3UUBA

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in solution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 95
structure length 311
sequence length 311
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uubA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uubA01
3WTKA 3TLTA 5J5HA 4UM1A 4A98A 3T4MA 4UM3S 3EAMA 5HCJA 2XQ6A 2Y54A 3UUBA 2W8GA 1OEDB 4WV9A 4ZR6A 2PH9A 3SQ9A 4Z91A 5L4EA 4UM3P 5LXBA 4ZJTA 2LKHA 2MAWA 3TLSA 3UU4A 2BG9B 3UU3A 3WTIA 5HEUA 2XQ4A 2Y58A 3EHZA 5AFKA 4HFCA 5HCMA 3RIFA 3TLVA 3LSVA 3P4WA 4LMJA 4B5DA 3RI5A 5BP0A 3RIAA 4COFA 4ZRUA 5KZUA 5LG3A 4BQTA 2PGZA 2M6IA 4TWDA 2Y57A 4Z90A 2WNLA 5J5GA 2QC1B 2XNUA 2ZJVA 4X5TA 4QH5A 2BYRA 2XNVA 3UQ7A 2XZ6A 1OEDE 3PMZA 2BR8A 3EI0A 2ZJUA 2BYPA 5AFJA 4ILCA 2XQ7A 3WIPA 2WNJA 4BFQA 4FRRA 2BG9E 2VL0A 3U8JA 4IREA 3UU6A 5L47A 5BW2A 5J5IA 3RQWA 2BR7A 2LM2A 2XQ3A 4UY2A 4A97A 5KE4A 4IL9A 2BG9A 2WNCA 4HFIA 4ZK4A 4ZK1A 5FJVA 4NZBA 4PIRA 2Y56A 2YMEA 2XQ5A 5HEOA 2YKSA 2BYNA 4HQPA 1OEDA 3ZKRA 4ZJSA 4AFHA 1UX2A 4TNVA 2BYSA 2XYTA 2XZ5A 3WTHA 3WTOA 2M6BA 4XK9A 3C84A 4DBMA 4QAAA 3JAEA 4ILAA 4ALXA 3WTMA 2KSRA 1UV6A 4EZ1A 4ZZBA 2WN9A 4D01A 3JAFA 4HFBA 5AINA 4HFEA 4QH1A 3TLUA 2YMDA 2XQ8A 4XHEA 5J0ZA 3JADA 3TLWA 4UXUA 3WTJA 4TWFA 5AFMA 2W8FA 2WZYA 3ZDHA 2XQAA 2Y7YA 3U8LA 5JMEA 3RHWA 2XYSA 2UZ6A 5SYOA 5AFLA 5HEJA 3U8NA 5J5FA 4TWHA 4LMLA 5HEGA 2BYQA 4QH4A 1UW6A 5HEHA 4QACA 5IUXA 4LMKA 5TVCA 3U8MA 2YN6A 5L4HA 3WTLA 4HFHA 2C9TA 5AFHA 3PEOA 2LKGA 5CO5A 5AFMB 4ZZCA 3U8KA 3GUAA 4QABA 4NPPA 2BJ0A 3RQUA 3UU5A 4AFGA 1I9BA 5CFBA 3P50A 4TNWA 4HFDA 3UQ4A 4F8HA 4AFTA 2XQ9A 2YOEA 3UU8A 3SH1A 4IL4A 3SIOA 3WTNA 2LLYA 4UM3A 3IGQA 3C79A 1OEDC 4ILBA 3SQ6A 5AFNA 2XNTA 5BRXA 3ZDGA 2X00D 2X00A 2BG9C
chains in the Genus database with same CATH superfamily
5AQFB 5DJQC 2P9BA 4WYVA 4A98A 4PJJA 2XQ6A 3P4PA 3ONXA 4ZR6A 2KWIB 4HN9A 3FHNA 4DV5T 2NW8A 4HKAA 5JDHA 2ZMAA 1KF6A 5AQQB 2CEAA 3CX8B 1LVFA 3SS1A 4BQTA 2WNLA 3KVAA 1H7CA 3MA9A 2XNVA 3H3AA 2QA7A 2ZJUA 2V26A 3VRAA 1MIVA 4U2ZA 2G0UA 1HNXT 4J2CA 3I0OA 4EB6E 2WNCA 3AA7B 2HN1A 3SFDA 4AQFA 4O4HE 4IGUA 1HG5A 4UXNB 4IE5A 3ZJ1A 3JADA 4UXUA 1VOMA 5LGUB 5FXXA 3ZSSA 4NXNT 4A5XA 5AFLA 4IDOA 4EV6A 4H63H 2E9XC 3AB3B 3GN5B 3N2GE 2V6YB 2E5VA 3OJAA 2JQQA 4X1IE 1X79A 2WS3A 4QKNA 3MZKB 1I9BA 4G2AA 2VVNA 2HN2A 3I0QA 3P7IA 3SIOA 3A5XA 4PFOA 2K24A 3LBXA 1LRZA 1LKXA 4YXDA 2VASA 4IT4A 5JR9A 4XAXB 4LF9T 4I43B 4H9SE 5KXJA 4JEUB 2HPLA 4WV9A 4H9QC 2YEVC 3OVUA 3TLSA 5AQRB 3WTIA 5HEUA 3EHZA 1YXRA 2V6XA 2JIWA 4PW8A 2M6IA 4AIUA 3CK6A 2BS2A 4X5TA 2BBJA 4UELA 4ZHQE 5FXVA 5EK4A 3P4RA 4ILCA 4JYAT 5AQOB 4C91A 3ZMUB 4JEHB 2XUEA 1OWAA 1KNRA 5DQWA 4TX5A 4OYKA 4WW0A 5AQVB 3ZKRA 2FJAA 1UX2A 2V7MA 4HWHA 4DBMA 4LFAT 4UV8B 5AQGB 3PUVF 3E08A 5AQNB 5AINA 3TLWA 4FJOA 4CI1B 2UZ6A 5JR9B 2W2UA 2LSKA 5JDGA 1WCRA 3PUXF 3HL6A 4PK5A 4N78D 3N2KE 3GUAA 1WR6A 4ZI3C 3AVRA 3N9PA 2WM9A 3IGQA 3CIRA 2QGSA 2N2NA 4JI0T 4NUUA 4UVCB 2L8KA 5ABHA 2V8SV 2BG9C 3G06A 3LG7A 4CI2B 2VQET 2XTLA 3CKDA 3ZSTA 3EAMA 3O9XA 3LBXB 2PH9A 3SQ9A 1X9BA 2W67A 5ABEA 5DQVA 2Z6EA 4XBFB 3PJAJ 3FZLB 3P4WA 5FP3A 3VKGA 3NZPA 3PUSA 5KZUA 2E8IA 4O4LE 4LF6T 2WP9A 4PJMA 2YINA 4ZEYA 1N33T 4IDNA 4L0RA 2LM2A 1MMGA 4DR7T 4HFIA 2B1EA 4ZK4A 5LG4A 4ZK1A 4NZBA 4PIRA 4YLHA 2M6BA 1E1HB 4AKRB 1QUUA 3PE0A 4GKJT 4ERRA 4PJLA 2CCQA 4QHOA 1D0XA 2JJ9A 3GA8A 4K0UA 3O1HA 5LHHB 1MMNA 3AAAB 4XHEA 3WTJA 2WB5A 4U3CA 2J47A 2LSYA 2Y7YA 2CPTA 3N9LA 2UUBT 3AEBA 3WAJA 2I6HA 2Q9QB 4IE0A 3KDSE 5AFUL 2WCAA 3X1DA 5AQPB 3C4WA 5TVCA 3RYHE 5JREA 3AEGA 3NVOA 3VHLA 3IHRA 2HHHT 3JCFA 1D0ZA 4MHCA 1G73A 2XQ9A 4IL4A 4K0KT 3RYCE 5BRXA 4ZS3A 5JH7E 4DV4T 3PUAA 2HH7A 5HXHA 5C2TA 4G63A 5JDFA 5LCYA 3ONLC 1WR0A 4EYYR 3EDVA 5LJMA 5LGTB 5LMUT 4ASKA 2ODVA 4OHFA 5HXEA 3O1JA 3V5SA 2OLTA 2Y57A 3GWHA 2W61A 3C4XA 2WDRA 2CMRA 2E9XB 