4EZ1A

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with alpha-conotoxin buia
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
203
Chain Sequence
LHSQANLMRLKSDLMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Pairwise interaction of alpha-conotoxin BuIA Pro6 with the beta subunit of nicotinic acetylcholine receptor
rcsb
source organism Aplysia californica
molecule tags Choline binding protein/toxin
total genus 50
structure length 203
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ez1A00
5TVCA 4A98A 2BG9A 3U8LA 5J5FA 4IREA 2XQ5A 3LSVA 3UU5A 3P4WA 4ILAA 5L4HA 5SYOA 3WTKA 4B5DA 2XNTA 2XYTA 3WIPA 2YMEA 4NPPA 4ZZBA 2PH9A 3C79A 3UQ7A 3EAMA 3SQ6A 2C9TA 4HFIA 3UU4A 4ALXA 3ZKRA 5AFJA 3RIAA 5AFMA 5HEOA 2BYNA 2Y54A 5J5GA 2BJ0A 3EI0A 4QACA 4IL9A 2WNCA 3RIFA 4FRRA 1UX2A 5FJVA 3JADA 3U8KA 4COFA 3UU6A 2XYSA 4A97A 3RI5A 4ILCA 4ZK1A 4HFEA 4LMKA 4QH1A 3SQ9A 3WTLA 2PGZA 4PIRA 5L47A 4Z91A 3TLSA 2YMDA 5HEJA 4UM3S 3C84A 2XNVA 3EHZA 4HFBA 3RHWA 4HFHA 4DBMA 2ZJVA 3UU8A 3UQ4A 4BFQA 2YN6A 2BR8A 4UM3A 5HCJA 3T4MA 2XQAA 3RQWA 3U8JA 2WN9A 4F8HA 4X5TA 2XZ5A 4QABA 4ZJSA 5IUXA 4UY2A 2W8GA 4ZRUA 5J5HA 2BG9C 1UW6A 2XQ6A 3JAEA 4TWFA 5HEUA 5KZUA 4ZZCA 2VL0A 5J5IA 4QH4A 5BW2A 3ZDGA 2XQ7A 5AFKA 2X00D 3TLTA 2XZ6A 4UXUA 4D01A 2W8FA 5AFHA 5AINA 4LMLA 5LG3A 2WZYA 4UM1A 3WTMA 4IL4A 3WTHA 3JAFA 2XQ4A 2BYRA 2XQ8A 3PMZA 2XQ3A 2BG9B 4AFGA 4QAAA 5KE4A 2X00A 4TWDA 4TNWA 4AFHA 2QC1B 4ZR6A 5HCMA 5HEGA 2XNUA 2WNJA 2Y7YA 3UU3A 2BYPA 2Y56A 3WTIA 4XK9A 2Y57A 4TWHA 3RQUA 5AFMB 2WNLA 2YKSA 5AFLA 1UV6A 2ZJUA 2YOEA 3UUBA 4UM3P 5JMEA 5LXBA 3TLWA 4EZ1A 3P50A 4LMJA 4QH5A 4HFCA 3WTOA 3WTNA 3U8NA 3PEOA 4TNVA 5CO5A 4ILBA 2BYSA 4ZJTA 5CFBA 3SIOA 4ZK4A 4XHEA 5BRXA 5BP0A 4Z90A 1I9BA 3ZDHA 5L4EA 2XQ9A 5AFNA 3SH1A 2UZ6A 5J0ZA 4HFDA 2Y58A 3TLVA 3WTJA 2BG9E 2BYQA 4BQTA 4HQPA 4AFTA 4NZBA 3TLUA 2BR7A 5HEHA 4WV9A 3GUAA 3IGQA 3U8MA
chains in the Genus database with same CATH superfamily
