UX2A 2Y7YA 4ZZCA 2XZ6A 4ZJSA 2Y57A 2YMDA 3TLUA 4UXUA 3WTIA 2C9TA 3TLSA 4F8HA 1UV6A 2VL0A 4ILCA 5SYOA 2BG9A 2BYNA 2BYSA 2XNVA 2Y58A 3SH1A 4HFCA 4PIRA 4ZK1A 4XK9A 4QABA 4UY2A 3TLWA 3WTMA 2WNJA 3TLTA 4ZZBA 5J5FA 3JAEA 2BR8A 2Y56A 4X5TA 3ZKRA 3WTKA 4ZK4A 4AFTA 2YKSA 4ZRUA 5L4EA 4QACA 5CFBA 2ZJUA 3PMZA 3C84A
chains in the Genus database with same CATH superfamily
4A98A 4BFQA 3IGQA 4HFIA 5HEGA 5HEOA 4ZJTA 3RQUA 4TWFA 4TNVA 5AINA 3UQ4A 4IL9A 2PGZA 5L47A 4ILAA 3ZDGA 2BG9B 3RHWA 2QC1B 2XYTA 3U8NA 5LG3A 3PEOA 4ZR6A 5JMEA 2BYPA 4ILBA 3WTOA 4EZ1A 4XHEA 3U8LA 3WTJA 5AFMB 3C79A 4BQTA 4D01A 2BR7A 3P50A 4UM3A 2Y54A 4UM1A 3RIAA 3JAFA 5KE4A 5HEHA 5HCMA 4HFDA 4QH1A 2BJ0A 3UU5A 2XNTA 2XQ7A 3UU8A 4Z91A 3P4WA 4HFHA 2XYSA 5HCJA 5AFJA 3WTNA 4AFHA 3JADA 4HFEA 3WTHA 4WV9A 4QH5A 3U8KA 5KZUA 3EHZA 4IL4A 1UW6A 4DBMA 2ZJVA 3LSVA 2WNLA 5AFHA 4COFA 2XQ6A 4B5DA 5HEJA 4HFBA 4TWDA 3ZDHA 4UM3P 2BG9E 4AFGA 3SQ6A 5BW2A 2BG9C 5CO5A 5TVCA 5AFLA 5J5HA 5LXBA 5J0ZA 4IREA 5IUXA 4QAAA 3UU4A 1I9BA 2BYQA 3GUAA 5J5GA 2X00D 2XQ4A 3UQ7A 2XNUA 2W8FA 4UM3S 2XQ5A 2UZ6A 3SIOA 4HQPA 4NPPA 5J5IA 2YOEA 2YN6A 2XQ3A 3EI0A 4LMLA 3RIFA 3EAMA 3WIPA 4ALXA 2XQ8A 4LMKA 4Z90A 5BP0A 3RI5A 3T4MA 2WN9A 2XQ9A 4LMJA 3U8MA 4A97A 2PH9A 3RQWA 2YMEA 5L4HA 4QH4A 5AFNA 2WNCA 4FRRA 3WTLA 5AFMA 4TWHA 2XZ5A 3UUBA 3UU6A 4NZBA 2WZYA 2W8GA 3UU3A 2X00A 2XQAA 5AFKA 3TLVA 3SQ9A 5FJVA 3U8JA 5HEUA 5BRXA 2BYRA 4TNWA 1UX2A 2Y7YA 4ZZCA 2XZ6A 4ZJSA 2Y57A 2YMDA 3TLUA 4UXUA 3WTIA 2C9TA 3TLSA 4F8HA 1UV6A 2VL0A 4ILCA 5SYOA 2BG9A 2BYNA 2BYSA 2XNVA 2Y58A 3SH1A 4HFCA 4PIRA 4ZK1A 4XK9A 4QABA 4UY2A 3TLWA 3WTMA 2WNJA 3TLTA 4ZZBA 5J5FA 3JAEA 2BR8A 2Y56A 4X5TA 3ZKRA 3WTKA 4ZK4A 4AFTA 2YKSA 4ZRUA 5L4EA 4QACA 5CFBA 2ZJUA 3PMZA 3C84A
chains in the Genus database with same CATH topology