4H63V 3ZN1B 2XZ6A 3LK2B 5L2LA 2SPCA 5AQLB 2NTXA 3SOLA 3RQWA 5L3GB 2KZ7B 3N9NA 1W0BA 3AE1A 2C0SA 1ZEEA 4DMVA 4E7SA 3WTHA 3BQLA 5AQJB 4NXMT 3B57A 2WZIA 1HR0T 3CQXC 2XQ8A 4KX6A 3FBZA 3RGLA 3U8LA 2D9DA 5CJ5A 2YU1A 2KMFA 3KV9A 5HEJA 2H7OA 3LK3B 1BR0A 4DR3T 4U74A 2X9WA 4AFGA 4EEBA 5FMNA 3UQ4A 1QLBA 4GYSA 4LF8T 3N9MA 5FL1A 3Q5DA 3QB5K 1HNZT 2X00A 4KHZF 2VVSA 4CN1A 3MK7C 3PJAA 3VKHA 3WAKA 2WAUA 2J1DG 4B3RT 4M1PA 2CWOA 3M3ZB 4U31A 2LOSA 4GK0E 4UVAB 3LFMA 5LMNT 3UUXB 5BP0A 4LFBT 3FZFB 3EUHA 4Z90A 5J5GA 1CHUA 3TKLB 3NKZA 2FJDA 2XHEB 4QH5A 4AQFC 4KBMB 4TV9E 3UUMA 3UT5E 1YQ4A 2ZM2A 4CXWA 3U78A 4OFZA 3KBTA 2VK9A 1N32T 3KV6A 3UTKA 4H9NC 2VL8A 4HEAA 3ZJ2A 1EZ3A 1BR2A 4QAAA 5FVLA 4DV1T 4EZ1A 2JQHA 4HGAA 3FB2A 5C3JA 2CXLA 5C8YE 5FNVE 2NP9A 5J2TE 4X65T 4IDPA 3UUNA 4YY3T 2Q9QA 2C9TA 3UFGA 5JDNA 1GQEA 4EIWA 4ZZCA 2KLQA 3RF1A 3PU3A 1WFDA 4O4IE 3VR8A 2LLYA 4OYJA 5AQUB 3ZDGA 2D0TA 2DHRA 3WTKA 1FMVA 4H9PC 4F6RC 3ETUA 1YQ3A 1J1JA 2VKDA 5KDMC 2PBIA 2H88A 4TV8E 5HCMA 3IF8B 4LMJA 1M7KA 1ZKEA 2QVAA 4PNIA 5E0OA 2BKPA 3L09A 2ZJVA 4B3TT 1HFAA 3KVBA 2V7KA 4X62T 2Q9QC 2UXCT 4I4TE 1XMQT 2XM2A 3UULA 4DNDA 1DU2A 4PJNA 2XQ5A 2YKSA 2BYSA 1T98A 2XPKA 4CN6A 2VWAA 4ILAA 2Y8DA 3AAIA 3S4UA 4ZI3D 1VCSA 4P1NA 3RHWA 4PK4A 2I59A 5AQKB 3AE2A 1Y64B 5HEGA 4HWFA 3AEEA 1NWMX 3T1YT 4X66T 1Z8UA 1MNEA 3PEOA 5CO5A 2XAFB 2CXDA 5L3BB 1T8BA 4NPPA 3UU5A 2IUBA 4HFDA 2XQYA 3IA3A 1T7SA 1MIYA 5AFNA 3ABVA 4YT0A 4YTMA 5JQGE 1XMOT 3PV0F 2DLRA 2WY2A 4UM1A 1Z0PA 1D1AA 3FXDB 4UM3S 4ZI2D 2CHNA 4AQYT 1NENA 2V7LA 2XM1A 4DV3T 2Y48B 3UFEA 5AQTB 5AFKA 2A2FX 3RIFA 2IHR1 4I50E 5LA6E 2QRXA 4B5DA 5AQSB 3V5UA 3SWHA 4ZI7E 4UR9A 3ZEFB 2B76A 4GYRA 4IIJE 2A72A 2BYRA 1E2AA 3Q5XA 4UF0B 3PMZA 1W9RA 5F8PA 5GONE 2IDOB 1US7B 2V6YA 3ZC0A 4OX9T 3OTOT 2ZM8A 3O1IA 4YSZA 2R6GF 4HQPA 3QC9A 5JRCA 3RIUC 4KP3C 4B3MT 3N9QA 3RC8A 3ZMSB 1IBLT 2X9YA 2W63A 4QXBB 2VKJA 2WZHA 2BVMA 2KINB 1MMDA 5HYAA 2BJ0A 4BAYB 3PU8A 2W66A 4MLKA 3WTNA 4IDQA 2CXFA 4AISA 3FBLA 4DR5T 2HPJA 2KT9A 1XNRT 2LOPA 1E7PA 3C64A 3N9OA 2K5BB 3QOFA 2ACXA 4ZJTA 3AE4A 3ZCJA 2NWBA 2Y58A 2XASB 4EYUA 3AECA 3KV4A 3MJXA 5LG3A 4TWDA 2EHOD 2LHRA 4WBOA 3RX6A 4EOZB 5IYZE 4ZOLE 4HWIB 2WNJA 2X0LB 1J5ET 5HAXA 2VL0A 3ZLIA 5L47A 5L3FB 3P8CD 2IAKA 2BDEA 4AKIA 5FJVA 2UXBT 4JI5T 2NOXA 4TNVA 2CHOA 3C84A 5JDLA 1UK5A 3ZN0B 3HKCE 2YMDA 3HA4A 4ISSA 4DR6T 3ZDHA 2XQAA 2JMHA 5KMGP 4YTPA 4TWHA 1XDPA 1UW6A 2N9DA 2IC6A 2XAGB 1I6ZA 2XY8B 3PUWF 4C90A 2V7IA 3OBVE 2D2SA 3MACA 3VU7H 4ISTA 1IBMT 3PURA 2JQKA 3ANWA 4DR1T 2BZBA 4YHHT 4ZI2C 2K3WA 3AXJB 1D1CA 2JQ9A 4Z91A 2LKHA 3F31A 2BG9B 4JUYA 2UXDT 2XQ4A 5IWAT 2BKNA 3TLVA 4X20E 2PTFA 4ZRUA 1BR1A 1UX4A 2QC1B 2V5DA 2FJEA 2M67A 3I9YA 5AFJA 2BYPA 2BBHA 3WIPA 3DJBA 5KX5E 3U8JA 2PFVA 5J1GA 3I1AA 5J5IA 5JTGA 3Q9DA 5LP6E 2FBWA 4YFSA 1KEYA 5JR9C 2KWHA 4IE4A 1OEDA 4ZJSA 2CLYB 2YDSA 5HXSA 3PUZF 4HFVA 3PUYF 4DR4T 4X64T 2IW5B 1XZYA 2QYWA 4JI6T 2H7VC 4X1KE 3BQKA 2WZYA 1HX1B 3VRBA 3U8NA 1XNQT 2XAQB 2XSBA 5L4HA 5ABGA 4CN4A 4UV9B 5AFHA 4OK0A 2XJ7A 4I55E 4P09A 3FXEB 3AE9A 5FXWA 1G8XA 3ZPOA 1W09A 1UUSA 4H9OC 1W0AA 4ILBA 3SQ6A 4DUYT 5F3JA 4KI0F 3ZMZB 4GKKT 2UUAT 2JPFA 2RPAA 4IE7A 2CE7A 4DUZT 3A7MA 4YJ3E 2VURA 4UM3P 2LSGA 2MAWA 3B13A 2FJBA 1I94T 2OV9A 3ANWB 3PTRB 2WU5A 1SHZC 2PGZA 2JMKA 1HS7A 4DO0A 2IMLA 2W4XA 3EABA 3Q5EA 3AEFA 3K1SA 5BW2A 3AXJA 4YJ2E 4WNKA 2LE8A 3C4ZA 3CQCB 3QB5A 5JDQA 2BVLA 2BYNA 2Y6XA 2YK0A 1IZNB 3RKGA 1U4QA 1S94A 3AA6B 3WTMA 4U7IA 4ZZBA 3KBUA 3FZMB 4UIGA 4H9RC 4LF5T 1ZV4X 1FJGT 5SYOA 2DCFA 1KNZA 4QH4A 2J4GA 3L8RA 4LMKA 4PAGA 2PG8A 3WTLA 3U8KA 5ABFA 5AQMB 1ZP0A 2DL1A 4TNWA 4AFTA 2XAJB 3LK42 2YOEA 2VB6A 4EGWA 3KINB 3Q5WA 4CXYA 2E9XD 1KNPA 2MBGA 4CZZB 2EHOC 2BS3A 5J5HA 2WMOA 1D0YA 3LDQB 2Y54A 2LJLA 3ZYLA 3L39A 3CMLA 3UU3A 3SFEA 4HFCA 4IE6A 2C5KT 2CA5A 5HXCA 2LSIA 4AKLA 3J9X1 