5TVCA 4A98A 2BG9A 3U8LA 5J5FA 4IREA 2XQ5A 3LSVA 3UU5A 3P4WA 4ILAA 5L4HA 5SYOA 3WTKA 4B5DA 2XNTA 2XYTA 3WIPA 2YMEA 4NPPA 4ZZBA 2PH9A 3C79A 3UQ7A 3EAMA 3SQ6A 2C9TA 4HFIA 3UU4A 4ALXA 3ZKRA 5AFJA 3RIAA 5AFMA 5HEOA 2BYNA 2Y54A 5J5GA 2BJ0A 3EI0A 4QACA 4IL9A 2WNCA 3RIFA 4FRRA 1UX2A 5FJVA 3JADA 3U8KA 4COFA 3UU6A 2XYSA 4A97A 3RI5A 4ILCA 4ZK1A 4HFEA 4LMKA 4QH1A 3SQ9A 3WTLA 2PGZA 4PIRA 5L47A 4Z91A 3TLSA 2YMDA 5HEJA 4UM3S 3C84A 2XNVA 3EHZA 4HFBA 3RHWA 4HFHA 4DBMA 2ZJVA 3UU8A 3UQ4A 4BFQA 2YN6A 2BR8A 4UM3A 5HCJA 3T4MA 2XQAA 3RQWA 3U8JA 2WN9A 4F8HA 4X5TA 2XZ5A 4QABA 4ZJSA 5IUXA 4UY2A 2W8GA 4ZRUA 5J5HA 2BG9C 1UW6A 2XQ6A 3JAEA 4TWFA 5HEUA 5KZUA 4ZZCA 2VL0A 5J5IA 4QH4A 5BW2A 3ZDGA 2XQ7A 5AFKA 2X00D 3TLTA 2XZ6A 4UXUA 4D01A 2W8FA 5AFHA 5AINA 4LMLA 5LG3A 2WZYA 4UM1A 3WTMA 4IL4A 3WTHA 3JAFA 2XQ4A 2BYRA 2XQ8A 3PMZA 2XQ3A 2BG9B 4AFGA 4QAAA 5KE4A 2X00A 4TWDA 4TNWA 4AFHA 2QC1B 4ZR6A 5HCMA 5HEGA 2XNUA 2WNJA 2Y7YA 3UU3A 2BYPA 2Y56A 3WTIA 4XK9A 2Y57A 4TWHA 3RQUA 5AFMB 2WNLA 2YKSA 5AFLA 1UV6A 2ZJUA 2YOEA 3UUBA 4UM3P 5JMEA 5LXBA 3TLWA 4EZ1A 3P50A 4LMJA 4QH5A 4HFCA 3WTOA 3WTNA 3U8NA 3PEOA 4TNVA 5CO5A 4ILBA 2BYSA 4ZJTA 5CFBA 3SIOA 4ZK4A 4XHEA 5BRXA 5BP0A 4Z90A 1I9BA 3ZDHA 5L4EA 2XQ9A 5AFNA 3SH1A 2UZ6A 5J0ZA 4HFDA 2Y58A 3TLVA 3WTJA 2BG9E 2BYQA 4BQTA 4HQPA 4AFTA 4NZBA 3TLUA 2BR7A 5HEHA 4WV9A 3GUAA 3IGQA 3U8MA
chains in the Genus database with same CATH topology
5TVCA 4A98A 2BG9A 3U8LA 5J5FA 4IREA 2XQ5A 3LSVA 3UU5A 3P4WA 4ILAA 5L4HA 5SYOA 3WTKA 4B5DA 2XNTA 2XYTA 3WIPA 2YMEA 4NPPA 4ZZBA 2PH9A 3C79A 3UQ7A 3EAMA 3SQ6A 2C9TA 4HFIA 3UU4A 4ALXA 3ZKRA 5AFJA 3RIAA 5AFMA 5HEOA 2BYNA 2Y54A 5J5GA 2BJ0A 3EI0A 4QACA 4IL9A 2WNCA 3RIFA 4FRRA 1UX2A 5FJVA 3JADA 3U8KA 4COFA 3UU6A 2XYSA 4A97A 3RI5A 4ILCA 4ZK1A 4HFEA 4LMKA 4QH1A 3SQ9A 3WTLA 2PGZA 4PIRA 5L47A 4Z91A 3TLSA 2YMDA 5HEJA 4UM3S 3C84A 2XNVA 3EHZA 4HFBA 3RHWA 4HFHA 4DBMA 2ZJVA 3UU8A 3UQ4A 4BFQA 2YN6A 2BR8A 4UM3A 5HCJA 3T4MA 2XQAA 3RQWA 3U8JA 2WN9A 4F8HA 4X5TA 2XZ5A 4QABA 4ZJSA 5IUXA 4UY2A 2W8GA 4ZRUA 5J5HA 2BG9C 1UW6A 2XQ6A 3JAEA 4TWFA 5HEUA 5KZUA 4ZZCA 2VL0A 5J5IA 4QH4A 5BW2A 3ZDGA 2XQ7A 5AFKA 2X00D 3TLTA 2XZ6A 4UXUA 4D01A 2W8FA 5AFHA 5AINA 4LMLA 5LG3A 2WZYA 4UM1A 3WTMA 4IL4A 3WTHA 3JAFA 2XQ4A 2BYRA 2XQ8A 3PMZA 2XQ3A 2BG9B 4AFGA 4QAAA 5KE4A 2X00A 4TWDA 4TNWA 4AFHA 2QC1B 4ZR6A 5HCMA 5HEGA 2XNUA 2WNJA 2Y7YA 3UU3A 2BYPA 2Y56A 3WTIA 4XK9A 2Y57A 4TWHA 3RQUA 5AFMB 2WNLA 2YKSA 5AFLA 1UV6A 2ZJUA 2YOEA 3UUBA 4UM3P 