3UUBA

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in solution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 95
structure length 311
sequence length 311
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uubA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uubA01
5JMEA 4IL9A 3JADA 4UXUA 2Y7YA 5CFBA 1UV6A 2PGZA 3U8JA 3SQ9A 3ZKRA 4LMJA 4ZR6A 5HCMA 3PMZA 5BW2A 2PH9A 5HEHA 5BRXA 2XQ9A 4TWFA 3WTNA 2BG9B 1OEDA 2QC1B 2WZYA 2BJ0A 3WTLA 3ZDHA 2XQ4A 4AFGA 2UZ6A 2YN6A 3UU4A 2BYQA 4ZZCA 4EZ1A 3RIFA 5LG3A 4ZZBA 4WV9A 3RIAA 4HFHA 3TLSA 4NPPA 2BR8A 3TLVA 5KE4A 4QAAA 4QH5A 3WTIA 4LMKA 5CO5A 2Y57A 5AFMB 2LLYA 2XQ5A 3U8MA 4NZBA 2XQ8A 4LMLA 2X00A 3RHWA 3PEOA 3SQ6A 4HFBA 4ZJTA 5FJVA 4QACA 2WNCA 4XK9A 4UM3P 4COFA 3UU5A 2XZ5A 4UM1A 2BR7A 2ZJVA 5HEGA 2XNUA 4HQPA 2KSRA 2XYSA 5AFLA 3GUAA 2YOEA 3U8NA 2WNJA 2Y58A 3UUBA 2BYPA 5J0ZA 2W8FA 3RI5A 2BG9E 2YKSA 3WTHA 1I9BA 3TLUA 2X00D 3P4WA 3JAEA 4D01A 1OEDB 3U8LA 3WTMA 2LKHA 3LSVA 2BYSA 5KZUA 3RQWA 5J5FA 3SIOA 4AFHA 2XQ3A 2W8GA 3WTJA 4ALXA 5J5IA 4ZJSA 5IUXA 1UX2A 4DBMA 5J5GA 4HFCA 4ZK4A 4TWHA 4HFEA 5HEUA 5AFJA 2VL0A 3U8KA 4UY2A 3WTKA 4Z90A 5HCJA 2YMDA 3T4MA 3TLTA 5AFMA 5L4EA 4IL4A 2YMEA 3UU6A 5HEJA 2XQAA 3UQ7A 5BP0A 5L4HA 3EHZA 3JAFA 4IREA 4UM3A 2WNLA 3ZDGA 2WN9A 4PIRA 5HEOA 4QH1A 4QH4A 5L47A 4UM3S 4B5DA 2XQ6A 3C84A 4TNWA 4TWDA 2BG9A 2Y54A 3P50A 3WTOA 5TVCA 5LXBA 3TLWA 4ILAA 3C79A 4HFIA 5SYOA 1UW6A 3UU3A 2LM2A 2M6BA 1OEDE 4TNVA 2MAWA 4AFTA 3WIPA 5AFHA 2XQ7A 4HFDA 2XNVA 5AFNA 2XNTA 2Y56A 2XZ6A 2LKGA 2BYNA 2ZJUA 4ILBA 2M6IA 4BQTA 2BG9C 3UQ4A 4BFQA 3UU8A 4X5TA 3RQUA 4A97A 4ILCA 4ZRUA 4FRRA 3EAMA 5J5HA 2XYTA 3IGQA 4QABA 2BYRA 3EI0A 4A98A 4XHEA 3SH1A 4F8HA 5AINA 1OEDC 4ZK1A 5AFKA 2C9TA 4Z91A
chains in the Genus database with same CATH superfamily
2ES0A 3FZHB 4DR5T 1BR2A 4PFOA 4ASKA 2SPCA 3WTNA 3P4QA 3OYXA 3NRXA 2BS4A 5FXXA 5LG3A 2LSGA 3CIRA 2EHOC 2JPFA 5JR9C 2VKDA 4YHHT 5HAXA 4H9NC 4YSYA 3C98B 3CKDA 4H9OC 2IHR1 5FY0A 3N5LA 4GK0E 2RA1A 3WTHA 2QRXA 4DMWA 4D01A 3U78A 1LVFA 2ODVA 2DCFA 2R6GF 3MACA 5LP6E 1YKHB 4C91A 3LDQB 1HX8A 4DBMA 4O4LE 5L3EB 1D0XA 1G73A 3KBUA 1CHUA 4YTNA 1Z0PA 2PBIA 2JMHA 2V5CA 5L4HA 2VKOA 2WNLA 1IJ5A 2WN9A 2L9QA 2QGSA 2XQ6A 3K3QC 4ILAA 4PJLA 3H37A 3E0ZA 4WZXA 1OEDE 5AFHA 2AE9A 4PFPA 2NWBA 3ZYMA 2JIWA 2L3LA 4QABA 2BYRA 3Q9DA 2WS3A 5FL0A 5L3BB 2V6YA 5CFBA 4EEBA 5JR9A 1XDOA 4UEMA 4LF7T 3OBVE 4DV5T 3FZKB 4JYAT 1WR6A 1J5WA 3SOLA 3PE0A 3N9MA 4DVDA 3ZSSA 3DTOA 2E9XA 2JRKA 5FVLA 1HF8A 5CB4E 3I1AA 3ESLA 5AFLA 1T8BA 3GUAA 2V6YB 2I0MA 3ZJ2A 5JR9B 4K0UA 3P4WA 2CLYB 3AE4A 1LKXA 4P0AA 5KZUA 4AFHA 5AQHB 5J2UE 1MIYA 5DJQC 3AEFA 4DUYT 3O1JA 3PJAJ 3AVSA 4CN6A 1KNZA 3ZMUB 5FL1A 2E9XB 5HEJA 1HFAA 1MMAA 3EUHA 2WP9A 4UM3A 2UUBT 4UF0A 2XAHB 2UXBT 4WYVA 2LSYA 3C79A 2W00A 3AAEB 3FBZA 3WIPA 1UX5A 4HWIB 3VHLA 2BKOA 1O3XA 3PUZF 2NTYA 5J5HA 5AQIB 4XZCA 4DV6T 2BKPA 4YTPA 1NENA 2CXDA 1HNZT 2A9UA 3ZKRA 5L3GB 4UF0B 5AQVB 2CXFA 4ZI2D 2IMLA 4AI6A 1CUNA 3QB5K 4AFGA 3SFDA 1DU2A 3CK6A 1YQ3A 2CBJA 3PU8A 2KLQA 3WTIA 5CO5A 3EDUA 2K24A 4DR7T 4ZS3A 3RHWA 1M7KA 2K5BB 4XK9A 2XZ5A 4KMCA 3IEEA 2CHNA 2YOEA 3IF8B 5LHHB 2WMNA 3J7Yq 4E7SA 1IZNB 5CGMA 1FIOA 1JNRA 2NW7A 3PTRB 2W8GA 3QUJA 5EK3A 1VCSA 3I0QA 2BS3A 4E7ZA 4QWNB 4CI1B 2IC6A 5DQWA 3ZMVB 3U8KA 3T4MA 2JQ9A 1MMNA 3UT5E 2C5IT 3UU6A 2UU9T 4IREA 1NWMX 4ZI3C 3ZLIA 4YXDA 2G0UA 2LM2A 4IGUA 3O9XA 1QUUA 1W09A 5LHGB 3C4ZA 5HXHA 1NEKA 3NBXX 4HFDA 2X9XA 4YSZA 3AECA 1HNWT 5BMVE 4JI2T 4CXXA 4JV5T 1D0YA 2ODUA 4GOUA 1JNZA 4AQGA 3AEDA 4IL9A 4AQYT 2UXCT 2KMFA 3RGLA 2XAQB 5H6RB 3PUVF 1OEDA 2WZYA 4X20E 3PJAA 3UU4A 4ZZCA 3RIFA 3CQCB 4DV3T 1KFYA 5KE4A 3ZT7A 1G8XA 1XZYA 4IDNA 1D0ZA 2Y57A 4L9IA 2DHRA 4PNIA 2UXXB 1ZHCA 5FMNA 4JEHB 2KSRA 1J1JA 3ZMZB 2Y6XA 4FI5A 3F2EA 3C4WA 4YJ2E 3U8NA 2Y58A 2E9XD 4UXNB 3UTKA 5HXEA 4B3TT 