4A98A 4BFQA 3IGQA 4HFIA 5HEGA 5HEOA 4ZJTA 3RQUA 4TWFA 4TNVA 5AINA 3UQ4A 4IL9A 2PGZA 5L47A 4ILAA 3ZDGA 2BG9B 3RHWA 2QC1B 2XYTA 3U8NA 5LG3A 3PEOA 4ZR6A 5JMEA 2BYPA 4ILBA 3WTOA 4EZ1A 4XHEA 3U8LA 3WTJA 5AFMB 3C79A 4BQTA 4D01A 2BR7A 3P50A 4UM3A 2Y54A 4UM1A 3RIAA 3JAFA 5KE4A 5HEHA 5HCMA 4HFDA 4QH1A 2BJ0A 3UU5A 2XNTA 2XQ7A 3UU8A 4Z91A 3P4WA 4HFHA 2XYSA 5HCJA 5AFJA 3WTNA 4AFHA 3JADA 4HFEA 3WTHA 4WV9A 4QH5A 3U8KA 5KZUA 3EHZA 4IL4A 1UW6A 4DBMA 2ZJVA 3LSVA 2WNLA 5AFHA 4COFA 2XQ6A 4B5DA 5HEJA 4HFBA 4TWDA 3ZDHA 4UM3P 2BG9E 4AFGA 3SQ6A 5BW2A 2BG9C 5CO5A 5TVCA 5AFLA 5J5HA 5LXBA 5J0ZA 4IREA 5IUXA 4QAAA 3UU4A 1I9BA 2BYQA 3GUAA 5J5GA 2X00D 2XQ4A 3UQ7A 2XNUA 2W8FA 4UM3S 2XQ5A 2UZ6A 3SIOA 4HQPA 4NPPA 5J5IA 2YOEA 2YN6A 2XQ3A 3EI0A 4LMLA 3RIFA 3EAMA 3WIPA 4ALXA 2XQ8A 4LMKA 4Z90A 5BP0A 3RI5A 3T4MA 2WN9A 2XQ9A 4LMJA 3U8MA 4A97A 2PH9A 3RQWA 2YMEA 5L4HA 4QH4A 5AFNA 2WNCA 4FRRA 3WTLA 5AFMA 4TWHA 2XZ5A 3UUBA 3UU6A 4NZBA 2WZYA 2W8GA 3UU3A 2X00A 2XQAA 5AFKA 3TLVA 3SQ9A 5FJVA 3U8JA 5HEUA 5BRXA 2BYRA 4TNWA 1UX2A 2Y7YA 4ZZCA 2XZ6A 4ZJSA 2Y57A 2YMDA 3TLUA 4UXUA 3WTIA 2C9TA 3TLSA 4F8HA 1UV6A 2VL0A 4ILCA 5SYOA 2BG9A 2BYNA 2BYSA 2XNVA 2Y58A 3SH1A 4HFCA 4PIRA 4ZK1A 4XK9A 4QABA 4UY2A 3TLWA 3WTMA 2WNJA 3TLTA 4ZZBA 5J5FA 3JAEA 2BR8A 2Y56A 4X5TA 3ZKRA 3WTKA 4ZK4A 4AFTA 2YKSA 4ZRUA 5L4EA 4QACA 5CFBA 2ZJUA 3PMZA 3C84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A98 A;  4BFQ A;  3IGQ A;  4HFI A;  5HEG A;  5HEO A;  4ZJT A;  3RQU A;  4TWF A;  4TNV A;  5AIN A;  3UQ4 A;  4IL9 A;  2PGZ A;  5L47 A;  4ILA A;  3ZDG A;  2BG9 B;  3RHW A;  2QC1 B;  2XYT A;  3U8N A;  5LG3 A;  3PEO A;  4ZR6 A;  5JME A;  2BYP A;  4ILB A;  3WTO A;  4EZ1 A;  4XHE A;  3U8L A;  3WTJ A;  5AFM B;  3C79 A;  4BQT A;  4D01 A;  2BR7 A;  3P50 A;  4UM3 A;  2Y54 A;  4UM1 A;  3RIA A;  3JAF A;  5KE4 A;  5HEH A;  5HCM A;  4HFD A;  4QH1 A;  2BJ0 A;  3UU5 A;  2XNT A;  2XQ7 A;  3UU8 A;  4Z91 A;  3P4W A;  4HFH A;  2XYS A;  5HCJ A;  5AFJ A;  3WTN A;  4AFH A;  3JAD