4EZ1A

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with alpha-conotoxin buia
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
203
Chain Sequence
LHSQANLMRLKSDLMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Choline binding protein/toxin
molecule keywords Soluble acetylcholine receptor
publication title Pairwise interaction of alpha-conotoxin BuIA Pro6 with the beta subunit of nicotinic acetylcholine receptor
rcsb
source organism Aplysia californica
total genus 50
structure length 203
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ez1A00
4IL4A 4UM3P 3ZDGA 4F8HA 4HFIA 4TNWA 2WZYA 5CO5A 4ZJSA 3JADA 3UU5A 5BW2A 4QH4A 5J0ZA 4HFHA 2WNJA 3UQ4A 5AFMA 4LMKA 3RQWA 2XQ9A 3C84A 5BRXA 4HFEA 3UUBA 2XYSA 2BJ0A 3C79A 3RIAA 2WNLA 3U8LA 2BR7A 3UU8A 5HEUA 2YOEA 5AFMB 4QH5A 2BG9A 2XYTA 3UQ7A 3SQ6A 4UM3S 3RHWA 5HCJA 4D01A 2W8FA 2X00D 5AFHA 2Y54A 3WTMA 4IL9A 2XNUA 3ZKRA 2ZJVA 3ZDHA 5J5HA 2BG9B 3WTKA 4B5DA 2XNVA 2Y57A 3UU3A 3U8JA 4ILCA 5KE4A 5AFKA 4LMJA 3SH1A 4ZR6A 2XQ7A 4AFGA 4ZK1A 3TLWA 2XQ8A 4BQTA 3JAEA 4ZRUA 3UU6A 2PGZA 3PMZA 3WTNA 2XQ3A 3RIFA 4ZK4A 3EAMA 4EZ1A 4NZBA 4ZJTA 2BYRA 4QACA 3WTLA 3WTJA 4UXUA 5LXBA 4X5TA 2XQ4A 4XHEA 2BYNA 2QC1B 2Y56A 3EI0A 3SQ9A 2BYQA 4TWHA 3SIOA 4HFBA 2XNTA 4UM3A 4A98A 3TLUA 4ILBA 5AFLA 4TNVA 1UV6A 3JAFA 2XQAA 3TLVA 4PIRA 3UU4A 2WN9A 4UM1A 2XQ5A 4AFTA 3GUAA 3IGQA 2W8GA 5J5IA 5HEJA 4ZZBA 3RQUA 2YKSA 3WTOA 4A97A 5SYOA 4ZZCA 1I9BA 4IREA 2UZ6A 2PH9A 2XZ5A 3U8MA 5AINA 2BYSA 5HCMA 5AFJA 4BFQA 2BG9C 5HEOA 5JMEA 2C9TA 2BR8A 2YMEA 4NPPA 4AFHA 5LG3A 4XK9A 4QH1A 4Z91A 2BYPA 4HFCA 3TLTA 2XQ6A 4COFA 5J5FA 3WTIA 3PEOA 2VL0A 4QABA 4UY2A 5AFNA 4ALXA 4HQPA 4LMLA 3TLSA 2X00A 5TVCA 3T4MA 3LSVA 3P50A 5L4EA 5FJVA 5CFBA 4HFDA 4TWDA 5L4HA 2YMDA 2XZ6A 2YN6A 5J5GA 3U8KA 5L47A 1UW6A 2Y7YA 4DBMA 4QAAA 5BP0A 3WTHA 5HEGA 4ILAA 4FRRA 4TWFA 4WV9A 1UX2A 2WNCA 3P4WA 5HEHA 2BG9E 5KZUA 2Y58A 3EHZA 3RI5A 5IUXA 3WIPA 4Z90A 3U8NA 2ZJUA
chains in the Genus database with same CATH superfamily