4KP3C 5JTGA 1OEDB 5C3JA 1YXRA 3OVUA 3MA9A 1IAPA 3PV0F 4EXTA 4NUUA 5DQVA 4CXWA 5L47A 2K9AA 4QKNA 4YJ3E 3CQXC 4DBRA 2GK9A 2X9HA 3ANWA 3DP7A 5F5WA 1L0VA 3LG7A 1HX1B 1XDPA 2NP9A 4PK6A 4XBFB 3VKHA 4BQTA 2MYSA 5AQTB 2UUCT 5LMNT 3QB5A 1V9DA 2X68A 3KV4A 3JADA 2XSAA 2B76A 2VB6A 3BQKA 2KXPB 4EGWA 3ANWB 1W9RA 2PTFA 3T1YT 1I94T 1XNQT 1MIVA 3ETVA 4Z8XA 5HXSA 1YQ4A 3SFEA 5HXCA 2XQ5A 4LMLA 4MLKA 2DWKA 4NIQA 4JI8T 1XNRT 3AEEA 5LYJE 4DR4T 2ZJVA 2MBGA 3UUMA 1FJGT 2BYPA 5LGTB 3Q5XA 1LVKA 2LM9A 3KVBA 3AE5A 3JAEA 3LK3B 3Q5WA 3QC9A 3SWHA 4LFAT 1N34T 2HHHT 2A2FX 3K8PC 4PW8A 4A5XA 3AE3A 4TWHA 2JQKA 3AE1A 4X64T 2J62A 4LF4T 1XMQT 3JAFA 3PURA 4X65T 3KV9A 3C84A 2YEVC 5LXBA 4DV2T 4CXYA 1U4QA 2DNXA 2KWHA 2WCAA 3W15B 2IC9A 5LBMA 2VKJA 5AFNA 4IE4A 3WI3A 4MALA 4ILBA 4A97A 3NVOA 2V8SV 4J2CA 3IGQA 5AINA 2VK9A 5FXVA 1ZV4X 4BAYB 1ZKEA 5AQNB 4DR3T 3BK9A 1Z8UA 5ADXL 4YHJA 4OK0A 4I43B 2BVMA 5KX5E 2UZ6A 2YN6A 3N9OA 2WM9A 3TLVA 3NZQA 2VASA 1WRDA 2D0UA 3AA7B 4UVAB 2H3RA 4NXNT 4EV6A 2BZBA 4O4JE 1FMWA 3UU5A 5LMUT 1HG5A 4AQFA 2XYSA 4HWFA 2CBIA 5AQQB 4GIWA 1H7CA 2XUEA 3OJAA 1I6ZA 5J0ZA 5LCYA 2L8KA 4ISSA 4HN9A 2LKHA 4CI3B 4DV4T 3NKZA 3A8YC 3UULA 5HEUA 3IBPA 4LF5T 2YMDA 3PUWF 3EDVA 5C2TA 3FZFB 3EHZA 4MFRA 3RH3A 2K3WA 1AJ3A 4ZI3D 4TWDA 5LNKA 4QXBB 5SYOA 2KWIB 2ACXA 2MAWA 2LSKA 2XPKA 5LGUB 2XSBA 4I55E 5JDFA 3ZYKA 4YLHA 2LOSA 3I0OA 1YKEB 4DV7T 3PUQA 4AIUA 4U74A 5AFUL 4ZEYA 4UELA 4Q25A 4GYSA 4PK4A 3JC6C 4JI0T 2X9YA 3MJXA 1UCUA 3K3NA 1VCTA 5FY7A 3P7IA 3NWIA 4QH5A 2M67A 4HGAA 3U3IA 3E22E 4AKIA 2VVNA 1VRBA 2VKHA 2ZLYA 2EHOA 2YU2A 3AVRA 3RYCE 4ADZA 2ZMAA 2UUAT 3HKDE 2KT9A 4LF6T 2C0SA 2BYSA 2WB5A 5J5IA 5AQRB 5LGNB 4EZ4A 2J47A 5J5GA 3MKDA 1IJ6A 3UFGA 5AFJA 2VL0A 3M65A 5FVKA 4ZOLE 3FZLB 5L4EA 3B5MA 4AXPA 2XQAA 4BJMA 3ZPOA 5JVDE 3ZDGA 4IDOA 2EHOB 5EK2A 4QXHB 4ERRA 4B5DA 2IAKA 3C51A 4HFIA 1MMGA 4DUZT 3RKOA 5C8YE 4KBMB 2XNTA 2LKGA 2I59A 4ILUA 3DJBA 2H88A 2X51A 4OYJA 2BBJA 4N78D 1T7SA 4LF8T 3KBTA 3RKGA 4BA9A 4G63A 4ZK1A 3H3AA 4AKGA 4ZHQE 3PMZA 2JQHA 3VKGA 3RIAA 3PUXF 3Q5DA 4NPPA 2CMRA 2K48A 4UVBB 2Q9QC 4XAXB 2WMOA 4LMKA 4YT0A 4KHPT 2FJAA 3C4XA 4NZBA 4OX9T 4B3MT 1HG2A 4UM3P 2CPTA 4IDQA 4UV8B 2OLTA 5HEGA 2LHRA 5JDQA 3RRCA 1E1HB 5BR8T 4YFSA 2BG9E 3ZSTA 4O2AE 5EK4A 4U7IA 1WFDA 1QSDA 2KINB 3N9QA 4O4HE 1YW0A 1KNRA 4HTEA 4PAGA 3QK6A 3KINB 2V7LA 2UXDT 5AFMA 4IL4A 3ZJ1A 2VWAA 2WDQA 3J9X1 4QH1A 1GQEA 2IUBA 4TX5A 5LA6E 4HWHA 3CMLA 3HA4A 3C50A 3AE8A 4TNVA 2AXDS 2XNVA 2BYNA 5ABHA 5HXRA 3P4RA 3ZC1A 2WDRA 2XYTA 3M3ZB 4DNDA 4Z91A 1YD8G 2CXLA 3RRWA 4H63V 2HPJA 2PGZA 4P0BA 2Q9QA 4V1Av 1IBLT 4A56A 2XQ9A 4TWFA 3R84B 4DV1T 1OXZA 4ZZBA 1ZEEA 5IWAT 5FKYA 3LK2B 3FXDB 4YSXA 4U31A 4HWDA 4U33A 3P8CD 5AQUB 3PEOA 1XWMA 2VL8A 2LSIA 4HWCA 3AE2A 2XM1A 1IBKT 2P9BA 5LOVE 2XNUA 2X0YA 5AQOB 4IT4A 4ZI7E 1R8IA 2RPAA 3ZN1B 1KF6A 4JI7T 1HS7A 3WTMA 5J5FA 3BQIA 2XQ3A 3N9NA 4ZJSA 1WR0A 2EHOD 1T98A 2E5VA 1B7TA 5TAOA 2IIUA 2XZEA 5ABEA 2XHEB 2VURA 2Z6EA 3RIUC 4HE8A 3RYIE 2PFVA 3S4UA 3KFWX 4DR1T 2W0GA 3LJCA 2CWOA 2W62A 2WQYA 4CI2B 3CX6B 3PUSA 2BG9C 5JQGE 1D1AA 3WAJA 3HKEE 1Y64B 2A3DA 3RC3A 4A98A 3ONXA 3C64A 5H6QB 4U3CA 3L39A 2CRBA 5BW2A 1U5PA 3JC6D 4QXCB 4DMVA 3MXZA 2F4VT 2PG8A 4O2BE 5FNVE 4WV9A 2WBLA 4NUVA 3BQLA 5LB7B 2FUPA 4IDZA 2MOZA 2WY2A 4I4TE 5ABFA 4UM1A 4DBQA 4DR2T 4JEUB 3P4PA 4EAHA 3FZMB 2MPKA 5AQSB 3N2KE 2N1GA 2A72A 5AQFB 1I9BA 5CJ5A 2N2NA 3RIUA 3AA1B 3RYFE 2IW5B 2KZ7B 4HFEA 1KEYA 3RPUA 2H7VC 4X1KE 4PJJA 5ABFB 4H63H 3LK42 4TNWA 2BG9A 4LFCT 5TVCA 2V5DA 4ZI2C 3TLWA 1WYBA 5KDMC 1XMOT 3ABVA 3PDYA 3O1IA 2Y56A 3A5XA 1S35A 2XASB 3UQ4A 1QLBA 4BFQA 2JJ9A 2XJ7A 2JQQA 4ILCA 1FMVA 1BR1A 1IBMT 3HI2A 3EI0A 3TKLB 3SH1A 1X79A 3UFEA 2C9TA 2Y7YA 5ETWA 3N9LA 4ZS2A 1N33T 3U8JA 4LMJA 3IA3A 2WZHA 2X9WA 4PJMA 4X1IE 1VOMA 2BG9B 2QC1B 4TV9E 3JCFA 1N32T 2KNDA 3ZC0A 4MHCA 