5FVKA 4UEMA 2WWUA 2ZM6T 5HWXA 2DI4A 1FEWA 1YD8G 4YHJA 4O4JE 2CLYC 3EI0A 5JDMA 5L3CB 4BFQA 2BG9E 4JI1T 3OKQA 2XQ3A 3L3PA 3ZYMA 1SA0E 3N5LA 4DBQA 3I9WA 4JI3T 2LRLA 1BR4A 1OXZA 3JAEA 4QXCB 5LB7B 4DV6T 4JI7T 1LVKA 2OA5A 2W0GA 4QH1A 4AXPA 4JV5T 1UGOA 3K3OA 2XYSA 3JC6C 5IUXA 2MYSA 2YN6A 2D0UA 2LKGA 2VKHA 4ADZA 3RQUA 3H37A 3AVSA 4F8HA 3T1HT 4I0UA 1UCUA 3C79A 3RRWA 1ZOYA 3K3QC 5BR8T 3FZHB 4YSXA 4JBWF 4P0BA 1IJ5A 3CWZB 3OPCA 1AJ3A 4AKHA 2C5IT 3UUBA 2XZEA 2W8GA 2IIUA 2I0MA 2DWGA 2JRKA 3F2EA 4DIDB 2X67A 2UXXB 1JNRA 2GK9A 2IC9A 4BA9A 5A1LA 5LBQB 2X0HA 2X68A 4TN7B 1VCTA 4DMWA 2X9XA 3UQ7A 4EAHA 3AE5A 2V7JA 3AEAA 3P4SA 2RA1A 3E0ZA 3U3IA 4WBNE 2WDVA 2W00A 2YMEA 3DTOA 1YKHB 3WTOA 3C51A 4O8SA 4XK9A 3NRYA 4HWDA 2CBJA 2KSRA 1UV6A 5IHYA 3NBXX 2N1GA 1IBKT 2LSJA 2MOZA 3RRCA 4DV2T 5AFMA 4TZ4C 4DVDA 4UVBB 5FYMA 1N36T 3RYFE 3P4QA 1WYCA 4EXTA 5ADXL 1FIOA 4A56A 5LNKA 1YW0A 1IJ6A 4TUYE 4LFCT 3P50A 2LRKA 3AE6A 4BJMA 3HKBE 1SE7A 1OEDC 2WSSV 1J5WA 3CVRA 4JI8T 4HWCA 4NIQA 3PUGA 4QX7B 3ZMVB 3AE3A 2CM0A 4AQGA 2J62A 2L9QA 5CB4E 3VR9A 1OEDB 5EK3A 2MPKA 5LXBA 2WDQA 2LHNA 5LHGB 3ONJA 4IHJE 5EK2A 4COFA 3MXZA 1MNDA 4L5GA 5TAOA 2UU9T 3RH3A 3EDUA 5FL0A 2BR7A 4ILUA 4IL9A 4NUVA 4XZCA 2BS4A 3E22E 4WZXA 2XYTA 2XZ5A 2WU2A 3CX7B 5F5WA 5LBMA 4ALXA 5JVDE 2WN9A 3J7Yq 4HFEA 1XDOA 2E2AA 3NWIA 3IEEA 3NRXA 5HXRA 4UF0A 1HTJF 3ZMTB 1HCIA 3C98B 5AFMB 3GN5A 1VRBA 1KK7A 2YDQA 5J2UE 1FMWA 3QNUA 4CQIA 5LYJE 5CFBA 1HNWT 3BK9A 3CX6B 2E9XA 3O4XE 2PJQA 4JI4T 4U72A 3ZYKA 4EZ4A 3NZQA 3TLTA 2NW9A 3LJCA 3N2OA 2VKOA 2X9HA 4JI2T 3KFWX 3ZT7A 4DBRA 2F4VT 2DWKA 4BJNA 2CRBA 4MFRA 3UU4A 4Z8XA 3ZC1A 3RI5A 3RIAA 2XNUA 4QXHB 2LT3A 1S35A 4V1Av 4LF7T 3RYIE 5AQIB 3FZKB 1HX8A 1UX5A 4GIWA 3UU6A 4L9IA 4A97A 2EHOA 2BG9A 4DV7T 5ABFB 3AA0B 2NTYA 2LM9A 5FY7A 5ETWA 1ZHCA 4O2BE 3MKDA 4D01A 2RP4A 3RKOA 3TLUA 3ZCIA 1JNZA 1V9DA 2W8FA 3AAEB 2K9AA 5JRCB 3JC6D 2L3LA 3CPZA 2KNDA 2V1DB 2X66A 3ETVA 4HFHA 2YU2A 2A9UA 2WWVA 4PFPA 2ZLYA 4U7YA 3K8PC 4KHPT 3B5MA 3C50A 2WBLA 4UM3A 1D1BA 2K48A 2D5UA 1CUNA 2XNTA 1IAPA 5LXTE 5BMVE 4JLEA 2LEHA 3T4MA 3HKEE 3RLFF 2H3RA 3DP7A 4GOUA 1UURA 2C5JA 4ZS2A 1R8IA 1N34T 2ACZA 4KMCA 2WMNA 5LOVE 1Y01A 4QX8B 3AE7A 1YKEB 3ESLA 3HKDE 2CBIA 3AA1B 2NW7A 4MBQA 5CGMA 1U5PA 4U2YA 1B7TA 4U33A 4GK5E 4Q25A 2BR8A 4E7ZA 5LHIB 3BQIA 2XQ7A 3ZT6A 3W15B 4O2AE 1HF8A 1QSDA 4AI6A 4UY2A 2E5LT 5FY1A 2AXDS 1SUMB 3HI2A 5H6QB 2Y56A 1L0VA 5LJNA 3A8YC 5FY0A 1MIWA 2FUPA 4B3ST 4X1YE 3JAFA 3OYZA 1O3XA 3AEDA 4YSYA 2WQYA 5L3EB 5JMEA 2W62A 2VQFT 2X0YA 3CQGB 5CA1E 1NAFA 5J5FA 4LMLA 2EHOB 2BYQA 5HEHA 1WRDA 4DR2T 3PDYA 4HTEA 3RIUA 3U8MA 4B6XA 1WLXA 3D0TA 5DABA 4YTNA 2DNXA 3ZT5A 3AE8A 4FI5A 4PK6A 5LGNB 3PUQA 5EZYE 5FXZA 4MALA 3M65A 2X00D 4IDZA 4EZHA 3KV5A 4HE8A 3RC3A 2YDRA 1M62A 2H89A 5HCJA 1T72A 5L4EA 5M4YA 2UUCT 1XWMA 5FKYA 3LSVA 3H3MA 5L3DB 1NEKA 2BKOA 2KXPB 4EEDA 2AE9A 1WYBA 2X51A 1KFYA 3WI3A 2Q9QD 1OEDE 4P0AA 4CXXA 3SRZA 4FRRA 2NR4A 3QUJA 3T8OA 4IREA 3QK6A 5KE4A 2UXNB 2XAHB 4ANJA 2ZM0A 2XSAA 5HEOA 4ZXLA 3OYXA 4AFHA 1HG2A 4LF4T 3RPUA 2CWYA 5AQHB 2ES0A 4HFBA 4AKGA 5J0ZA 4TWFA 3R84B 3Q2MA 5CA0E 3F57A 3R6NA 4QACA 2MTQA 2V5CA 1MMAA 4CI3B 3HR0A 4KUMB 4QABA 2ODUA 3EVYA 5HWYA 3IBPA 3GMIA 3UU8A 3SH1A 4DV0T 5H6RB 3K3NA 4QWNB 2A3DA
chains in the Genus database with same CATH topology