A;  4HFE A;  3WTH A;  4WV9 A;  4QH5 A;  3U8K A;  5KZU A;  3EHZ A;  4IL4 A;  1UW6 A;  4DBM A;  2ZJV A;  3LSV A;  2WNL A;  5AFH A;  4COF A;  2XQ6 A;  4B5D A;  5HEJ A;  4HFB A;  4TWD A;  3ZDH A;  4UM3 P;  2BG9 E;  4AFG A;  3SQ6 A;  5BW2 A;  2BG9 C;  5CO5 A;  5TVC A;  5AFL A;  5J5H A;  5LXB A;  5J0Z A;  4IRE A;  5IUX A;  4QAA A;  3UU4 A;  1I9B A;  2BYQ A;  3GUA A;  5J5G A;  2X00 D;  2XQ4 A;  3UQ7 A;  2XNU A;  2W8F A;  4UM3 S;  2XQ5 A;  2UZ6 A;  3SIO A;  4HQP A;  4NPP A;  5J5I A;  2YOE A;  2YN6 A;  2XQ3 A;  3EI0 A;  4LML A;  3RIF A;  3EAM A;  3WIP A;  4ALX A;  2XQ8 A;  4LMK A;  4Z90 A;  5BP0 A;  3RI5 A;  3T4M A;  2WN9 A;  2XQ9 A;  4LMJ A;  3U8M A;  4A97 A;  2PH9 A;  3RQW A;  2YME A;  5L4H A;  4QH4 A;  5AFN A;  2WNC A;  4FRR A;  3WTL A;  5AFM A;  4TWH A;  2XZ5 A;  3UUB A;  3UU6 A;  4NZB A;  2WZY A;  2W8G A;  3UU3 A;  2X00 A;  2XQA A;  5AFK A;  3TLV A;  3SQ9 A;  5FJV A;  3U8J A;  5HEU A;  5BRX A;  2BYR A;  4TNW A;  1UX2 A;  2Y7Y A;  4ZZC A;  2XZ6 A;  4ZJS A;  2Y57 A;  2YMD A;  3TLU A;  4UXU A;  3WTI A;  2C9T A;  3TLS A;  4F8H A;  1UV6 A;  2VL0 A;  4ILC A;  5SYO A;  2BG9 A;  2BYN A;  2BYS A;  2XNV A;  2Y58 A;  3SH1 A;  4HFC A;  4PIR A;  4ZK1 A;  4XK9 A;  4QAB A;  4UY2 A;  3TLW A;  3WTM A;  2WNJ A;  3TLT A;  4ZZB A;  5J5F A;  3JAE A;  2BR8 A;  2Y56 A;  4X5T A;  3ZKR A;  3WTK A;  4ZK4 A;  4AFT A;  2YKS A;  4ZRU A;  5L4E A;  4QAC A;  5CFB A;  2ZJU A;  3PMZ A;  3C84 A; 
#chains in the Genus database with same CATH topology
 4A98 A;  4BFQ A;  3IGQ A;  4HFI A;  5HEG A;  5HEO A;  4ZJT A;  3RQU A;  4TWF A;  4TNV A;  5AIN A;  3UQ4 A;  4IL9 A;  2PGZ A;  5L47 A;  4ILA A;  3ZDG A;  2BG9 B;  3RHW A;  2QC1 B;  2XYT A;  3U8N A;  5LG3 A;  3PEO A;  4ZR6 A;  5JME A;  2BYP A;  4ILB A;  3WTO A;  4EZ1 A;  4XHE A;  3U8L A;  3WTJ A;  5AFM B;  3C79 A;  4BQT A;  4D01 A;  2BR7 A;  3P50 A;  4UM3 A;  2Y54 A;  4UM1 