1D1BA 4QAAA 4EYYR 2PJQA 4I0UA 3VR9A 2Q9QD 3Q2MA 4U2ZA 2X67A 1HCIA 4HQPA 3WAKA 4K0KT 2W2UA 2V1DB 2J4GA 3RI5A 5JH7E 2MTQA 1N36T 4JI5T 2HN1A 3X1DA 4ALXA 2V7MA 4ZK4A 2FJEA 3VU7H 2C5JA 2ZM6T 3GN5A 1E2AA 4C90A 5LJMA 3AE9A 4MBQA 3AA0B 3ZMTB 2JMKA 2WZIA 2ZM2A 3OTOT 4O4IE 3RLFF 4JBWF 1UW6A 3KVAA 4KHZF 2W63A 2YINA 2XQ7A 4GK5E 5JDGA 2CCQA 3VRAA 4DV0T 3GN5B 4F8HA 2CLYC 1E7PA 2WDVA 5CA0E 3FXEB 3T8OA 3LBXA 5HCMA 3KV6A 5E0OA 2E9XC 2I6HA 2WWUA 2E5LT 5JDNA 3PUGA 1MNEA 4IE5A 5GONE 4U7YA 3CX7B 2YDQA 4IE0A 3PU3A 4LFBT 4COFA 4TZ4C 2V7IA 5LG4A 2WNJA 3GA8A 3LBXB 2E2AA 2IDOB 2LRKA 3I9YA 5F3JA 2BDEA 3LSVA 4H9QC 2WWVA 3SIOA 4CQIA 3V5UA 3QNUA 2BVLA 4HFCA 3WTKA 4Z90A 4IIJE 3ETUA 4HKAA 2NW9A 4H9SE 1S94A 3O1HA 5HEOA 4UM3S 4YTMA 2X0LB 4GKKT 3UU3A 2W4XA 4WBOA 2XZ6A 1HR0T 5JREA 2YDSA 2HN2A 4ISTA 3AAAB 2VQFT 1UGOA 4ZRUA 3MK7C 4JI6T 3FBLA 5KXJA 5L2LA 5L3FB 3D0TA 4LF9T 1MIWA 4UIGA 2Y8DA 4L0RA 4P09A 2FJBA 5HWYA 5BRXA 2BBHA 3WTLA 3ZDHA 5J2TE 1US7B 4KUMB 4GKJT 5AQMB 3RYHE 5AQGB 3L3PA 3U8MA 2XQ8A 1NAFA 2XY8B 5M4YA 3SS1A 3CVRA 3F57A 4WBNE 2WU5A 2YKSA 5JRCA 4OYKA 2ZM0A 2V26A 2V7KA 2XAFB 4UY2A 5AQLB 3L09A 5AQJB 3CWZB 2YMEA 2WAUA 5JDLA 4P1NA 3AE6A 3LFMA 3Q5EA 5JDHA 2QVAA 4QX8B 2YDRA 4JI4T 3B13A 3PUAA 1BR4A 3QOFA 1HTJF 3UUNA 1SA0E 2NTXA 4UR9A 5JRCB 2WSSV 4I50E 4AKRB 2LJLA 3ZCIA 3UU8A 5EZYE 2CHOA 4FRRA 2LHNA 2J1DG 4CN1A 4IE6A 1OEDC 4X62T 5AFKA 5JMEA 3PUYF 1UV6A 2DI4A 2V7JA 5J1GA 4DR6T 1SE7A 4KX6A 1KK7A 4TUYE 2BYQA 5LHIB 3ZEFB 4IDPA 2X0HA 2LSJA 3AEAA 3HR0A 5AFMB 3N2OA 4EIWA 2X00A 4H9PC 3MZKB 4QACA 2WNCA 2CA5A 3RF1A 3R6NA 2BS2A 2VQET 1HNXT 4H9RC 2HH7A 4O8SA 2CEAA 4ZXLA 3UUBA 4UV9B 3ZMSB 3AEBA 5L3CB 4JI3T 3TLUA 2C5KT 3U8LA 3ZT6A 3WTJA 4B3ST 5LXTE 4B3RT 4WNKA 4TV8E 4NXMT 2RP4A 2V6XA 5A1LA 3UUXB 2XAJB 4L5GA 3B57A 2X66A 5FYMA 2Q9QB 2CM0A 4PIRA 2HPLA 3AA6B 5L3DB 4JI1T 2Y48B 3P50A 4FJOA 4EB6E 3RC8A 4BJNA 3N2GE 2LOPA 4WW0A 4G2AA 4ANJA 3K3OA 3ZYLA 3ONJA 4KI0F 2H89A 3AAIA 3EAMA 3FHNA 1UURA 5IYZE 2CWYA 5IHYA 3NRYA 2OV9A 1D1CA 3CPZA 4OHFA 4ZR6A 2UXNB 3T1HT 1WCRA 5HEHA 1UK5A 2XAGB 2XQ4A 4EZ1A 4AISA 2BR8A 1X9BA 4EYUA 5FY1A 3ZCJA 3OPCA 5JDMA 2DWGA 1T72A 3VR8A 3SQ6A 4ZJTA 4HFBA 4X66T 5ABGA 5FJVA 5LJNA 3SRZA 4JUYA 1KNPA 3CX8B 5KMGP 4JLEA 1SHZC 2OA5A 2XTLA 1FEWA 2LE8A 1EZ3A 4IHJE 4EZHA 2VVSA 3HKCE 2LEHA 4PJNA 5IUXA 1ZOYA 4M1PA 2QYWA 4F6RC 5F8PA 1ZP0A 3H3MA 5HCJA 2NOXA 3F31A 1W0AA 2BKNA 4CZZB 2LT3A 4QHOA 3KDSE 4PK5A 5LBQB 4QH4A 3AE7A 4YY3T 4DIDB 2Y54A 1MMDA 2H7OA 3NZPA 3CQGB 5FP3A 3OYZA 2D2SA 3GMIA 1UX4A 3KV5A 1OWAA 2ZJUA 2M6IA 2WU2A 2N9DA 3RQUA 3OKQA 4QX7B 2XM2A 2D5UA 1MNDA 1WLXA 2NR4A 4EOZB 2DL1A 4UXUA 3I9WA 3ZT5A 3SQ9A 4UVCB 4GYRA 2PH9A 2BJ0A 3AXJA 3ZN0B 5HWXA 4EEDA 2ACZA 4HFHA 3TLSA 5HYAA 4AQFC 4HEAA 4IE7A 4X1YE 2LLYA 1WYCA 3E08A 2B1EA 3N9PA 3FB2A 5FXWA 2NW8A 3O4XE 4B6XA 2BR7A 2FBWA 4OFZA 2W67A 2XQYA 1UUSA 3AB3B 3P4SA 3A7MA 1W0BA 2W8FA 2X00D 3L8RA 4U72A 3AXJB 1LRZA 3RQWA 2CE7A 1UX2A 1M62A 3AEGA 2QA7A 2YU1A 2W66A 3HL6A 1SUMB 4TN7B 2FJDA 3G06A 1Y01A 5CA1E 3TLTA 4DO0A 5BP0A 3UQ7A 5AQKB 3VRBA 5DABA 2D9DA 3EABA 2DLRA 2W61A 1BR0A 3IHRA 3WTOA 5FXZA 5AQPB 3EVYA 4AKLA 3GWHA 4AKHA 2M6BA 4AFTA 3K1SA 2D0TA 4U2YA 3HKBE 3RX6A 4X5TA 3ONLC 2YK0A 4CN4A 2LRLA 4XHEA 1J5ET 2E8IA 4HFVA 3V5SA 2ZM8A
chains in the Genus database with same CATH topology