4IL4A 4UM3P 3ZDGA 4F8HA 4HFIA 4TNWA 2WZYA 5CO5A 4ZJSA 3JADA 3UU5A 5BW2A 4QH4A 5J0ZA 4HFHA 2WNJA 3UQ4A 5AFMA 4LMKA 3RQWA 2XQ9A 3C84A 5BRXA 4HFEA 3UUBA 2XYSA 2BJ0A 3C79A 3RIAA 2WNLA 3U8LA 2BR7A 3UU8A 5HEUA 2YOEA 5AFMB 4QH5A 2BG9A 2XYTA 3UQ7A 3SQ6A 4UM3S 3RHWA 5HCJA 4D01A 2W8FA 2X00D 5AFHA 2Y54A 3WTMA 4IL9A 2XNUA 3ZKRA 2ZJVA 3ZDHA 5J5HA 2BG9B 3WTKA 4B5DA 2XNVA 2Y57A 3UU3A 3U8JA 4ILCA 5KE4A 5AFKA 4LMJA 3SH1A 4ZR6A 2XQ7A 4AFGA 4ZK1A 3TLWA 2XQ8A 4BQTA 3JAEA 4ZRUA 3UU6A 2PGZA 3PMZA 3WTNA 2XQ3A 3RIFA 4ZK4A 3EAMA 4EZ1A 4NZBA 4ZJTA 2BYRA 4QACA 3WTLA 3WTJA 4UXUA 5LXBA 4X5TA 2XQ4A 4XHEA 2BYNA 2QC1B 2Y56A 3EI0A 3SQ9A 2BYQA 4TWHA 3SIOA 4HFBA 2XNTA 4UM3A 4A98A 3TLUA 4ILBA 5AFLA 4TNVA 1UV6A 3JAFA 2XQAA 3TLVA 4PIRA 3UU4A 2WN9A 4UM1A 2XQ5A 4AFTA 3GUAA 3IGQA 2W8GA 5J5IA 5HEJA 4ZZBA 3RQUA 2YKSA 3WTOA 4A97A 5SYOA 4ZZCA 1I9BA 4IREA 2UZ6A 2PH9A 2XZ5A 3U8MA 5AINA 2BYSA 5HCMA 5AFJA 4BFQA 2BG9C 5HEOA 5JMEA 2C9TA 2BR8A 2YMEA 4NPPA 4AFHA 5LG3A 4XK9A 4QH1A 4Z91A 2BYPA 4HFCA 3TLTA 2XQ6A 4COFA 5J5FA 3WTIA 3PEOA 2VL0A 4QABA 4UY2A 5AFNA 4ALXA 4HQPA 4LMLA 3TLSA 2X00A 5TVCA 3T4MA 3LSVA 3P50A 5L4EA 5FJVA 5CFBA 4HFDA 4TWDA 5L4HA 2YMDA 2XZ6A 2YN6A 5J5GA 3U8KA 5L47A 1UW6A 2Y7YA 4DBMA 4QAAA 5BP0A 3WTHA 5HEGA 4ILAA 4FRRA 4TWFA 4WV9A 1UX2A 2WNCA 3P4WA 5HEHA 2BG9E 5KZUA 2Y58A 3EHZA 3RI5A 5IUXA 3WIPA 4Z90A 3U8NA 2ZJUA
chains in the Genus database with same CATH topology
4IL4A 4UM3P 3ZDGA 4F8HA 4HFIA 4TNWA 2WZYA 5CO5A 4ZJSA 3JADA 3UU5A 5BW2A 4QH4A 5J0ZA 4HFHA 2WNJA 3UQ4A 5AFMA 4LMKA 3RQWA 2XQ9A 3C84A 5BRXA 4HFEA 3UUBA 2XYSA 2BJ0A 3C79A 3RIAA 2WNLA 3U8LA 2BR7A 3UU8A 5HEUA 2YOEA 5AFMB 4QH5A 2BG9A 2XYTA 3UQ7A 3SQ6A 4UM3S 3RHWA 5HCJA 4D01A 2W8FA 2X00D 5AFHA 2Y54A 3WTMA 4IL9A 2XNUA 3ZKRA 2ZJVA 3ZDHA 5J5HA 2BG9B 3WTKA 4B5DA 2XNVA 2Y57A 3UU3A 3U8JA 4ILCA 5KE4A 5AFKA 4LMJA 3SH1A 4ZR6A 2XQ7A 4AFGA 4ZK1A 3TLWA 2XQ8A 4BQTA 3JAEA 4ZRUA 3UU6A 2PGZA 3PMZA 3WTNA 2XQ3A 3RIFA 4ZK4A 3EAMA 4EZ1A 4NZBA 4ZJTA 2BYRA 4QACA 3WTLA 3WTJA 4UXUA 5LXBA 4X5TA 2XQ4A 4XHEA 2BYNA 2QC1B 2Y56A 3EI0A 3SQ9A 2BYQA 4TWHA 3SIOA 4HFBA 2XNTA 4UM3A 4A98A 3TLUA 4ILBA 5AFLA 4TNVA 1UV6A 3JAFA 2XQAA 3TLVA 4PIRA 3UU4A 2WN9A 4UM1A 2XQ5A 4AFTA 3GUAA 3IGQA 2W8GA 5J5IA 5HEJA 4ZZBA 3RQUA 2YKSA 3WTOA 4A97A 5SYOA 4ZZCA 1I9BA 4IREA 2UZ6A 2PH9A 2XZ5A 3U8MA 5AINA 2BYSA 5HCMA 5AFJA 4BFQA 2BG9C 5HEOA 5JMEA 2C9TA 2BR8A 2YMEA 4NPPA 4AFHA 5LG3A 4XK9A 4QH1A 4Z91A 2BYPA 4HFCA 3TLTA 2XQ6A 