A;  3RIA A;  3JAF A;  5KE4 A;  5HEH A;  5HCM A;  4HFD A;  4QH1 A;  2BJ0 A;  3UU5 A;  2XNT A;  2XQ7 A;  3UU8 A;  4Z91 A;  3P4W A;  4HFH A;  2XYS A;  5HCJ A;  5AFJ A;  3WTN A;  4AFH A;  3JAD A;  4HFE A;  3WTH A;  4WV9 A;  4QH5 A;  3U8K A;  5KZU A;  3EHZ A;  4IL4 A;  1UW6 A;  4DBM A;  2ZJV A;  3LSV A;  2WNL A;  5AFH A;  4COF A;  2XQ6 A;  4B5D A;  5HEJ A;  4HFB A;  4TWD A;  3ZDH A;  4UM3 P;  2BG9 E;  4AFG A;  3SQ6 A;  5BW2 A;  2BG9 C;  5CO5 A;  5TVC A;  5AFL A;  5J5H A;  5LXB A;  5J0Z A;  4IRE A;  5IUX A;  4QAA A;  3UU4 A;  1I9B A;  2BYQ A;  3GUA A;  5J5G A;  2X00 D;  2XQ4 A;  3UQ7 A;  2XNU A;  2W8F A;  4UM3 S;  2XQ5 A;  2UZ6 A;  3SIO A;  4HQP A;  4NPP A;  5J5I A;  2YOE A;  2YN6 A;  2XQ3 A;  3EI0 A;  4LML A;  3RIF A;  3EAM A;  3WIP A;  4ALX A;  2XQ8 A;  4LMK A;  4Z90 A;  5BP0 A;  3RI5 A;  3T4M A;  2WN9 A;  2XQ9 A;  4LMJ A;  3U8M A;  4A97 A;  2PH9 A;  3RQW A;  2YME A;  5L4H A;  4QH4 A;  5AFN A;  2WNC A;  4FRR A;  3WTL A;  5AFM A;  4TWH A;  2XZ5 A;  3UUB A;  3UU6 A;  4NZB A;  2WZY A;  2W8G A;  3UU3 A;  2X00 A;  2XQA A;  5AFK A;  3TLV A;  3SQ9 A;  5FJV A;  3U8J A;  5HEU A;  5BRX A;  2BYR A;  4TNW A;  1UX2 A;  2Y7Y A;  4ZZC A;  2XZ6 A;  4ZJS A;  2Y57 A;  2YMD A;  3TLU A;  4UXU A;  3WTI A;  2C9T A;  3TLS A;  4F8H A;  1UV6 A;  2VL0 A;  4ILC A;  5SYO A;  2BG9 A;  2BYN A;  2BYS A;  2XNV A;  2Y58 A;  3SH1 A;  4HFC A;  4PIR A;  4ZK1 A;  4XK9 A;  4QAB A;  4UY2 A;  3TLW A;  3WTM A;  2WNJ A;  3TLT A;  4ZZB A;  5J5F A;  3JAE A;  2BR8 A;  2Y56 A;  4X5T A;  3ZKR A;  3WTK A;  4ZK4 A;  4AFT A;  2YKS A;  4ZRU A;  5L4E A;  4QAC A;  5CFB A;  2ZJU A;  3PMZ A;  3C84 A; 
#chains in the Genus database with same CATH homology