5JMEA 4IL9A 3JADA 4UXUA 2Y7YA 5CFBA 1UV6A 2PGZA 3U8JA 3SQ9A 3ZKRA 4LMJA 4ZR6A 5HCMA 3PMZA 5BW2A 2PH9A 5HEHA 5BRXA 2XQ9A 4TWFA 3WTNA 2BG9B 1OEDA 2QC1B 2WZYA 2BJ0A 3WTLA 3ZDHA 2XQ4A 4AFGA 2UZ6A 2YN6A 3UU4A 2BYQA 4ZZCA 4EZ1A 3RIFA 5LG3A 4ZZBA 4WV9A 3RIAA 4HFHA 3TLSA 4NPPA 2BR8A 3TLVA 5KE4A 4QAAA 4QH5A 3WTIA 4LMKA 5CO5A 2Y57A 5AFMB 2LLYA 2XQ5A 3U8MA 4NZBA 2XQ8A 4LMLA 2X00A 3RHWA 3PEOA 3SQ6A 4HFBA 4ZJTA 5FJVA 4QACA 2WNCA 4XK9A 4UM3P 4COFA 3UU5A 2XZ5A 4UM1A 2BR7A 2ZJVA 5HEGA 2XNUA 4HQPA 2KSRA 2XYSA 5AFLA 3GUAA 2YOEA 3U8NA 2WNJA 2Y58A 3UUBA 2BYPA 5J0ZA 2W8FA 3RI5A 2BG9E 2YKSA 3WTHA 1I9BA 3TLUA 2X00D 3P4WA 3JAEA 4D01A 1OEDB 3U8LA 3WTMA 2LKHA 3LSVA 2BYSA 5KZUA 3RQWA 5J5FA 3SIOA 4AFHA 2XQ3A 2W8GA 3WTJA 4ALXA 5J5IA 4ZJSA 5IUXA 1UX2A 4DBMA 5J5GA 4HFCA 4ZK4A 4TWHA 4HFEA 5HEUA 5AFJA 2VL0A 3U8KA 4UY2A 3WTKA 4Z90A 5HCJA 2YMDA 3T4MA 3TLTA 5AFMA 5L4EA 4IL4A 2YMEA 3UU6A 5HEJA 2XQAA 3UQ7A 5BP0A 5L4HA 3EHZA 3JAFA 4IREA 4UM3A 2WNLA 3ZDGA 2WN9A 4PIRA 5HEOA 4QH1A 4QH4A 5L47A 4UM3S 4B5DA 2XQ6A 3C84A 4TNWA 4TWDA 2BG9A 2Y54A 3P50A 3WTOA 5TVCA 5LXBA 3TLWA 4ILAA 3C79A 4HFIA 5SYOA 1UW6A 3UU3A 2LM2A 2M6BA 1OEDE 4TNVA 2MAWA 4AFTA 3WIPA 5AFHA 2XQ7A 4HFDA 2XNVA 5AFNA 2XNTA 2Y56A 2XZ6A 2LKGA 2BYNA 2ZJUA 4ILBA 2M6IA 4BQTA 2BG9C 3UQ4A 4BFQA 3UU8A 4X5TA 3RQUA 4A97A 4ILCA 4ZRUA 4FRRA 3EAMA 5J5HA 2XYTA 3IGQA 4QABA 2BYRA 3EI0A 4A98A 4XHEA 3SH1A 4F8HA 5AINA 1OEDC 4ZK1A 5AFKA 2C9TA 4Z91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JME A;  4IL9 A;  3JAD A;  4UXU A;  2Y7Y A;  5CFB A;  1UV6 A;  2PGZ A;  3U8J A;  3SQ9 A;  3ZKR A;  4LMJ A;  4ZR6 A;  5HCM A;  3PMZ A;  5BW2 A;  2PH9 A;  5HEH A;  5BRX A;  2XQ9 A;  4TWF A;  3WTN A;  2BG9 B;  1OED A;  2QC1 B;  2WZY A;  2BJ0 A;  3WTL A;  3ZDH A;  2XQ4 A;  4AFG A;  2UZ6 A;  2YN6 A;  3UU4 A;  2BYQ A;  4ZZC A;  4EZ1 A;  3RIF A;  5LG3 A;  4ZZB A;  4WV9 A;  3RIA A;  4HFH A;  3TLS A;  4NPP A;  2BR8 A;  3TLV A;  5KE4 A;  4QAA A;  4QH5 A;  3WTI A;  4LMK A;  5CO5 A;  2Y57 A;  5AFM B;  2LLY A;  2XQ5 A;  3U8M A;  4NZB A;  2XQ8 A;  4LML A;  2X00 A;  3RHW A;  3PEO A;  3SQ6 A;  4HFB A;  4ZJT A;  5FJV A;  4QAC A;  2WNC A;  4XK9 A;  4UM3 P;  4COF A;  3UU5 A;  2XZ5 A;  4UM1 A;  2BR7 A;  2ZJV A;  5HEG A;  2XNU A;  4HQP A;  2KSR A;  2XYS A;  5AFL A;  3GUA A;  2YOE A;  3U8N A;  2WNJ A;  2Y58 A;  3UUB A;  2BYP A;  5J0Z A;  2W8F A;  3RI5 A;  2BG9 E;  2YKS A;  3WTH A;  1I9B A;  3TLU A;  2X00 D;  3P4W A;  3JAE A;  4D01 A;  1OED B;  3U8L A;  3WTM A;  2LKH A;  3LSV A;  2BYS A;  5KZU A;  3RQW A;  5J5F A;  3SIO A;  4AFH A;  2XQ3 A;  2W8G A;  3WTJ A;  4ALX A;  5J5I A;  4ZJS A;  5IUX A;  1UX2 A;  4DBM A;  5J5G A;  4HFC A;  4ZK4 A;  4TWH A;  4HFE A;  5HEU A;  5AFJ A;  2VL0 A;  3U8K A;  4UY2 A;  3WTK A;  4Z90 A;  5HCJ A;  2YMD A;  3T4M A;  3TLT A;  5AFM A;  5L4E A;  4IL4 A;  2YME A;  3UU6 A;  5HEJ A;  2XQA A;  3UQ7 A;  5BP0 A;  5L4H A;  3EHZ A;  3JAF A;  4IRE A;  4UM3 A;  2WNL A;  3ZDG A;  2WN9 A;  4PIR A;  5HEO A;  4QH1 A;  4QH4 A;  5L47 A;  4UM3 S;  4B5D A;  2XQ6 A;  3C84 A;  4TNW A;  4TWD A;  2BG9 A;  2Y54 A;  3P50 A;  3WTO A;  5TVC A;  5LXB A;  3TLW A;  4ILA A;  3C79 A;  4HFI A;  5SYO A;  1UW6 A;  3UU3 A;  2LM2 A;  2M6B A;  1OED E;  4TNV A;  2MAW A;  4AFT A;  3WIP A;  5AFH A;  2XQ7 A;  4HFD A;  2XNV A;  5AFN A;  2XNT A;  2Y56 A;  2XZ6 A;  2LKG A;  2BYN A;  2ZJU A;  4ILB A;  2M6I A;  4BQT A;  2BG9 C;  3UQ4 A;  4BFQ A;  3UU8 A;  4X5T A;  3RQU A;  4A97 A;  4ILC A;  4ZRU A;  4FRR A;  3EAM A;  5J5H A;  2XYT A;  3IGQ A;  4QAB A;  2BYR A;  3EI0 A;  4A98 A;  4XHE A;  3SH1 A;  4F8H A;  5AIN A;  1OED C;  4ZK1 A;  5AFK A;  2C9T A;  4Z91 A; 
#chains in the Genus database with same CATH topology
 2ES0 A;  3FZH B;  4DR5 T;  1BR2 A;  4PFO A;  4ASK A;  2SPC A;  3WTN A;  3P4Q A;  3OYX A;  3NRX A;  2BS4 A;  5FXX A;  5LG3 A;  2LSG A;  3CIR A;  2EHO C;  2JPF A;  5JR9 C;  2VKD A;  4YHH T;  5HAX A;  4H9N C;  4YSY A;  3C98 B;  3CKD A;  4H9O C;  2IHR 1;  5FY0 A;  3N5L A;  4GK0 E;  2RA1 A;  3WTH A;  2QRX A;  4DMW A;  4D01 A;  3U78 A;  1LVF A;  2ODV A;  2DCF A;  2R6G F;  3MAC A;  5LP6 E;  1YKH B;  4C91 A;  3LDQ B;  1HX8 A;  4DBM A;  4O4L E;  5L3E B;  1D0X A;  1G73 A;  3KBU A;  1CHU A;  4YTN A;  1Z0P A;  2PBI A;  2JMH A;  2V5C A;  5L4H A;  2VKO A;  2WNL A;  1IJ5 A;  2WN9 A;  2L9Q