3WTKA 3TLTA 5J5HA 4UM1A 4A98A 3T4MA 4UM3S 3EAMA 5HCJA 2XQ6A 2Y54A 3UUBA 2W8GA 1OEDB 4WV9A 4ZR6A 2PH9A 3SQ9A 4Z91A 5L4EA 4UM3P 5LXBA 4ZJTA 2LKHA 2MAWA 3TLSA 3UU4A 2BG9B 3UU3A 3WTIA 5HEUA 2XQ4A 2Y58A 3EHZA 5AFKA 4HFCA 5HCMA 3RIFA 3TLVA 3LSVA 3P4WA 4LMJA 4B5DA 3RI5A 5BP0A 3RIAA 4COFA 4ZRUA 5KZUA 5LG3A 4BQTA 2PGZA 2M6IA 4TWDA 2Y57A 4Z90A 2WNLA 5J5GA 2QC1B 2XNUA 2ZJVA 4X5TA 4QH5A 2BYRA 2XNVA 3UQ7A 2XZ6A 1OEDE 3PMZA 2BR8A 3EI0A 2ZJUA 2BYPA 5AFJA 4ILCA 2XQ7A 3WIPA 2WNJA 4BFQA 4FRRA 2BG9E 2VL0A 3U8JA 4IREA 3UU6A 5L47A 5BW2A 5J5IA 3RQWA 2BR7A 2LM2A 2XQ3A 4UY2A 4A97A 5KE4A 4IL9A 2BG9A 2WNCA 4HFIA 4ZK4A 4ZK1A 5FJVA 4NZBA 4PIRA 2Y56A 2YMEA 2XQ5A 5HEOA 2YKSA 2BYNA 4HQPA 1OEDA 3ZKRA 4ZJSA 4AFHA 1UX2A 4TNVA 2BYSA 2XYTA 2XZ5A 3WTHA 3WTOA 2M6BA 4XK9A 3C84A 4DBMA 4QAAA 3JAEA 4ILAA 4ALXA 3WTMA 2KSRA 1UV6A 4EZ1A 4ZZBA 2WN9A 4D01A 3JAFA 4HFBA 5AINA 4HFEA 4QH1A 3TLUA 2YMDA 2XQ8A 4XHEA 5J0ZA 3JADA 3TLWA 4UXUA 3WTJA 4TWFA 5AFMA 2W8FA 2WZYA 3ZDHA 2XQAA 2Y7YA 3U8LA 5JMEA 3RHWA 2XYSA 2UZ6A 5SYOA 5AFLA 5HEJA 3U8NA 5J5FA 4TWHA 4LMLA 5HEGA 2BYQA 4QH4A 1UW6A 5HEHA 4QACA 5IUXA 4LMKA 5TVCA 3U8MA 2YN6A 5L4HA 3WTLA 4HFHA 2C9TA 5AFHA 3PEOA 2LKGA 5CO5A 5AFMB 4ZZCA 3U8KA 3GUAA 4QABA 4NPPA 2BJ0A 3RQUA 3UU5A 4AFGA 1I9BA 5CFBA 3P50A 4TNWA 4HFDA 3UQ4A 4F8HA 4AFTA 2XQ9A 2YOEA 3UU8A 3SH1A 4IL4A 3SIOA 3WTNA 2LLYA 4UM3A 3IGQA 3C79A 1OEDC 4ILBA 3SQ6A 5AFNA 2XNTA 5BRXA 3ZDGA 2X00D 2X00A 2BG9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTK A;  3TLT A;  5J5H A;  4UM1 A;  4A98 A;  3T4M A;  4UM3 S;  3EAM A;  5HCJ A;  2XQ6 A;  2Y54 A;  3UUB A;  2W8G A;  1OED B;  4WV9 A;  4ZR6 A;  2PH9 A;  3SQ9 A;  4Z91 A;  5L4E A;  4UM3 P;  5LXB A;  4ZJT A;  2LKH A;  2MAW A;  3TLS A;  3UU4 A;  2BG9 B;  3UU3 A;  3WTI A;  5HEU A;  2XQ4 A;  2Y58 A;  3EHZ A;  5AFK A;  4HFC A;  5HCM A;  3RIF A;  3TLV A;  3LSV A;  3P4W A;  4LMJ A;  4B5D A;  3RI5 A;  5BP0 A;  3RIA A;  4COF A;  4ZRU A;  5KZU A;  5LG3 A;  4BQT A;  2PGZ A;  2M6I A;  4TWD A;  2Y57 A;  4Z90 A;  2WNL A;  5J5G A;  2QC1 B;  2XNU A;  2ZJV A;  4X5T A;  4QH5 A;  2BYR A;  2XNV A;  3UQ7 A;  2XZ6 A;  1OED E;  3PMZ A;  2BR8 A;  3EI0 A;  2ZJU A;  2BYP A;  5AFJ A;  4ILC A;  2XQ7 A;  3WIP A;  2WNJ A;  4BFQ A;  4FRR A;  2BG9 E;  2VL0 A;  3U8J A;  4IRE A;  3UU6 A;  5L47 A;  5BW2 A;  5J5I A;  3RQW A;  2BR7 A;  2LM2 A;  2XQ3 A;  4UY2 A;  4A97 A;  5KE4 A;  4IL9 A;  2BG9 A;  2WNC A;  4HFI A;  4ZK4 A;  4ZK1 A;  5FJV A;  4NZB A;  4PIR A;  2Y56 A;  2YME A;  2XQ5 A;  5HEO A;  2YKS A;  2BYN A;  4HQP A;  1OED A;  3ZKR A;  4ZJS A;  4AFH A;  1UX2 A;  4TNV A;  2BYS A;  2XYT A;  2XZ5 A;  3WTH A;  3WTO A;  2M6B A;  4XK9 A;  3C84 A;  4DBM A;  4QAA A;  3JAE A;  4ILA A;  4ALX A;  3WTM A;  2KSR A;  1UV6 A;  4EZ1 A;  4ZZB A;  2WN9 A;  4D01 A;  3JAF A;  4HFB A;  5AIN A;  4HFE A;  4QH1 A;  3TLU A;  2YMD A;  2XQ8 A;  4XHE A;  5J0Z A;  3JAD A;  3TLW A;  4UXU A;  3WTJ A;  4TWF A;  5AFM A;  2W8F A;  2WZY A;  3ZDH A;  2XQA A;  2Y7Y A;  3U8L A;  5JME A;  3RHW A;  2XYS A;  2UZ6 A;  5SYO A;  5AFL A;  5HEJ A;  3U8N A;  5J5F A;  4TWH A;  4LML A;  5HEG A;  2BYQ A;  4QH4 A;  1UW6 A;  5HEH A;  4QAC A;  5IUX A;  4LMK A;  5TVC A;  3U8M A;  2YN6 A;  5L4H A;  3WTL A;  4HFH A;  2C9T A;  5AFH A;  3PEO A;  2LKG A;  5CO5 A;  5AFM B;  4ZZC A;  3U8K A;  3GUA A;  4QAB A;  4NPP A;  2BJ0 A;  3RQU A;  3UU5 A;  4AFG A;  1I9B A;  5CFB A;  3P50 A;  4TNW A;  4HFD A;  3UQ4 A;  4F8H A;  4AFT A;  2XQ9 A;  2YOE A;  3UU8 A;  3SH1 A;  4IL4 A;  3SIO A;  3WTN A;  2LLY A;  4UM3 A;  3IGQ A;  3C79 A;  1OED C;  4ILB A;  3SQ6 A;  5AFN A;  2XNT A;  5BRX A;  3ZDG A;  2X00 D;  2X00 A;  2BG9 C; 
#chains in the Genus database with same CATH topology
 5AQF B;  5DJQ C;  2P9B A;  4WYV A;  4A98 A;  4PJJ A;  2XQ6 A;  3P4P A;  3ONX A;  4ZR6 A;  2KWI B;  4HN9 A;  3FHN A;  4DV5 T;  2NW8 A;  4HKA A;  5JDH A;  2ZMA A;  1KF6 A;  5AQQ B;  2CEA A;  3CX8 B;  1LVF A;  3SS1 A;  4BQT A;  2WNL A;  3KVA A;  1H7C A;  3MA9 A;  2XNV A;  3H3A A;  2QA7 A;  2ZJU A;  2V26 A;  3VRA A;  1MIV A;  4U2Z A;  2G0U A;  1HNX T;  4J2C A;  3I0O A;  4EB6 E;  2WNC A;  3AA7 B;  2HN1 A;  3SFD A;  4AQF A;  4O4H E;  4IGU A;  1HG5 A;  4UXN B;  4IE5 A;  3ZJ1 A;  3JAD A;  4UXU A;  1VOM A;  5LGU B;  5FXX A;  3ZSS A;  4NXN T;  4A5X A;  5AFL A;  4IDO A;  4EV6 A;  4H63 H;  