5JMEA 5LXBA 3TLWA 4EZ1A 3P50A 4LMJA 4QH5A 4HFCA 3WTOA 3WTNA 3U8NA 3PEOA 4TNVA 5CO5A 4ILBA 2BYSA 4ZJTA 5CFBA 3SIOA 4ZK4A 4XHEA 5BRXA 5BP0A 4Z90A 1I9BA 3ZDHA 5L4EA 2XQ9A 5AFNA 3SH1A 2UZ6A 5J0ZA 4HFDA 2Y58A 3TLVA 3WTJA 2BG9E 2BYQA 4BQTA 4HQPA 4AFTA 4NZBA 3TLUA 2BR7A 5HEHA 4WV9A 3GUAA 3IGQA 3U8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TVC A;  4A98 A;  2BG9 A;  3U8L A;  5J5F A;  4IRE A;  2XQ5 A;  3LSV A;  3UU5 A;  3P4W A;  4ILA A;  5L4H A;  5SYO A;  3WTK A;  4B5D A;  2XNT A;  2XYT A;  3WIP A;  2YME A;  4NPP A;  4ZZB A;  2PH9 A;  3C79 A;  3UQ7 A;  3EAM A;  3SQ6 A;  2C9T A;  4HFI A;  3UU4 A;  4ALX A;  3ZKR A;  5AFJ A;  3RIA A;  5AFM A;  5HEO A;  2BYN A;  2Y54 A;  5J5G A;  2BJ0 A;  3EI0 A;  4QAC A;  4IL9 A;  2WNC A;  3RIF A;  4FRR A;  1UX2 A;  5FJV A;  3JAD A;  3U8K A;  4COF A;  3UU6 A;  2XYS A;  4A97 A;  3RI5 A;  4ILC A;  4ZK1 A;  4HFE A;  4LMK A;  4QH1 A;  3SQ9 A;  3WTL A;  2PGZ A;  4PIR A;  5L47 A;  4Z91 A;  3TLS A;  2YMD A;  5HEJ A;  4UM3 S;  3C84 A;  2XNV A;  3EHZ A;  4HFB A;  3RHW A;  4HFH A;  4DBM A;  2ZJV A;  3UU8 A;  3UQ4 A;  4BFQ A;  2YN6 A;  2BR8 A;  4UM3 A;  5HCJ A;  3T4M A;  2XQA A;  3RQW A;  3U8J A;  2WN9 A;  4F8H A;  4X5T A;  2XZ5 A;  4QAB A;  4ZJS A;  5IUX A;  4UY2 A;  2W8G A;  4ZRU A;  5J5H A;  2BG9 C;  1UW6 A;  2XQ6 A;  3JAE A;  4TWF A;  5HEU A;  5KZU A;  4ZZC A;  2VL0 A;  5J5I A;  4QH4 A;  5BW2 A;  3ZDG A;  2XQ7 A;  5AFK A;  2X00 D;  3TLT A;  2XZ6 A;  4UXU A;  4D01 A;  2W8F A;  5AFH A;  5AIN A;  4LML A;  5LG3 A;  2WZY A;  4UM1 A;  3WTM A;  4IL4 A;  3WTH A;  3JAF A;  2XQ4 A;  2BYR A;  2XQ8 A;  3PMZ A;  2XQ3 A;  2BG9 B;  4AFG A;  4QAA A;  5KE4 A;  2X00 A;  4TWD A;  4TNW A;  4AFH A;  2QC1 B;  4ZR6 A;  5HCM A;  5HEG A;  2XNU A;  2WNJ A;  2Y7Y A;  3UU3 A;  2BYP A;  2Y56 A;  3WTI A;  4XK9 A;  2Y57 A;  4TWH A;  3RQU A;  5AFM B;  2WNL A;  2YKS A;  5AFL A;  1UV6 A;  2ZJU A;  2YOE A;  3UUB A;  4UM3 P;  5JME A;  5LXB A;  3TLW A;  4EZ1 A;  3P50 A;  4LMJ A;  4QH5 A;  4HFC A;  3WTO A;  3WTN A;  3U8N A;  3PEO A;  4TNV A;  5CO5 A;  4ILB A;  2BYS A;  4ZJT A;  5CFB A;  3SIO A;  4ZK4 A;  4XHE A;  5BRX A;  5BP0 A;  4Z90 A;  1I9B A;  3ZDH A;  5L4E A;  2XQ9 A;  5AFN A;  3SH1 A;  2UZ6 A;  5J0Z A;  4HFD A;  2Y58 A;  3TLV A;  3WTJ A;  2BG9 E;  2BYQ A;  4BQT A;  4HQP A;  4AFT A;  4NZB A;  3TLU A;  2BR7 A;  5HEH A;  4WV9 A;  3GUA A;  3IGQ A;  3U8M A; 