A;  2QGS A;  2XQ6 A;  3K3Q C;  4ILA A;  4PJL A;  3H37 A;  3E0Z A;  4WZX A;  1OED E;  5AFH A;  2AE9 A;  4PFP A;  2NWB A;  3ZYM A;  2JIW A;  2L3L A;  4QAB A;  2BYR A;  3Q9D A;  2WS3 A;  5FL0 A;  5L3B B;  2V6Y A;  5CFB A;  4EEB A;  5JR9 A;  1XDO A;  4UEM A;  4LF7 T;  3OBV E;  4DV5 T;  3FZK B;  4JYA T;  1WR6 A;  1J5W A;  3SOL A;  3PE0 A;  3N9M A;  4DVD A;  3ZSS A;  3DTO A;  2E9X A;  2JRK A;  5FVL A;  1HF8 A;  5CB4 E;  3I1A A;  3ESL A;  5AFL A;  1T8B A;  3GUA A;  2V6Y B;  2I0M A;  3ZJ2 A;  5JR9 B;  4K0U A;  3P4W A;  2CLY B;  3AE4 A;  1LKX A;  4P0A A;  5KZU A;  4AFH A;  5AQH B;  5J2U E;  1MIY A;  5DJQ C;  3AEF A;  4DUY T;  3O1J A;  3PJA J;  3AVS A;  4CN6 A;  1KNZ A;  3ZMU B;  5FL1 A;  2E9X B;  5HEJ A;  1HFA A;  1MMA A;  3EUH A;  2WP9 A;  4UM3 A;  2UUB T;  4UF0 A;  2XAH B;  2UXB T;  4WYV A;  2LSY A;  3C79 A;  2W00 A;  3AAE B;  3FBZ A;  3WIP A;  1UX5 A;  4HWI B;  3VHL A;  2BKO A;  1O3X A;  3PUZ F;  2NTY A;  5J5H A;  5AQI B;  4XZC A;  4DV6 T;  2BKP A;  4YTP A;  1NEN A;  2CXD A;  1HNZ T;  2A9U A;  3ZKR A;  5L3G B;  4UF0 B;  5AQV B;  2CXF A;  4ZI2 D;  2IML A;  4AI6 A;  1CUN A;  3QB5 K;  4AFG A;  3SFD A;  1DU2 A;  3CK6 A;  1YQ3 A;  2CBJ A;  3PU8 A;  2KLQ A;  3WTI A;  5CO5 A;  3EDU A;  2K24 A;  4DR7 T;  4ZS3 A;  3RHW A;  1M7K A;  2K5B B;  4XK9 A;  2XZ5 A;  4KMC A;  3IEE A;  2CHN A;  2YOE A;  3IF8 B;  5LHH B;  2WMN A;  3J7Y q;  4E7S A;  1IZN B;  5CGM A;  1FIO A;  1JNR A;  2NW7 A;  3PTR B;  2W8G A;  3QUJ A;  5EK3 A;  1VCS A;  3I0Q A;  2BS3 A;  4E7Z A;  4QWN B;  4CI1 B;  2IC6 A;  5DQW A;  3ZMV B;  3U8K A;  3T4M A;  2JQ9 A;  1MMN A;  3UT5 E;  2C5I T;  3UU6 A;  2UU9 T;  4IRE A;  1NWM X;  4ZI3 C;  3ZLI A;  4YXD A;  2G0U A;  2LM2 A;  4IGU A;  3O9X A;  1QUU A;  1W09 A;  5LHG B;  3C4Z A;  5HXH A;  1NEK A;  3NBX X;  4HFD A;  2X9X A;  4YSZ A;  3AEC A;  1HNW T;  5BMV E;  4JI2 T;  4CXX A;  4JV5 T;  1D0Y A;  2ODU A;  4GOU A;  1JNZ A;  4AQG A;  3AED A;  4IL9 A;  4AQY T;  2UXC T;  2KMF A;  3RGL A;  2XAQ B;  5H6R B;  3PUV F;  1OED A;  2WZY A;  4X20 E;  3PJA A;  3UU4 A;  4ZZC A;  3RIF A;  3CQC B;  4DV3 T;  1KFY A;  5KE4 A;  3ZT7 A;  1G8X A;  1XZY A;  4IDN A;  1D0Z A;  2Y57 A;  4L9I A;  2DHR A;  4PNI A;  2UXX B;  1ZHC A;  5FMN A;  4JEH B;  2KSR A;  1J1J A;  3ZMZ B;  2Y6X A;  4FI5 A;  3F2E A;  3C4W A;  4YJ2 E;  3U8N A;  2Y58 A;  2E9X D;  4UXN B;  3UTK A;  5HXE A;  4B3T T;  4KP3 C;  5JTG A;  1OED B;  5C3J A;  1YXR A;  3OVU A;  3MA9 A;  1IAP A;  3PV0 F;  4EXT A;  4NUU A;  5DQV A;  4CXW A;  5L47 A;  2K9A A;  4QKN A;  4YJ3 E;  3CQX C;  4DBR A;  2GK9 A;  2X9H A;  3ANW A;  3DP7 A;  5F5W A;  1L0V A;  3LG7 A;  1HX1 B;  1XDP A;  2NP9 A;  4PK6 A;  4XBF B;  3VKH A;  4BQT A;  2MYS A;  5AQT B;  2UUC T;  5LMN T;  3QB5 A;  1V9D A;  2X68 A;  3KV4 A;  3JAD A;  2XSA A;  2B76 A;  2VB6 A;  3BQK A;  2KXP B;  4EGW A;  3ANW B;  1W9R A;  2PTF A;  3T1Y T;  1I94 T;  1XNQ T;  1MIV A;  3ETV A;  4Z8X A;  5HXS A;  1YQ4 A;  3SFE A;  5HXC A;  2XQ5 A;  4LML A;  4MLK A;  2DWK A;  4NIQ A;  4JI8 T;  1XNR T;  3AEE A;  5LYJ E;  4DR4 T;  2ZJV A;  2MBG A;  3UUM A;  1FJG T;  2BYP A;  5LGT B;  3Q5X A;  1LVK A;  2LM9 A;  3KVB A;  3AE5 A;  3JAE A;  3LK3 B;  3Q5W A;  3QC9 A;  3SWH A;  4LFA T;  1N34 T;  2HHH T;  2A2F X;  3K8P C;  4PW8 A;  4A5X A;  3AE3 A;  4TWH A;  2JQK A;  3AE1 A;  4X64 T;  2J62 A;  4LF4 T;  1XMQ T;  3JAF A;  3PUR A;  4X65 T;  3KV9 A;  3C84 A;  2YEV C;  5LXB A;  4DV2 T;  4CXY A;  1U4Q A;  2DNX A;  2KWH A;  2WCA A;  3W15 B;  2IC9 A;  5LBM A;  2VKJ A;  5AFN A;  4IE4 A;  3WI3 A;  4MAL A;  4ILB A;  4A97 A;  3NVO A;  2V8S V;  4J2C A;  3IGQ A;  5AIN A;  2VK9 A;  5FXV A;  1ZV4 X;  4BAY B;  1ZKE A;  5AQN B;  4DR3 T;  3BK9 A;  1Z8U A;  5ADX L;  4YHJ A;  4OK0 A;  4I43 B;  2BVM A;  5KX5 E;  2UZ6 A;  2YN6 A;  3N9O A;  2WM9 