 4A98 A;  4BFQ A;  3IGQ A;  4HFI A;  5HEG A;  5HEO A;  4ZJT A;  3RQU A;  4TWF A;  4TNV A;  5AIN A;  3UQ4 A;  4IL9 A;  2PGZ A;  5L47 A;  4ILA A;  3ZDG A;  2BG9 B;  3RHW A;  2QC1 B;  2XYT A;  3U8N A;  5LG3 A;  3PEO A;  4ZR6 A;  5JME A;  2BYP A;  4ILB A;  3WTO A;  4EZ1 A;  4XHE A;  3U8L A;  3WTJ A;  5AFM B;  3C79 A;  4BQT A;  4D01 A;  2BR7 A;  3P50 A;  4UM3 A;  2Y54 A;  4UM1 A;  3RIA A;  3JAF A;  5KE4 A;  5HEH A;  5HCM A;  4HFD A;  4QH1 A;  2BJ0 A;  3UU5 A;  2XNT A;  2XQ7 A;  3UU8 A;  4Z91 A;  3P4W A;  4HFH A;  2XYS A;  5HCJ A;  5AFJ A;  3WTN A;  4AFH A;  3JAD A;  4HFE A;  3WTH A;  4WV9 A;  4QH5 A;  3U8K A;  5KZU A;  3EHZ A;  4IL4 A;  1UW6 A;  4DBM A;  2ZJV A;  3LSV A;  2WNL A;  5AFH A;  4COF A;  2XQ6 A;  4B5D A;  5HEJ A;  4HFB A;  4TWD A;  3ZDH A;  4UM3 P;  2BG9 E;  4AFG A;  3SQ6 A;  5BW2 A;  2BG9 C;  5CO5 A;  5TVC A;  5AFL A;  5J5H A;  5LXB A;  5J0Z A;  4IRE A;  5IUX A;  4QAA A;  3UU4 A;  1I9B A;  2BYQ A;  3GUA A;  5J5G A;  2X00 D;  2XQ4 A;  3UQ7 A;  2XNU A;  2W8F A;  4UM3 S;  2XQ5 A;  2UZ6 A;  3SIO A;  4HQP A;  4NPP A;  5J5I A;  2YOE A;  2YN6 A;  2XQ3 A;  3EI0 A;  4LML A;  3RIF A;  3EAM A;  3WIP A;  4ALX A;  2XQ8 A;  4LMK A;  4Z90 A;  5BP0 A;  3RI5 A;  3T4M A;  2WN9 A;  2XQ9 A;  4LMJ A;  3U8M A;  4A97 A;  2PH9 A;  3RQW A;  2YME A;  5L4H A;  4QH4 A;  5AFN A;  2WNC A;  4FRR A;  3WTL A;  5AFM A;  4TWH A;  2XZ5 A;  3UUB A;  3UU6 A;  4NZB A;  2WZY A;  2W8G A;  3UU3 A;  2X00 A;  2XQA A;  5AFK A;  3TLV A;  3SQ9 A;  5FJV A;  3U8J A;  5HEU A;  5BRX A;  2BYR A;  4TNW A;  1UX2 A;  2Y7Y A;  4ZZC A;  2XZ6 A;  4ZJS A;  2Y57 A;  2YMD A;  3TLU A;  4UXU A;  3WTI A;  2C9T A;  3TLS A;  4F8H A;  1UV6 A;  2VL0 A;  4ILC A;  5SYO A;  2BG9 A;  2BYN A;  2BYS A;  2XNV A;  2Y58 A;  3SH1 A;  4HFC A;  4PIR A;  4ZK1 A;  4XK9 A;  4QAB A;  4UY2 A;  3TLW A;  3WTM A;  2WNJ A;  3TLT A;  4ZZB A;  5J5F A;  3JAE A;  2BR8 A;  2Y56 A;  4X5T A;  3ZKR A;  3WTK A;  4ZK4 A;  4AFT A;  2YKS A;  4ZRU A;  5L4E A;  4QAC A;  5CFB A;  2ZJU A;  3PMZ A;  3C84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...