#chains in the Genus database with same CATH topology
 5TVC A;  4A98 A;  2BG9 A;  3U8L A;  5J5F A;  4IRE A;  2XQ5 A;  3LSV A;  3UU5 A;  3P4W A;  4ILA A;  5L4H A;  5SYO A;  3WTK A;  4B5D A;  2XNT A;  2XYT A;  3WIP A;  2YME A;  4NPP A;  4ZZB A;  2PH9 A;  3C79 A;  3UQ7 A;  3EAM A;  3SQ6 A;  2C9T A;  4HFI A;  3UU4 A;  4ALX A;  3ZKR A;  5AFJ A;  3RIA A;  5AFM A;  5HEO A;  2BYN A;  2Y54 A;  5J5G A;  2BJ0 A;  3EI0 A;  4QAC A;  4IL9 A;  2WNC A;  3RIF A;  4FRR A;  1UX2 A;  5FJV A;  3JAD A;  3U8K A;  4COF A;  3UU6 A;  2XYS A;  4A97 A;  3RI5 A;  4ILC A;  4ZK1 A;  4HFE A;  4LMK A;  4QH1 A;  3SQ9 A;  3WTL A;  2PGZ A;  4PIR A;  5L47 A;  4Z91 A;  3TLS A;  2YMD A;  5HEJ A;  4UM3 S;  3C84 A;  2XNV A;  3EHZ A;  4HFB A;  3RHW A;  4HFH A;  4DBM A;  2ZJV A;  3UU8 A;  3UQ4 A;  4BFQ A;  2YN6 A;  2BR8 A;  4UM3 A;  5HCJ A;  3T4M A;  2XQA A;  3RQW A;  3U8J A;  2WN9 A;  4F8H A;  4X5T A;  2XZ5 A;  4QAB A;  4ZJS A;  5IUX A;  4UY2 A;  2W8G A;  4ZRU A;  5J5H A;  2BG9 C;  1UW6 A;  2XQ6 A;  3JAE A;  4TWF A;  5HEU A;  5KZU A;  4ZZC A;  2VL0 A;  5J5I A;  4QH4 A;  5BW2 A;  3ZDG A;  2XQ7 A;  5AFK A;  2X00 D;  3TLT A;  2XZ6 A;  4UXU A;  4D01 A;  2W8F A;  5AFH A;  5AIN A;  4LML A;  5LG3 A;  2WZY A;  4UM1 A;  3WTM A;  4IL4 A;  3WTH A;  3JAF A;  2XQ4 A;  2BYR A;  2XQ8 A;  3PMZ A;  2XQ3 A;  2BG9 B;  4AFG A;  4QAA A;  5KE4 A;  2X00 A;  4TWD A;  4TNW A;  4AFH A;  2QC1 B;  4ZR6 A;  5HCM A;  5HEG A;  2XNU A;  2WNJ A;  2Y7Y A;  3UU3 A;  2BYP A;  2Y56 A;  3WTI A;  4XK9 A;  2Y57 A;  4TWH A;  3RQU A;  5AFM B;  2WNL A;  2YKS A;  5AFL A;  1UV6 A;  2ZJU A;  2YOE A;  3UUB A;  4UM3 P;  5JME A;  5LXB A;  3TLW A;  4EZ1 A;  3P50 A;  4LMJ A;  4QH5 A;  4HFC A;  3WTO A;  3WTN A;  3U8N A;  3PEO A;  4TNV A;  5CO5 A;  4ILB A;  2BYS A;  4ZJT A;  5CFB A;  3SIO A;  4ZK4 A;  4XHE A;  5BRX A;  5BP0 A;  4Z90 A;  1I9B A;  3ZDH A;  5L4E A;  2XQ9 A;  5AFN A;  3SH1 A;  2UZ6 A;  5J0Z A;  4HFD A;  2Y58 A;  3TLV A;  3WTJ A;  2BG9 E;  2BYQ A;  4BQT A;  4HQP A;  4AFT A;  4NZB A;  3TLU A;  2BR7 A;  5HEH A;  4WV9 A;  3GUA A;  3IGQ A;  3U8M A; 