4COFA 5J5FA 3WTIA 3PEOA 2VL0A 4QABA 4UY2A 5AFNA 4ALXA 4HQPA 4LMLA 3TLSA 2X00A 5TVCA 3T4MA 3LSVA 3P50A 5L4EA 5FJVA 5CFBA 4HFDA 4TWDA 5L4HA 2YMDA 2XZ6A 2YN6A 5J5GA 3U8KA 5L47A 1UW6A 2Y7YA 4DBMA 4QAAA 5BP0A 3WTHA 5HEGA 4ILAA 4FRRA 4TWFA 4WV9A 1UX2A 2WNCA 3P4WA 5HEHA 2BG9E 5KZUA 2Y58A 3EHZA 3RI5A 5IUXA 3WIPA 4Z90A 3U8NA 2ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL4 A;  4UM3 P;  3ZDG A;  4F8H A;  4HFI A;  4TNW A;  2WZY A;  5CO5 A;  4ZJS A;  3JAD A;  3UU5 A;  5BW2 A;  4QH4 A;  5J0Z A;  4HFH A;  2WNJ A;  3UQ4 A;  5AFM A;  4LMK A;  3RQW A;  2XQ9 A;  3C84 A;  5BRX A;  4HFE A;  3UUB A;  2XYS A;  2BJ0 A;  3C79 A;  3RIA A;  2WNL A;  3U8L A;  2BR7 A;  3UU8 A;  5HEU A;  2YOE A;  5AFM B;  4QH5 A;  2BG9 A;  2XYT A;  3UQ7 A;  3SQ6 A;  4UM3 S;  3RHW A;  5HCJ A;  4D01 A;  2W8F A;  2X00 D;  5AFH A;  2Y54 A;  3WTM A;  4IL9 A;  2XNU A;  3ZKR A;  2ZJV A;  3ZDH A;  5J5H A;  2BG9 B;  3WTK A;  4B5D A;  2XNV A;  2Y57 A;  3UU3 A;  3U8J A;  4ILC A;  5KE4 A;  5AFK A;  4LMJ A;  3SH1 A;  4ZR6 A;  2XQ7 A;  4AFG A;  4ZK1 A;  3TLW A;  2XQ8 A;  4BQT A;  3JAE A;  4ZRU A;  3UU6 A;  2PGZ A;  3PMZ A;  3WTN A;  2XQ3 A;  3RIF A;  4ZK4 A;  3EAM A;  4EZ1 A;  4NZB A;  4ZJT A;  2BYR A;  4QAC A;  3WTL A;  3WTJ A;  4UXU A;  5LXB A;  4X5T A;  2XQ4 A;  4XHE A;  2BYN A;  2QC1 B;  2Y56 A;  3EI0 A;  3SQ9 A;  2BYQ A;  4TWH A;  3SIO A;  4HFB A;  2XNT A;  4UM3 A;  4A98 A;  3TLU A;  4ILB A;  5AFL A;  4TNV A;  1UV6 A;  3JAF A;  2XQA A;  3TLV A;  4PIR A;  3UU4 A;  2WN9 A;  4UM1 A;  2XQ5 A;  4AFT A;  3GUA A;  3IGQ A;  2W8G A;  5J5I A;  5HEJ A;  4ZZB A;  3RQU A;  2YKS A;  3WTO A;  4A97 A;  5SYO A;  4ZZC A;  1I9B A;  4IRE A;  2UZ6 A;  2PH9 A;  2XZ5 A;  3U8M A;  5AIN A;  2BYS A;  5HCM A;  5AFJ A;  4BFQ A;  2BG9 C;  5HEO A;  5JME A;  2C9T A;  2BR8 A;  2YME A;  4NPP A;  4AFH A;  5LG3 A;  4XK9 A;  4QH1 A;  4Z91 A;  2BYP A;  4HFC A;  3TLT A;  2XQ6 A;  4COF A;  5J5F A;  3WTI A;  3PEO A;  2VL0 A;  4QAB A;  4UY2 A;  5AFN A;  4ALX A;  4HQP A;  4LML A;  3TLS A;  2X00 A;  5TVC A;  3T4M A;  3LSV A;  3P50 A;  5L4E A;  5FJV A;  5CFB A;  4HFD A;  4TWD A;  5L4H A;  2YMD A;  2XZ6 A;  2YN6 A;  5J5G A;  3U8K A;  5L47 A;  1UW6 A;  2Y7Y A;  4DBM A;  4QAA A;  5BP0 A;  3WTH A;  5HEG A;  4ILA A;  4FRR A;  4TWF A;  4WV9 A;  1UX2 A;  2WNC A;  3P4W A;  5HEH A;  2BG9 E;  5KZU A;  2Y58 A;  3EHZ A;  3RI5 A;  5IUX A;  3WIP A;  4Z90 A;  3U8N A;  2ZJU A; 