A;  3TLV A;  3NZQ A;  2VAS A;  1WRD A;  2D0U A;  3AA7 B;  4UVA B;  2H3R A;  4NXN T;  4EV6 A;  2BZB A;  4O4J E;  1FMW A;  3UU5 A;  5LMU T;  1HG5 A;  4AQF A;  2XYS A;  4HWF A;  2CBI A;  5AQQ B;  4GIW A;  1H7C A;  2XUE A;  3OJA A;  1I6Z A;  5J0Z A;  5LCY A;  2L8K A;  4ISS A;  4HN9 A;  2LKH A;  4CI3 B;  4DV4 T;  3NKZ A;  3A8Y C;  3UUL A;  5HEU A;  3IBP A;  4LF5 T;  2YMD A;  3PUW F;  3EDV A;  5C2T A;  3FZF B;  3EHZ A;  4MFR A;  3RH3 A;  2K3W A;  1AJ3 A;  4ZI3 D;  4TWD A;  5LNK A;  4QXB B;  5SYO A;  2KWI B;  2ACX A;  2MAW A;  2LSK A;  2XPK A;  5LGU B;  2XSB A;  4I55 E;  5JDF A;  3ZYK A;  4YLH A;  2LOS A;  3I0O A;  1YKE B;  4DV7 T;  3PUQ A;  4AIU A;  4U74 A;  5AFU L;  4ZEY A;  4UEL A;  4Q25 A;  4GYS A;  4PK4 A;  3JC6 C;  4JI0 T;  2X9Y A;  3MJX A;  1UCU A;  3K3N A;  1VCT A;  5FY7 A;  3P7I A;  3NWI A;  4QH5 A;  2M67 A;  4HGA A;  3U3I A;  3E22 E;  4AKI A;  2VVN A;  1VRB A;  2VKH A;  2ZLY A;  2EHO A;  2YU2 A;  3AVR A;  3RYC E;  4ADZ A;  2ZMA A;  2UUA T;  3HKD E;  2KT9 A;  4LF6 T;  2C0S A;  2BYS A;  2WB5 A;  5J5I A;  5AQR B;  5LGN B;  4EZ4 A;  2J47 A;  5J5G A;  3MKD A;  1IJ6 A;  3UFG A;  5AFJ A;  2VL0 A;  3M65 A;  5FVK A;  4ZOL E;  3FZL B;  5L4E A;  3B5M A;  4AXP A;  2XQA A;  4BJM A;  3ZPO A;  5JVD E;  3ZDG A;  4IDO A;  2EHO B;  5EK2 A;  4QXH B;  4ERR A;  4B5D A;  2IAK A;  3C51 A;  4HFI A;  1MMG A;  4DUZ T;  3RKO A;  5C8Y E;  4KBM B;  2XNT A;  2LKG A;  2I59 A;  4ILU A;  3DJB A;  2H88 A;  2X51 A;  4OYJ A;  2BBJ A;  4N78 D;  1T7S A;  4LF8 T;  3KBT A;  3RKG A;  4BA9 A;  4G63 A;  4ZK1 A;  3H3A A;  4AKG A;  4ZHQ E;  3PMZ A;  2JQH A;  3VKG A;  3RIA A;  3PUX F;  3Q5D A;  4NPP A;  2CMR A;  2K48 A;  4UVB B;  2Q9Q C;  4XAX B;  2WMO A;  4LMK A;  4YT0 A;  4KHP T;  2FJA A;  3C4X A;  4NZB A;  4OX9 T;  4B3M T;  1HG2 A;  4UM3 P;  2CPT A;  4IDQ A;  4UV8 B;  2OLT A;  5HEG A;  2LHR A;  5JDQ A;  3RRC A;  1E1H B;  5BR8 T;  4YFS A;  2BG9 E;  3ZST A;  4O2A E;  5EK4 A;  4U7I A;  1WFD A;  1QSD A;  2KIN B;  3N9Q A;  4O4H E;  1YW0 A;  1KNR A;  4HTE A;  4PAG A;  3QK6 A;  3KIN B;  2V7L A;  2UXD T;  5AFM A;  4IL4 A;  3ZJ1 A;  2VWA A;  2WDQ A;  3J9X 1;  4QH1 A;  1GQE A;  2IUB A;  4TX5 A;  5LA6 E;  4HWH A;  3CML A;  3HA4 A;  3C50 A;  3AE8 A;  4TNV A;  2AXD S;  2XNV A;  2BYN A;  5ABH A;  5HXR A;  3P4R A;  3ZC1 A;  2WDR A;  2XYT A;  3M3Z B;  4DND A;  4Z91 A;  1YD8 G;  2CXL A;  3RRW A;  4H63 V;  2HPJ A;  2PGZ A;  4P0B A;  2Q9Q A;  4V1A v;  1IBL T;  4A56 A;  2XQ9 A;  4TWF A;  3R84 B;  4DV1 T;  1OXZ A;  4ZZB A;  1ZEE A;  5IWA T;  5FKY A;  3LK2 B;  3FXD B;  4YSX A;  4U31 A;  4HWD A;  4U33 A;  3P8C D;  5AQU B;  3PEO A;  1XWM A;  2VL8 A;  2LSI A;  4HWC A;  3AE2 A;  2XM1 A;  1IBK T;  2P9B A;  5LOV E;  2XNU A;  2X0Y A;  5AQO B;  4IT4 A;  4ZI7 E;  1R8I A;  2RPA A;  3ZN1 B;  1KF6 A;  4JI7 T;  1HS7 A;  3WTM A;  5J5F A;  3BQI A;  2XQ3 A;  3N9N A;  4ZJS A;  1WR0 A;  2EHO D;  1T98 A;  2E5V A;  1B7T A;  5TAO A;  2IIU A;  2XZE A;  5ABE A;  2XHE B;  2VUR A;  2Z6E A;  3RIU C;  4HE8 A;  3RYI E;  2PFV A;  3S4U A;  3KFW X;  4DR1 T;  2W0G A;  3LJC A;  2CWO A;  2W62 A;  2WQY A;  4CI2 B;  3CX6 B;  3PUS A;  2BG9 C;  5JQG E;  1D1A A;  3WAJ A;  3HKE E;  1Y64 B;  2A3D A;  3RC3 A;  4A98 A;  3ONX A;  3C64 A;  5H6Q B;  4U3C A;  3L39 A;  2CRB A;  5BW2 A;  1U5P A;  3JC6 D;  4QXC B;  4DMV A;  3MXZ A;  2F4V T;  2PG8 A;  4O2B E;  5FNV E;  4WV9 A;  2WBL A;  4NUV A;  3BQL A;  5LB7 B;  2FUP A;  4IDZ A;  2MOZ A;  2WY2 A;  4I4T E;  5ABF A;  4UM1 A;  4DBQ A;  4DR2 T;  4JEU B;  3P4P A;  4EAH A;  3FZM B;  2MPK A;  5AQS B;  3N2K E;  2N1G A;  2A72 A;  5AQF B;  1I9B A;  5CJ5 A;  2N2N A;  3RIU A;  3AA1 B;  3RYF E;  2IW5 B;  2KZ7 B;  4HFE A;  1KEY A;  3RPU A;  2H7V C;  4X1K E;  4PJJ A;  5ABF B;  4H63 H;  3LK4 2;  4TNW A;  2BG9 A;  4LFC T;  