2E9X C;  3AB3 B;  3GN5 B;  3N2G E;  2V6Y B;  2E5V A;  3OJA A;  2JQQ A;  4X1I E;  1X79 A;  2WS3 A;  4QKN A;  3MZK B;  1I9B A;  4G2A A;  2VVN A;  2HN2 A;  3I0Q A;  3P7I A;  3SIO A;  3A5X A;  4PFO A;  2K24 A;  3LBX A;  1LRZ A;  1LKX A;  4YXD A;  2VAS A;  4IT4 A;  5JR9 A;  4XAX B;  4LF9 T;  4I43 B;  4H9S E;  5KXJ A;  4JEU B;  2HPL A;  4WV9 A;  4H9Q C;  2YEV C;  3OVU A;  3TLS A;  5AQR B;  3WTI A;  5HEU A;  3EHZ A;  1YXR A;  2V6X A;  2JIW A;  4PW8 A;  2M6I A;  4AIU A;  3CK6 A;  2BS2 A;  4X5T A;  2BBJ A;  4UEL A;  4ZHQ E;  5FXV A;  5EK4 A;  3P4R A;  4ILC A;  4JYA T;  5AQO B;  4C91 A;  3ZMU B;  4JEH B;  2XUE A;  1OWA A;  1KNR A;  5DQW A;  4TX5 A;  4OYK A;  4WW0 A;  5AQV B;  3ZKR A;  2FJA A;  1UX2 A;  2V7M A;  4HWH A;  4DBM A;  4LFA T;  4UV8 B;  5AQG B;  3PUV F;  3E08 A;  5AQN B;  5AIN A;  3TLW A;  4FJO A;  4CI1 B;  2UZ6 A;  5JR9 B;  2W2U A;  2LSK A;  5JDG A;  1WCR A;  3PUX F;  3HL6 A;  4PK5 A;  4N78 D;  3N2K E;  3GUA A;  1WR6 A;  4ZI3 C;  3AVR A;  3N9P A;  2WM9 A;  3IGQ A;  3CIR A;  2QGS A;  2N2N A;  4JI0 T;  4NUU A;  4UVC B;  2L8K A;  5ABH A;  2V8S V;  2BG9 C;  3G06 A;  3LG7 A;  4CI2 B;  2VQE T;  2XTL A;  3CKD A;  3ZST A;  3EAM A;  3O9X A;  3LBX B;  2PH9 A;  3SQ9 A;  1X9B A;  2W67 A;  5ABE A;  5DQV A;  2Z6E A;  4XBF B;  3PJA J;  3FZL B;  3P4W A;  5FP3 A;  3VKG A;  3NZP A;  3PUS A;  5KZU A;  2E8I A;  4O4L E;  4LF6 T;  2WP9 A;  4PJM A;  2YIN A;  4ZEY A;  1N33 T;  4IDN A;  4L0R A;  2LM2 A;  1MMG A;  4DR7 T;  4HFI A;  2B1E A;  4ZK4 A;  5LG4 A;  4ZK1 A;  4NZB A;  4PIR A;  4YLH A;  2M6B A;  1E1H B;  4AKR B;  1QUU A;  3PE0 A;  4GKJ T;  4ERR A;  4PJL A;  2CCQ A;  4QHO A;  1D0X A;  2JJ9 A;  3GA8 A;  4K0U A;  3O1H A;  5LHH B;  1MMN A;  3AAA B;  4XHE A;  3WTJ A;  2WB5 A;  4U3C A;  2J47 A;  2LSY A;  2Y7Y A;  2CPT A;  3N9L A;  2UUB T;  3AEB A;  3WAJ A;  2I6H A;  2Q9Q B;  4IE0 A;  3KDS E;  5AFU L;  2WCA A;  3X1D A;  5AQP B;  3C4W A;  5TVC A;  3RYH E;  5JRE A;  3AEG A;  3NVO A;  3VHL A;  3IHR A;  2HHH T;  3JCF A;  1D0Z A;  4MHC A;  1G73 A;  2XQ9 A;  4IL4 A;  4K0K T;  3RYC E;  5BRX A;  4ZS3 A;  5JH7 E;  4DV4 T;  3PUA A;  2HH7 A;  5HXH A;  5C2T A;  4G63 A;  5JDF A;  5LCY A;  3ONL C;  1WR0 A;  4EYY R;  3EDV A;  5LJM A;  5LGT B;  5LMU T;  4ASK A;  2ODV A;  4OHF A;  5HXE A;  3O1J A;  3V5S A;  2OLT A;  2Y57 A;  3GWH A;  2W61 A;  3C4X A;  2WDR A;  2CMR A;  2E9X B;  4H63 V;  3ZN1 B;  2XZ6 A;  3LK2 B;  5L2L A;  2SPC A;  5AQL B;  2NTX A;  3SOL A;  3RQW A;  5L3G B;  2KZ7 B;  3N9N A;  1W0B A;  3AE1 A;  2C0S A;  1ZEE A;  4DMV A;  4E7S A;  3WTH A;  3BQL A;  5AQJ B;  4NXM T;  3B57 A;  2WZI A;  1HR0 T;  3CQX C;  2XQ8 A;  4KX6 A;  3FBZ A;  3RGL A;  3U8L A;  2D9D A;  5CJ5 A;  2YU1 A;  2KMF A;  3KV9 A;  5HEJ A;  2H7O A;  3LK3 B;  1BR0 A;  4DR3 T;  4U74 A;  2X9W A;  4AFG A;  4EEB A;  5FMN A;  3UQ4 A;  1QLB A;  4GYS A;  4LF8 T;  3N9M A;  5FL1 A;  3Q5D A;  3QB5 K;  1HNZ T;  2X00 A;  4KHZ F;  2VVS A;  4CN1 A;  3MK7 C;  3PJA A;  3VKH A;  3WAK A;  2WAU A;  2J1D G;  4B3R T;  4M1P A;  2CWO A;  3M3Z B;  4U31 A;  2LOS A;  4GK0 E;  4UVA B;  3LFM A;  5LMN T;  3UUX B;  5BP0 A;  4LFB T;  3FZF B;  3EUH A;  4Z90 A;  5J5G A;  1CHU A;  3TKL B;  3NKZ A;  2FJD A;  2XHE B;  4QH5 A;  4AQF C;  4KBM B;  4TV9 E;  3UUM A;  3UT5 E;  1YQ4 A;  2ZM2 A;  4CXW A;  3U78 A;  4OFZ A;  3KBT A;  2VK9 A;  1N32 T;  3KV6 A;  3UTK A;  4H9N C;  2VL8 A;  4HEA A;  3ZJ2 A;  1EZ3 A;  1BR2 A;  4QAA A;  5FVL A;  4DV1 T;  4EZ1 A;  2JQH A;  4HGA A;  3FB2 A;  5C3J A;  2CXL A;  5C8Y E;  5FNV E;  2NP9 A;  5J2T E;  4X65 T;  4IDP A;  3UUN A;  4YY3 T;  2Q9Q A;  2C9T A;  3UFG A;  5JDN A;  1GQE A;  4EIW A;  4ZZC A;  2KLQ A;  3RF1 A;  3PU3 A;  1WFD A;  4O4I E;  3VR8 A;  2LLY A;  4OYJ A;  5AQU B;  3ZDG A;  2D0T A;  2DHR A;  3WTK A;  1FMV A;  4H9P