#chains in the Genus database with same CATH homology
 5TVC A;  4A98 A;  2BG9 A;  3U8L A;  5J5F A;  4IRE A;  2XQ5 A;  3LSV A;  3UU5 A;  3P4W A;  4ILA A;  5L4H A;  5SYO A;  3WTK A;  4B5D A;  2XNT A;  2XYT A;  3WIP A;  2YME A;  4NPP A;  4ZZB A;  2PH9 A;  3C79 A;  3UQ7 A;  3EAM A;  3SQ6 A;  2C9T A;  4HFI A;  3UU4 A;  4ALX A;  3ZKR A;  5AFJ A;  3RIA A;  5AFM A;  5HEO A;  2BYN A;  2Y54 A;  5J5G A;  2BJ0 A;  3EI0 A;  4QAC A;  4IL9 A;  2WNC A;  3RIF A;  4FRR A;  1UX2 A;  5FJV A;  3JAD A;  3U8K A;  4COF A;  3UU6 A;  2XYS A;  4A97 A;  3RI5 A;  4ILC A;  4ZK1 A;  4HFE A;  4LMK A;  4QH1 A;  3SQ9 A;  3WTL A;  2PGZ A;  4PIR A;  5L47 A;  4Z91 A;  3TLS A;  2YMD A;  5HEJ A;  4UM3 S;  3C84 A;  2XNV A;  3EHZ A;  4HFB A;  3RHW A;  4HFH A;  4DBM A;  2ZJV A;  3UU8 A;  3UQ4 A;  4BFQ A;  2YN6 A;  2BR8 A;  4UM3 A;  5HCJ A;  3T4M A;  2XQA A;  3RQW A;  3U8J A;  2WN9 A;  4F8H A;  4X5T A;  2XZ5 A;  4QAB A;  4ZJS A;  5IUX A;  4UY2 A;  2W8G A;  4ZRU A;  5J5H A;  2BG9 C;  1UW6 A;  2XQ6 A;  3JAE A;  4TWF A;  5HEU A;  5KZU A;  4ZZC A;  2VL0 A;  5J5I A;  4QH4 A;  5BW2 A;  3ZDG A;  2XQ7 A;  5AFK A;  2X00 D;  3TLT A;  2XZ6 A;  4UXU A;  4D01 A;  2W8F A;  5AFH A;  5AIN A;  4LML A;  5LG3 A;  2WZY A;  4UM1 A;  3WTM A;  4IL4 A;  3WTH A;  3JAF A;  2XQ4 A;  2BYR A;  2XQ8 A;  3PMZ A;  2XQ3 A;  2BG9 B;  4AFG A;  4QAA A;  5KE4 A;  2X00 A;  4TWD A;  4TNW A;  4AFH A;  2QC1 B;  4ZR6 A;  5HCM A;  5HEG A;  2XNU A;  2WNJ A;  2Y7Y A;  3UU3 A;  2BYP A;  2Y56 A;  3WTI A;  4XK9 A;  2Y57 A;  4TWH A;  3RQU A;  5AFM B;  2WNL A;  2YKS A;  5AFL A;  1UV6 A;  2ZJU A;  2YOE A;  3UUB A;  4UM3 P;  5JME A;  5LXB A;  3TLW A;  4EZ1 A;  3P50 A;  4LMJ A;  4QH5 A;  4HFC A;  3WTO A;  3WTN A;  3U8N A;  3PEO A;  4TNV A;  5CO5 A;  4ILB A;  2BYS A;  4ZJT A;  5CFB A;  3SIO A;  4ZK4 A;  4XHE A;  5BRX A;  5BP0 A;  4Z90 A;  1I9B A;  3ZDH A;  5L4E A;  2XQ9 A;  5AFN A;  3SH1 A;  2UZ6 A;  5J0Z A;  4HFD A;  2Y58 A;  3TLV A;  3WTJ A;  2BG9 E;  2BYQ A;  4BQT A;  4HQP A;  4AFT A;  4NZB A;  3TLU A;  2BR7 A;  5HEH A;  4WV9 A;  3GUA A;  3IGQ A;  3U8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...