5TVC A;  2V5D A;  4ZI2 C;  3TLW A;  1WYB A;  5KDM C;  1XMO T;  3ABV A;  3PDY A;  3O1I A;  2Y56 A;  3A5X A;  1S35 A;  2XAS B;  3UQ4 A;  1QLB A;  4BFQ A;  2JJ9 A;  2XJ7 A;  2JQQ A;  4ILC A;  1FMV A;  1BR1 A;  1IBM T;  3HI2 A;  3EI0 A;  3TKL B;  3SH1 A;  1X79 A;  3UFE A;  2C9T A;  2Y7Y A;  5ETW A;  3N9L A;  4ZS2 A;  1N33 T;  3U8J A;  4LMJ A;  3IA3 A;  2WZH A;  2X9W A;  4PJM A;  4X1I E;  1VOM A;  2BG9 B;  2QC1 B;  4TV9 E;  3JCF A;  1N32 T;  2KND A;  3ZC0 A;  4MHC A;  1D1B A;  4QAA A;  4EYY R;  2PJQ A;  4I0U A;  3VR9 A;  2Q9Q D;  3Q2M A;  4U2Z A;  2X67 A;  1HCI A;  4HQP A;  3WAK A;  4K0K T;  2W2U A;  2V1D B;  2J4G A;  3RI5 A;  5JH7 E;  2MTQ A;  1N36 T;  4JI5 T;  2HN1 A;  3X1D A;  4ALX A;  2V7M A;  4ZK4 A;  2FJE A;  3VU7 H;  2C5J A;  2ZM6 T;  3GN5 A;  1E2A A;  4C90 A;  5LJM A;  3AE9 A;  4MBQ A;  3AA0 B;  3ZMT B;  2JMK A;  2WZI A;  2ZM2 A;  3OTO T;  4O4I E;  3RLF F;  4JBW F;  1UW6 A;  3KVA A;  4KHZ F;  2W63 A;  2YIN A;  2XQ7 A;  4GK5 E;  5JDG A;  2CCQ A;  3VRA A;  4DV0 T;  3GN5 B;  4F8H A;  2CLY C;  1E7P A;  2WDV A;  5CA0 E;  3FXE B;  3T8O A;  3LBX A;  5HCM A;  3KV6 A;  5E0O A;  2E9X C;  2I6H A;  2WWU A;  2E5L T;  5JDN A;  3PUG A;  1MNE A;  4IE5 A;  5GON E;  4U7Y A;  3CX7 B;  2YDQ A;  4IE0 A;  3PU3 A;  4LFB T;  4COF A;  4TZ4 C;  2V7I A;  5LG4 A;  2WNJ A;  3GA8 A;  3LBX B;  2E2A A;  2IDO B;  2LRK A;  3I9Y A;  5F3J A;  2BDE A;  3LSV A;  4H9Q C;  2WWV A;  3SIO A;  4CQI A;  3V5U A;  3QNU A;  2BVL A;  4HFC A;  3WTK A;  4Z90 A;  4IIJ E;  3ETU A;  4HKA A;  2NW9 A;  4H9S E;  1S94 A;  3O1H A;  5HEO A;  4UM3 S;  4YTM A;  2X0L B;  4GKK T;  3UU3 A;  2W4X A;  4WBO A;  2XZ6 A;  1HR0 T;  5JRE A;  2YDS A;  2HN2 A;  4IST A;  3AAA B;  2VQF T;  1UGO A;  4ZRU A;  3MK7 C;  4JI6 T;  3FBL A;  5KXJ A;  5L2L A;  5L3F B;  3D0T A;  4LF9 T;  1MIW A;  4UIG A;  2Y8D A;  4L0R A;  4P09 A;  2FJB A;  5HWY A;  5BRX A;  2BBH A;  3WTL A;  3ZDH A;  5J2T E;  1US7 B;  4KUM B;  4GKJ T;  5AQM B;  3RYH E;  5AQG B;  3L3P A;  3U8M A;  2XQ8 A;  1NAF A;  2XY8 B;  5M4Y A;  3SS1 A;  3CVR A;  3F57 A;  4WBN E;  2WU5 A;  2YKS A;  5JRC A;  4OYK A;  2ZM0 A;  2V26 A;  2V7K A;  2XAF B;  4UY2 A;  5AQL B;  3L09 A;  5AQJ B;  3CWZ B;  2YME A;  2WAU A;  5JDL A;  4P1N A;  3AE6 A;  3LFM A;  3Q5E A;  5JDH A;  2QVA A;  4QX8 B;  2YDR A;  4JI4 T;  3B13 A;  3PUA A;  1BR4 A;  3QOF A;  1HTJ F;  3UUN A;  1SA0 E;  2NTX A;  4UR9 A;  5JRC B;  2WSS V;  4I50 E;  4AKR B;  2LJL A;  3ZCI A;  3UU8 A;  5EZY E;  2CHO A;  4FRR A;  2LHN A;  2J1D G;  4CN1 A;  4IE6 A;  1OED C;  4X62 T;  5AFK A;  5JME A;  3PUY F;  1UV6 A;  2DI4 A;  2V7J A;  5J1G A;  4DR6 T;  1SE7 A;  4KX6 A;  1KK7 A;  4TUY E;  2BYQ A;  5LHI B;  3ZEF B;  4IDP A;  2X0H A;  2LSJ A;  3AEA A;  3HR0 A;  5AFM B;  3N2O A;  4EIW A;  2X00 A;  4H9P C;  3MZK B;  4QAC A;  2WNC A;  2CA5 A;  3RF1 A;  3R6N A;  2BS2 A;  2VQE T;  1HNX T;  4H9R C;  2HH7 A;  4O8S A;  2CEA A;  4ZXL A;  3UUB A;  4UV9 B;  3ZMS B;  3AEB A;  5L3C B;  4JI3 T;  3TLU A;  2C5K T;  3U8L A;  3ZT6 A;  3WTJ A;  4B3S T;  5LXT E;  4B3R T;  4WNK A;  4TV8 E;  4NXM T;  2RP4 A;  2V6X A;  5A1L A;  3UUX B;  2XAJ B;  4L5G A;  3B57 A;  2X66 A;  5FYM A;  2Q9Q B;  2CM0 A;  4PIR A;  2HPL A;  3AA6 B;  5L3D B;  4JI1 T;  2Y48 B;  3P50 A;  4FJO A;  4EB6 E;  3RC8 A;  4BJN A;  3N2G E;  2LOP A;  4WW0 A;  4G2A A;  4ANJ A;  3K3O A;  3ZYL A;  3ONJ A;  4KI0 F;  2H89 A;  3AAI A;  3EAM A;  3FHN A;  1UUR A;  5IYZ E;  2CWY A;  5IHY A;  3NRY A;  2OV9 A;  1D1C A;  3CPZ A;  4OHF A;  4ZR6 A;  2UXN B;  3T1H T;  1WCR A;  5HEH A;  1UK5 A;  2XAG B;  2XQ4 A;  4EZ1 A;  4AIS A;  2BR8 A;  1X9B A;  4EYU A;  5FY1 A;  3ZCJ A;  3OPC A;  5JDM A;  2DWG A;  1T72 A;  3VR8 A;  3SQ6 A;  4ZJT A;  4HFB A;  4X66 T;  5ABG A;  5FJV A;  5LJN A;  3SRZ A;  4JUY A;  1KNP A;  3CX8 B;  