C;  4F6R C;  3ETU A;  1YQ3 A;  1J1J A;  2VKD A;  5KDM C;  2PBI A;  2H88 A;  4TV8 E;  5HCM A;  3IF8 B;  4LMJ A;  1M7K A;  1ZKE A;  2QVA A;  4PNI A;  5E0O A;  2BKP A;  3L09 A;  2ZJV A;  4B3T T;  1HFA A;  3KVB A;  2V7K A;  4X62 T;  2Q9Q C;  2UXC T;  4I4T E;  1XMQ T;  2XM2 A;  3UUL A;  4DND A;  1DU2 A;  4PJN A;  2XQ5 A;  2YKS A;  2BYS A;  1T98 A;  2XPK A;  4CN6 A;  2VWA A;  4ILA A;  2Y8D A;  3AAI A;  3S4U A;  4ZI3 D;  1VCS A;  4P1N A;  3RHW A;  4PK4 A;  2I59 A;  5AQK B;  3AE2 A;  1Y64 B;  5HEG A;  4HWF A;  3AEE A;  1NWM X;  3T1Y T;  4X66 T;  1Z8U A;  1MNE A;  3PEO A;  5CO5 A;  2XAF B;  2CXD A;  5L3B B;  1T8B A;  4NPP A;  3UU5 A;  2IUB A;  4HFD A;  2XQY A;  3IA3 A;  1T7S A;  1MIY A;  5AFN A;  3ABV A;  4YT0 A;  4YTM A;  5JQG E;  1XMO T;  3PV0 F;  2DLR A;  2WY2 A;  4UM1 A;  1Z0P A;  1D1A A;  3FXD B;  4UM3 S;  4ZI2 D;  2CHN A;  4AQY T;  1NEN A;  2V7L A;  2XM1 A;  4DV3 T;  2Y48 B;  3UFE A;  5AQT B;  5AFK A;  2A2F X;  3RIF A;  2IHR 1;  4I50 E;  5LA6 E;  2QRX A;  4B5D A;  5AQS B;  3V5U A;  3SWH A;  4ZI7 E;  4UR9 A;  3ZEF B;  2B76 A;  4GYR A;  4IIJ E;  2A72 A;  2BYR A;  1E2A A;  3Q5X A;  4UF0 B;  3PMZ A;  1W9R A;  5F8P A;  5GON E;  2IDO B;  1US7 B;  2V6Y A;  3ZC0 A;  4OX9 T;  3OTO T;  2ZM8 A;  3O1I A;  4YSZ A;  2R6G F;  4HQP A;  3QC9 A;  5JRC A;  3RIU C;  4KP3 C;  4B3M T;  3N9Q A;  3RC8 A;  3ZMS B;  1IBL T;  2X9Y A;  2W63 A;  4QXB B;  2VKJ A;  2WZH A;  2BVM A;  2KIN B;  1MMD A;  5HYA A;  2BJ0 A;  4BAY B;  3PU8 A;  2W66 A;  4MLK A;  3WTN A;  4IDQ A;  2CXF A;  4AIS A;  3FBL A;  4DR5 T;  2HPJ A;  2KT9 A;  1XNR T;  2LOP A;  1E7P A;  3C64 A;  3N9O A;  2K5B B;  3QOF A;  2ACX A;  4ZJT A;  3AE4 A;  3ZCJ A;  2NWB A;  2Y58 A;  2XAS B;  4EYU A;  3AEC A;  3KV4 A;  3MJX A;  5LG3 A;  4TWD A;  2EHO D;  2LHR A;  4WBO A;  3RX6 A;  4EOZ B;  5IYZ E;  4ZOL E;  4HWI B;  2WNJ A;  2X0L B;  1J5E T;  5HAX A;  2VL0 A;  3ZLI A;  5L47 A;  5L3F B;  3P8C D;  2IAK A;  2BDE A;  4AKI A;  5FJV A;  2UXB T;  4JI5 T;  2NOX A;  4TNV A;  2CHO A;  3C84 A;  5JDL A;  1UK5 A;  3ZN0 B;  3HKC E;  2YMD A;  3HA4 A;  4ISS A;  4DR6 T;  3ZDH A;  2XQA A;  2JMH A;  5KMG P;  4YTP A;  4TWH A;  1XDP A;  1UW6 A;  2N9D A;  2IC6 A;  2XAG B;  1I6Z A;  2XY8 B;  3PUW F;  4C90 A;  2V7I A;  3OBV E;  2D2S A;  3MAC A;  3VU7 H;  4IST A;  1IBM T;  3PUR A;  2JQK A;  3ANW A;  4DR1 T;  2BZB A;  4YHH T;  4ZI2 C;  2K3W A;  3AXJ B;  1D1C A;  2JQ9 A;  4Z91 A;  2LKH A;  3F31 A;  2BG9 B;  4JUY A;  2UXD T;  2XQ4 A;  5IWA T;  2BKN A;  3TLV A;  4X20 E;  2PTF A;  4ZRU A;  1BR1 A;  1UX4 A;  2QC1 B;  2V5D A;  2FJE A;  2M67 A;  3I9Y A;  5AFJ A;  2BYP A;  2BBH A;  3WIP A;  3DJB A;  5KX5 E;  3U8J A;  2PFV A;  5J1G A;  3I1A A;  5J5I A;  5JTG A;  3Q9D A;  5LP6 E;  2FBW A;  4YFS A;  1KEY A;  5JR9 C;  2KWH A;  4IE4 A;  1OED A;  4ZJS A;  2CLY B;  2YDS A;  5HXS A;  3PUZ F;  4HFV A;  3PUY F;  4DR4 T;  4X64 T;  2IW5 B;  1XZY A;  2QYW A;  4JI6 T;  2H7V C;  4X1K E;  3BQK A;  2WZY A;  1HX1 B;  3VRB A;  3U8N A;  1XNQ T;  2XAQ B;  2XSB A;  5L4H A;  5ABG A;  4CN4 A;  4UV9 B;  5AFH A;  4OK0 A;  2XJ7 A;  4I55 E;  4P09 A;  3FXE B;  3AE9 A;  5FXW A;  1G8X A;  3ZPO A;  1W09 A;  1UUS A;  4H9O C;  1W0A A;  4ILB A;  3SQ6 A;  4DUY T;  5F3J A;  4KI0 F;  3ZMZ B;  4GKK T;  2UUA T;  2JPF A;  2RPA A;  4IE7 A;  2CE7 A;  4DUZ T;  3A7M A;  4YJ3 E;  2VUR A;  4UM3 P;  2LSG A;  2MAW A;  3B13 A;  2FJB A;  1I94 T;  2OV9 A;  3ANW B;  3PTR B;  2WU5 A;  1SHZ C;  2PGZ A;  2JMK A;  1HS7 A;  4DO0 A;  2IML A;  2W4X A;  3EAB A;  3Q5E A;  3AEF A;  3K1S A;  5BW2 A;  3AXJ A;  4YJ2 E;  4WNK A;  2LE8 A;  3C4Z A;  3CQC B;  3QB5 A;  5JDQ A;  2BVL A;  2BYN A;  2Y6X A;  2YK0 A;  1IZN B;  3RKG A;  1U4Q A;  1S94 A;  3AA6 B;  3WTM A;  4U7I A;  4ZZB A;  3KBU A;  3FZM B;  4UIG A;  4H9R C;  4LF5 T;  1ZV4 