#chains in the Genus database with same CATH topology
 4IL4 A;  4UM3 P;  3ZDG A;  4F8H A;  4HFI A;  4TNW A;  2WZY A;  5CO5 A;  4ZJS A;  3JAD A;  3UU5 A;  5BW2 A;  4QH4 A;  5J0Z A;  4HFH A;  2WNJ A;  3UQ4 A;  5AFM A;  4LMK A;  3RQW A;  2XQ9 A;  3C84 A;  5BRX A;  4HFE A;  3UUB A;  2XYS A;  2BJ0 A;  3C79 A;  3RIA A;  2WNL A;  3U8L A;  2BR7 A;  3UU8 A;  5HEU A;  2YOE A;  5AFM B;  4QH5 A;  2BG9 A;  2XYT A;  3UQ7 A;  3SQ6 A;  4UM3 S;  3RHW A;  5HCJ A;  4D01 A;  2W8F A;  2X00 D;  5AFH A;  2Y54 A;  3WTM A;  4IL9 A;  2XNU A;  3ZKR A;  2ZJV A;  3ZDH A;  5J5H A;  2BG9 B;  3WTK A;  4B5D A;  2XNV A;  2Y57 A;  3UU3 A;  3U8J A;  4ILC A;  5KE4 A;  5AFK A;  4LMJ A;  3SH1 A;  4ZR6 A;  2XQ7 A;  4AFG A;  4ZK1 A;  3TLW A;  2XQ8 A;  4BQT A;  3JAE A;  4ZRU A;  3UU6 A;  2PGZ A;  3PMZ A;  3WTN A;  2XQ3 A;  3RIF A;  4ZK4 A;  3EAM A;  4EZ1 A;  4NZB A;  4ZJT A;  2BYR A;  4QAC A;  3WTL A;  3WTJ A;  4UXU A;  5LXB A;  4X5T A;  2XQ4 A;  4XHE A;  2BYN A;  2QC1 B;  2Y56 A;  3EI0 A;  3SQ9 A;  2BYQ A;  4TWH A;  3SIO A;  4HFB A;  2XNT A;  4UM3 A;  4A98 A;  3TLU A;  4ILB A;  5AFL A;  4TNV A;  1UV6 A;  3JAF A;  2XQA A;  3TLV A;  4PIR A;  3UU4 A;  2WN9 A;  4UM1 A;  2XQ5 A;  4AFT A;  3GUA A;  3IGQ A;  2W8G A;  5J5I A;  5HEJ A;  4ZZB A;  3RQU A;  2YKS A;  3WTO A;  4A97 A;  5SYO A;  4ZZC A;  1I9B A;  4IRE A;  2UZ6 A;  2PH9 A;  2XZ5 A;  3U8M A;  5AIN A;  2BYS A;  5HCM A;  5AFJ A;  4BFQ A;  2BG9 C;  5HEO A;  5JME A;  2C9T A;  2BR8 A;  2YME A;  4NPP A;  4AFH A;  5LG3 A;  4XK9 A;  4QH1 A;  4Z91 A;  2BYP A;  4HFC A;  3TLT A;  2XQ6 A;  4COF A;  5J5F A;  3WTI A;  3PEO A;  2VL0 A;  4QAB A;  4UY2 A;  5AFN A;  4ALX A;  4HQP A;  4LML A;  3TLS A;  2X00 A;  5TVC A;  3T4M A;  3LSV A;  3P50 A;  5L4E A;  5FJV A;  5CFB A;  4HFD A;  4TWD A;  5L4H A;  2YMD A;  2XZ6 A;  2YN6 A;  5J5G A;  3U8K A;  5L47 A;  1UW6 A;  2Y7Y A;  4DBM A;  4QAA A;  5BP0 A;  3WTH A;  5HEG A;  4ILA A;  4FRR A;  4TWF A;  4WV9 A;  1UX2 A;  2WNC A;  3P4W A;  5HEH A;  2BG9 E;  5KZU A;  2Y58 A;  3EHZ A;  3RI5 A;  5IUX A;  3WIP A;  4Z90 A;  3U8N A;  2ZJU A; 