5KMG P;  4JLE A;  1SHZ C;  2OA5 A;  2XTL A;  1FEW A;  2LE8 A;  1EZ3 A;  4IHJ E;  4EZH A;  2VVS A;  3HKC E;  2LEH A;  4PJN A;  5IUX A;  1ZOY A;  4M1P A;  2QYW A;  4F6R C;  5F8P A;  1ZP0 A;  3H3M A;  5HCJ A;  2NOX A;  3F31 A;  1W0A A;  2BKN A;  4CZZ B;  2LT3 A;  4QHO A;  3KDS E;  4PK5 A;  5LBQ B;  4QH4 A;  3AE7 A;  4YY3 T;  4DID B;  2Y54 A;  1MMD A;  2H7O A;  3NZP A;  3CQG B;  5FP3 A;  3OYZ A;  2D2S A;  3GMI A;  1UX4 A;  3KV5 A;  1OWA A;  2ZJU A;  2M6I A;  2WU2 A;  2N9D A;  3RQU A;  3OKQ A;  4QX7 B;  2XM2 A;  2D5U A;  1MND A;  1WLX A;  2NR4 A;  4EOZ B;  2DL1 A;  4UXU A;  3I9W A;  3ZT5 A;  3SQ9 A;  4UVC B;  4GYR A;  2PH9 A;  2BJ0 A;  3AXJ A;  3ZN0 B;  5HWX A;  4EED A;  2ACZ A;  4HFH A;  3TLS A;  5HYA A;  4AQF C;  4HEA A;  4IE7 A;  4X1Y E;  2LLY A;  1WYC A;  3E08 A;  2B1E A;  3N9P A;  3FB2 A;  5FXW A;  2NW8 A;  3O4X E;  4B6X A;  2BR7 A;  2FBW A;  4OFZ A;  2W67 A;  2XQY A;  1UUS A;  3AB3 B;  3P4S A;  3A7M A;  1W0B A;  2W8F A;  2X00 D;  3L8R A;  4U72 A;  3AXJ B;  1LRZ A;  3RQW A;  2CE7 A;  1UX2 A;  1M62 A;  3AEG A;  2QA7 A;  2YU1 A;  2W66 A;  3HL6 A;  1SUM B;  4TN7 B;  2FJD A;  3G06 A;  1Y01 A;  5CA1 E;  3TLT A;  4DO0 A;  5BP0 A;  3UQ7 A;  5AQK B;  3VRB A;  5DAB A;  2D9D A;  3EAB A;  2DLR A;  2W61 A;  1BR0 A;  3IHR A;  3WTO A;  5FXZ A;  5AQP B;  3EVY A;  4AKL A;  3GWH A;  4AKH A;  2M6B A;  4AFT A;  3K1S A;  2D0T A;  4U2Y A;  3HKB E;  3RX6 A;  4X5T A;  3ONL C;  2YK0 A;  4CN4 A;  2LRL A;  4XHE A;  1J5E T;  2E8I A;  4HFV A;  3V5S A;  2ZM8 A; 
#chains in the Genus database with same CATH homology
 5JME A;  4IL9 A;  3JAD A;  4UXU A;  2Y7Y A;  5CFB A;  1UV6 A;  2PGZ A;  3U8J A;  3SQ9 A;  3ZKR A;  4LMJ A;  4ZR6 A;  5HCM A;  3PMZ A;  5BW2 A;  2PH9 A;  5HEH A;  5BRX A;  2XQ9 A;  4TWF A;  3WTN A;  2BG9 B;  1OED A;  2QC1 B;  2WZY A;  2BJ0 A;  3WTL A;  3ZDH A;  2XQ4 A;  4AFG A;  2UZ6 A;  2YN6 A;  3UU4 A;  2BYQ A;  4ZZC A;  4EZ1 A;  3RIF A;  5LG3 A;  4ZZB A;  4WV9 A;  3RIA A;  4HFH A;  3TLS A;  4NPP A;  2BR8 A;  3TLV A;  5KE4 A;  4QAA A;  4QH5 A;  3WTI A;  4LMK A;  5CO5 A;  2Y57 A;  5AFM B;  2LLY A;  2XQ5 A;  3U8M A;  4NZB A;  2XQ8 A;  4LML A;  2X00 A;  3RHW A;  3PEO A;  3SQ6 A;  4HFB A;  4ZJT A;  5FJV A;  4QAC A;  2WNC A;  4XK9 A;  4UM3 P;  4COF A;  3UU5 A;  2XZ5 A;  4UM1 A;  2BR7 A;  2ZJV A;  5HEG A;  2XNU A;  4HQP A;  2KSR A;  2XYS A;  5AFL A;  3GUA A;  2YOE A;  3U8N A;  2WNJ A;  2Y58 A;  3UUB A;  2BYP A;  5J0Z A;  2W8F A;  3RI5 A;  2BG9 E;  2YKS A;  3WTH A;  1I9B A;  3TLU A;  2X00 D;  3P4W A;  3JAE A;  4D01 A;  1OED B;  3U8L A;  3WTM A;  2LKH A;  3LSV A;  2BYS A;  5KZU A;  3RQW A;  5J5F A;  3SIO A;  4AFH A;  2XQ3 A;  2W8G A;  3WTJ A;  4ALX A;  5J5I A;  4ZJS A;  5IUX A;  1UX2 A;  4DBM A;  5J5G A;  4HFC A;  4ZK4 A;  4TWH A;  4HFE A;  5HEU A;  5AFJ A;  2VL0 A;  3U8K A;  4UY2 A;  3WTK A;  4Z90 A;  5HCJ A;  2YMD A;  3T4M A;  3TLT A;  5AFM A;  5L4E A;  4IL4 A;  2YME A;  3UU6 A;  5HEJ A;  2XQA A;  3UQ7 A;  5BP0 A;  5L4H A;  3EHZ A;  3JAF A;  4IRE A;  4UM3 A;  2WNL A;  3ZDG A;  2WN9 A;  4PIR A;  5HEO A;  4QH1 A;  4QH4 A;  5L47 A;  4UM3 S;  4B5D A;  2XQ6 A;  3C84 A;  4TNW A;  4TWD A;  2BG9 A;  2Y54 A;  3P50 A;  3WTO A;  5TVC A;  5LXB A;  3TLW A;  4ILA A;  3C79 A;  4HFI A;  5SYO A;  1UW6 A;  3UU3 A;  2LM2 A;  2M6B A;  1OED E;  4TNV A;  2MAW A;  4AFT A;  3WIP A;  5AFH A;  2XQ7 A;  4HFD A;  2XNV A;  5AFN A;  2XNT A;  2Y56 A;  2XZ6 A;  2LKG A;  2BYN A;  2ZJU A;  4ILB A;  2M6I A;  4BQT A;  2BG9 C;  3UQ4 A;  4BFQ A;  3UU8 A;  4X5T A;  3RQU A;  4A97 A;  4ILC A;  4ZRU A;  4FRR A;  3EAM A;  5J5H A;  2XYT A;  3IGQ A;  4QAB A;  2BYR A;  3EI0 A;  4A98 A;  4XHE A;  3SH1 A;  4F8H A;  5AIN A;  1OED C;  4ZK1 A;  5AFK A;  2C9T A;  4Z91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...