X;  1FJG T;  5SYO A;  2DCF A;  1KNZ A;  4QH4 A;  2J4G A;  3L8R A;  4LMK A;  4PAG A;  2PG8 A;  3WTL A;  3U8K A;  5ABF A;  5AQM B;  1ZP0 A;  2DL1 A;  4TNW A;  4AFT A;  2XAJ B;  3LK4 2;  2YOE A;  2VB6 A;  4EGW A;  3KIN B;  3Q5W A;  4CXY A;  2E9X D;  1KNP A;  2MBG A;  4CZZ B;  2EHO C;  2BS3 A;  5J5H A;  2WMO A;  1D0Y A;  3LDQ B;  2Y54 A;  2LJL A;  3ZYL A;  3L39 A;  3CML A;  3UU3 A;  3SFE A;  4HFC A;  4IE6 A;  2C5K T;  2CA5 A;  5HXC A;  2LSI A;  4AKL A;  3J9X 1;  5FVK A;  4UEM A;  2WWU A;  2ZM6 T;  5HWX A;  2DI4 A;  1FEW A;  1YD8 G;  4YHJ A;  4O4J E;  2CLY C;  3EI0 A;  5JDM A;  5L3C B;  4BFQ A;  2BG9 E;  4JI1 T;  3OKQ A;  2XQ3 A;  3L3P A;  3ZYM A;  1SA0 E;  3N5L A;  4DBQ A;  3I9W A;  4JI3 T;  2LRL A;  1BR4 A;  1OXZ A;  3JAE A;  4QXC B;  5LB7 B;  4DV6 T;  4JI7 T;  1LVK A;  2OA5 A;  2W0G A;  4QH1 A;  4AXP A;  4JV5 T;  1UGO A;  3K3O A;  2XYS A;  3JC6 C;  5IUX A;  2MYS A;  2YN6 A;  2D0U A;  2LKG A;  2VKH A;  4ADZ A;  3RQU A;  3H37 A;  3AVS A;  4F8H A;  3T1H T;  4I0U A;  1UCU A;  3C79 A;  3RRW A;  1ZOY A;  3K3Q C;  5BR8 T;  3FZH B;  4YSX A;  4JBW F;  4P0B A;  1IJ5 A;  3CWZ B;  3OPC A;  1AJ3 A;  4AKH A;  2C5I T;  3UUB A;  2XZE A;  2W8G A;  2IIU A;  2I0M A;  2DWG A;  2JRK A;  3F2E A;  4DID B;  2X67 A;  2UXX B;  1JNR A;  2GK9 A;  2IC9 A;  4BA9 A;  5A1L A;  5LBQ B;  2X0H A;  2X68 A;  4TN7 B;  1VCT A;  4DMW A;  2X9X A;  3UQ7 A;  4EAH A;  3AE5 A;  2V7J A;  3AEA A;  3P4S A;  2RA1 A;  3E0Z A;  3U3I A;  4WBN E;  2WDV A;  2W00 A;  2YME A;  3DTO A;  1YKH B;  3WTO A;  3C51 A;  4O8S A;  4XK9 A;  3NRY A;  4HWD A;  2CBJ A;  2KSR A;  1UV6 A;  5IHY A;  3NBX X;  2N1G A;  1IBK T;  2LSJ A;  2MOZ A;  3RRC A;  4DV2 T;  5AFM A;  4TZ4 C;  4DVD A;  4UVB B;  5FYM A;  1N36 T;  3RYF E;  3P4Q A;  1WYC A;  4EXT A;  5ADX L;  1FIO A;  4A56 A;  5LNK A;  1YW0 A;  1IJ6 A;  4TUY E;  4LFC T;  3P50 A;  2LRK A;  3AE6 A;  4BJM A;  3HKB E;  1SE7 A;  1OED C;  2WSS V;  1J5W A;  3CVR A;  4JI8 T;  4HWC A;  4NIQ A;  3PUG A;  4QX7 B;  3ZMV B;  3AE3 A;  2CM0 A;  4AQG A;  2J62 A;  2L9Q A;  5CB4 E;  3VR9 A;  1OED B;  5EK3 A;  2MPK A;  5LXB A;  2WDQ A;  2LHN A;  5LHG B;  3ONJ A;  4IHJ E;  5EK2 A;  4COF A;  3MXZ A;  1MND A;  4L5G A;  5TAO A;  2UU9 T;  3RH3 A;  3EDU A;  5FL0 A;  2BR7 A;  4ILU A;  4IL9 A;  4NUV A;  4XZC A;  2BS4 A;  3E22 E;  4WZX A;  2XYT A;  2XZ5 A;  2WU2 A;  3CX7 B;  5F5W A;  5LBM A;  4ALX A;  5JVD E;  2WN9 A;  3J7Y q;  4HFE A;  1XDO A;  2E2A A;  3NWI A;  3IEE A;  3NRX A;  5HXR A;  4UF0 A;  1HTJ F;  3ZMT B;  1HCI A;  3C98 B;  5AFM B;  3GN5 A;  1VRB A;  1KK7 A;  2YDQ A;  5J2U E;  1FMW A;  3QNU A;  4CQI A;  5LYJ E;  5CFB A;  1HNW T;  3BK9 A;  3CX6 B;  2E9X A;  3O4X E;  2PJQ A;  4JI4 T;  4U72 A;  3ZYK A;  4EZ4 A;  3NZQ A;  3TLT A;  2NW9 A;  3LJC A;  3N2O A;  2VKO A;  2X9H A;  4JI2 T;  3KFW X;  3ZT7 A;  4DBR A;  2F4V T;  2DWK A;  4BJN A;  2CRB A;  4MFR A;  3UU4 A;  4Z8X A;  3ZC1 A;  3RI5 A;  3RIA A;  2XNU A;  4QXH B;  2LT3 A;  1S35 A;  4V1A v;  4LF7 T;  3RYI E;  5AQI B;  3FZK B;  1HX8 A;  1UX5 A;  4GIW A;  3UU6 A;  4L9I A;  4A97 A;  2EHO A;  2BG9 A;  4DV7 T;  5ABF B;  3AA0 B;  2NTY A;  2LM9 A;  5FY7 A;  5ETW A;  1ZHC A;  4O2B E;  3MKD A;  4D01 A;  2RP4 A;  3RKO A;  3TLU A;  3ZCI A;  1JNZ A;  1V9D A;  2W8F A;  3AAE B;  2K9A A;  5JRC B;  3JC6 D;  2L3L A;  3CPZ A;  2KND A;  2V1D B;  2X66 A;  3ETV A;  4HFH A;  2YU2 A;  2A9U A;  2WWV A;  4PFP A;  2ZLY A;  4U7Y A;  3K8P C;  4KHP T;  3B5M A;  3C50 A;  2WBL A;  4UM3 A;  1D1B A;  2K48 A;  2D5U A;  1CUN A;  2XNT A;  1IAP A;  5LXT E;  5BMV E;  4JLE A;  2LEH A;  3T4M A;  3HKE E;  3RLF F;  2H3R A;  3DP7 A;  4GOU A;  1UUR A;  2C5J A;  4ZS2 A;  1R8I A;  1N34 T;  2ACZ A;  4KMC A;  2WMN A;  5LOV E;  1Y01 A;  4QX8 B;  3AE7 A;  1YKE B;  3ESL A;  3HKD E;  2CBI A;  