#chains in the Genus database with same CATH homology
 4IL4 A;  4UM3 P;  3ZDG A;  4F8H A;  4HFI A;  4TNW A;  2WZY A;  5CO5 A;  4ZJS A;  3JAD A;  3UU5 A;  5BW2 A;  4QH4 A;  5J0Z A;  4HFH A;  2WNJ A;  3UQ4 A;  5AFM A;  4LMK A;  3RQW A;  2XQ9 A;  3C84 A;  5BRX A;  4HFE A;  3UUB A;  2XYS A;  2BJ0 A;  3C79 A;  3RIA A;  2WNL A;  3U8L A;  2BR7 A;  3UU8 A;  5HEU A;  2YOE A;  5AFM B;  4QH5 A;  2BG9 A;  2XYT A;  3UQ7 A;  3SQ6 A;  4UM3 S;  3RHW A;  5HCJ A;  4D01 A;  2W8F A;  2X00 D;  5AFH A;  2Y54 A;  3WTM A;  4IL9 A;  2XNU A;  3ZKR A;  2ZJV A;  3ZDH A;  5J5H A;  2BG9 B;  3WTK A;  4B5D A;  2XNV A;  2Y57 A;  3UU3 A;  3U8J A;  4ILC A;  5KE4 A;  5AFK A;  4LMJ A;  3SH1 A;  4ZR6 A;  2XQ7 A;  4AFG A;  4ZK1 A;  3TLW A;  2XQ8 A;  4BQT A;  3JAE A;  4ZRU A;  3UU6 A;  2PGZ A;  3PMZ A;  3WTN A;  2XQ3 A;  3RIF A;  4ZK4 A;  3EAM A;  4EZ1 A;  4NZB A;  4ZJT A;  2BYR A;  4QAC A;  3WTL A;  3WTJ A;  4UXU A;  5LXB A;  4X5T A;  2XQ4 A;  4XHE A;  2BYN A;  2QC1 B;  2Y56 A;  3EI0 A;  3SQ9 A;  2BYQ A;  4TWH A;  3SIO A;  4HFB A;  2XNT A;  4UM3 A;  4A98 A;  3TLU A;  4ILB A;  5AFL A;  4TNV A;  1UV6 A;  3JAF A;  2XQA A;  3TLV A;  4PIR A;  3UU4 A;  2WN9 A;  4UM1 A;  2XQ5 A;  4AFT A;  3GUA A;  3IGQ A;  2W8G A;  5J5I A;  5HEJ A;  4ZZB A;  3RQU A;  2YKS A;  3WTO A;  4A97 A;  5SYO A;  4ZZC A;  1I9B A;  4IRE A;  2UZ6 A;  2PH9 A;  2XZ5 A;  3U8M A;  5AIN A;  2BYS A;  5HCM A;  5AFJ A;  4BFQ A;  2BG9 C;  5HEO A;  5JME A;  2C9T A;  2BR8 A;  2YME A;  4NPP A;  4AFH A;  5LG3 A;  4XK9 A;  4QH1 A;  4Z91 A;  2BYP A;  4HFC A;  3TLT A;  2XQ6 A;  4COF A;  5J5F A;  3WTI A;  3PEO A;  2VL0 A;  4QAB A;  4UY2 A;  5AFN A;  4ALX A;  4HQP A;  4LML A;  3TLS A;  2X00 A;  5TVC A;  3T4M A;  3LSV A;  3P50 A;  5L4E A;  5FJV A;  5CFB A;  4HFD A;  4TWD A;  5L4H A;  2YMD A;  2XZ6 A;  2YN6 A;  5J5G A;  3U8K A;  5L47 A;  1UW6 A;  2Y7Y A;  4DBM A;  4QAA A;  5BP0 A;  3WTH A;  5HEG A;  4ILA A;  4FRR A;  4TWF A;  4WV9 A;  1UX2 A;  2WNC A;  3P4W A;  5HEH A;  2BG9 E;  5KZU A;  2Y58 A;  3EHZ A;  3RI5 A;  5IUX A;  3WIP A;  4Z90 A;  3U8N A;  2ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...