3AA1 B;  2NW7 A;  4MBQ A;  5CGM A;  1U5P A;  4U2Y A;  1B7T A;  4U33 A;  4GK5 E;  4Q25 A;  2BR8 A;  4E7Z A;  5LHI B;  3BQI A;  2XQ7 A;  3ZT6 A;  3W15 B;  4O2A E;  1HF8 A;  1QSD A;  4AI6 A;  4UY2 A;  2E5L T;  5FY1 A;  2AXD S;  1SUM B;  3HI2 A;  5H6Q B;  2Y56 A;  1L0V A;  5LJN A;  3A8Y C;  5FY0 A;  1MIW A;  2FUP A;  4B3S T;  4X1Y E;  3JAF A;  3OYZ A;  1O3X A;  3AED A;  4YSY A;  2WQY A;  5L3E B;  5JME A;  2W62 A;  2VQF T;  2X0Y A;  3CQG B;  5CA1 E;  1NAF A;  5J5F A;  4LML A;  2EHO B;  2BYQ A;  5HEH A;  1WRD A;  4DR2 T;  3PDY A;  4HTE A;  3RIU A;  3U8M A;  4B6X A;  1WLX A;  3D0T A;  5DAB A;  4YTN A;  2DNX A;  3ZT5 A;  3AE8 A;  4FI5 A;  4PK6 A;  5LGN B;  3PUQ A;  5EZY E;  5FXZ A;  4MAL A;  3M65 A;  2X00 D;  4IDZ A;  4EZH A;  3KV5 A;  4HE8 A;  3RC3 A;  2YDR A;  1M62 A;  2H89 A;  5HCJ A;  1T72 A;  5L4E A;  5M4Y A;  2UUC T;  1XWM A;  5FKY A;  3LSV A;  3H3M A;  5L3D B;  1NEK A;  2BKO A;  2KXP B;  4EED A;  2AE9 A;  1WYB A;  2X51 A;  1KFY A;  3WI3 A;  2Q9Q D;  1OED E;  4P0A A;  4CXX A;  3SRZ A;  4FRR A;  2NR4 A;  3QUJ A;  3T8O A;  4IRE A;  3QK6 A;  5KE4 A;  2UXN B;  2XAH B;  4ANJ A;  2ZM0 A;  2XSA A;  5HEO A;  4ZXL A;  3OYX A;  4AFH A;  1HG2 A;  4LF4 T;  3RPU A;  2CWY A;  5AQH B;  2ES0 A;  4HFB A;  4AKG A;  5J0Z A;  4TWF A;  3R84 B;  3Q2M A;  5CA0 E;  3F57 A;  3R6N A;  4QAC A;  2MTQ A;  2V5C A;  1MMA A;  4CI3 B;  3HR0 A;  4KUM B;  4QAB A;  2ODU A;  3EVY A;  5HWY A;  3IBP A;  3GMI A;  3UU8 A;  3SH1 A;  4DV0 T;  5H6R B;  3K3N A;  4QWN B;  2A3D A; 
#chains in the Genus database with same CATH homology
 3WTK A;  3TLT A;  5J5H A;  4UM1 A;  4A98 A;  3T4M A;  4UM3 S;  3EAM A;  5HCJ A;  2XQ6 A;  2Y54 A;  3UUB A;  2W8G A;  1OED B;  4WV9 A;  4ZR6 A;  2PH9 A;  3SQ9 A;  4Z91 A;  5L4E A;  4UM3 P;  5LXB A;  4ZJT A;  2LKH A;  2MAW A;  3TLS A;  3UU4 A;  2BG9 B;  3UU3 A;  3WTI A;  5HEU A;  2XQ4 A;  2Y58 A;  3EHZ A;  5AFK A;  4HFC A;  5HCM A;  3RIF A;  3TLV A;  3LSV A;  3P4W A;  4LMJ A;  4B5D A;  3RI5 A;  5BP0 A;  3RIA A;  4COF A;  4ZRU A;  5KZU A;  5LG3 A;  4BQT A;  2PGZ A;  2M6I A;  4TWD A;  2Y57 A;  4Z90 A;  2WNL A;  5J5G A;  2QC1 B;  2XNU A;  2ZJV A;  4X5T A;  4QH5 A;  2BYR A;  2XNV A;  3UQ7 A;  2XZ6 A;  1OED E;  3PMZ A;  2BR8 A;  3EI0 A;  2ZJU A;  2BYP A;  5AFJ A;  4ILC A;  2XQ7 A;  3WIP A;  2WNJ A;  4BFQ A;  4FRR A;  2BG9 E;  2VL0 A;  3U8J A;  4IRE A;  3UU6 A;  5L47 A;  5BW2 A;  5J5I A;  3RQW A;  2BR7 A;  2LM2 A;  2XQ3 A;  4UY2 A;  4A97 A;  5KE4 A;  4IL9 A;  2BG9 A;  2WNC A;  4HFI A;  4ZK4 A;  4ZK1 A;  5FJV A;  4NZB A;  4PIR A;  2Y56 A;  2YME A;  2XQ5 A;  5HEO A;  2YKS A;  2BYN A;  4HQP A;  1OED A;  3ZKR A;  4ZJS A;  4AFH A;  1UX2 A;  4TNV A;  2BYS A;  2XYT A;  2XZ5 A;  3WTH A;  3WTO A;  2M6B A;  4XK9 A;  3C84 A;  4DBM A;  4QAA A;  3JAE A;  4ILA A;  4ALX A;  3WTM A;  2KSR A;  1UV6 A;  4EZ1 A;  4ZZB A;  2WN9 A;  4D01 A;  3JAF A;  4HFB A;  5AIN A;  4HFE A;  4QH1 A;  3TLU A;  2YMD A;  2XQ8 A;  4XHE A;  5J0Z A;  3JAD A;  3TLW A;  4UXU A;  3WTJ A;  4TWF A;  5AFM A;  2W8F A;  2WZY A;  3ZDH A;  2XQA A;  2Y7Y A;  3U8L A;  5JME A;  3RHW A;  2XYS A;  2UZ6 A;  5SYO A;  5AFL A;  5HEJ A;  3U8N A;  5J5F A;  4TWH A;  4LML A;  5HEG A;  2BYQ A;  4QH4 A;  1UW6 A;  5HEH A;  4QAC A;  5IUX A;  4LMK A;  5TVC A;  3U8M A;  2YN6 A;  5L4H A;  3WTL A;  4HFH A;  2C9T A;  5AFH A;  3PEO A;  2LKG A;  5CO5 A;  5AFM B;  4ZZC A;  3U8K A;  3GUA A;  4QAB A;  4NPP A;  2BJ0 A;  3RQU A;  3UU5 A;  4AFG A;  1I9B A;  5CFB A;  3P50 A;  4TNW A;  4HFD A;  3UQ4 A;  4F8H A;  4AFT A;  2XQ9 A;  2YOE A;  3UU8 A;  3SH1 A;  4IL4 A;  3SIO A;  3WTN A;  2LLY A;  4UM3 A;  3IGQ A;  3C79 A;  1OED C;  4ILB A;  3SQ6 A;  5AFN A;  2XNT A;  5BRX A;  3ZDG A;  2X00 D;  2X00 A;  2BG9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...