3UUBA

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in solution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 95
structure length 311
sequence length 311
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uubA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uubA01
5BW2A 1OEDA 3P4WA 5CFBA 5BP0A 3GUAA 2X00A 4ZK1A 2XQ8A 2XNUA 3TLVA 4AFTA 2Y57A 4LMKA 2YMEA 5TVCA 5AFHA 4ILCA 4XHEA 2W8FA 4TWFA 4Z91A 4ZJSA 2YN6A 2XNTA 3RQUA 3U8MA 2Y54A 4TWHA 4D01A 3WTMA 3IGQA 1OEDE 4ILAA 2BG9C 3T4MA 3WTKA 3WTHA 3U8NA 4HFBA 1UV6A 3SIOA 2BG9B 4BQTA 3EAMA 2LKGA 3U8KA 2ZJUA 4Z90A 5J5GA 3WTOA 3TLTA 2BG9A 4X5TA 3EI0A 4ZJTA 3UU5A 2BYNA 2LLYA 4QH5A 4QH1A 2WZYA 4QABA 5IUXA 5KE4A 2YKSA 3RQWA 5J5IA 3WTJA 4TNWA 2MAWA 4NPPA 4HFCA 5J5FA 2BG9E 2XQAA 3RHWA 5HCJA 4IREA 3SQ6A 2W8GA 5L4EA 3PEOA 4HFIA 2C9TA 2XZ6A 4UM3P 5JMEA 4LMLA 2LKHA 2VL0A 2LM2A 4HQPA 5LG3A 4FRRA 2M6IA 5KZUA 2XQ6A 2BYRA 5LXBA 2Y56A 4DBMA 3TLWA 4HFEA 4IL9A 4NZBA 4EZ1A 5J5HA 2WNCA 5CO5A 3ZDGA 2BYQA 4A98A 5AFJA 4HFHA 2XQ9A 3SQ9A 4BFQA 5HEJA 4IL4A 5HEOA 2M6BA 1UX2A 2YMDA 3U8LA 5L47A 2WNJA 3UU3A 3WTIA 4QAAA 2UZ6A 4ZK4A 3WTNA 4LMJA 2X00D 3P50A 2XYTA 3JAEA 3JAFA 3UUBA 5AINA 5L4HA 3UQ7A 3WIPA 2XZ5A 3UQ4A 4ZZBA 5J0ZA 3PMZA 2YOEA 4COFA 4UM1A 4UM3A 4B5DA 1I9BA 2XQ4A 2WNLA 5SYOA 2WN9A 4AFHA 3TLSA 3RIAA 4AFGA 5AFMB 3WTLA 2KSRA 5HEGA 2BR8A 3TLUA 4A97A 4UY2A 4QACA 4WV9A 2XQ5A 5HEHA 3C79A 2BYPA 4ZZCA 4TNVA 2Y7YA 5AFMA 4ILBA 2XQ3A 3RI5A 3JADA 2PH9A 5AFKA 3SH1A 3U8JA 2PGZA 2Y58A 4PIRA 3UU4A 1UW6A 2XYSA 4UXUA 3LSVA 4HFDA 5AFLA 3RIFA 2XNVA 2XQ7A 4TWDA 5HCMA 1OEDC 5HEUA 3ZKRA 2ZJVA 3C84A 5FJVA 3ZDHA 2BYSA 4ZR6A 5AFNA 4QH4A 5BRXA 1OEDB 3UU6A 4XK9A 4ZRUA 4F8HA 2BR7A 2QC1B 4UM3S 3EHZA 3UU8A 2BJ0A 4ALXA
chains in the Genus database with same CATH superfamily
4GKKT 2XQ8A 3K8PC 2MPKA 2X0LB 4O8SA 4WNKA 2YK0A 4KX6A 1CHUA 5L3GB 4ZHQE 5E0OA 2RPAA 3A8YC 3EI0A 4I0UA 2DCFA 3ZYMA 5EZYE 4QABA 5IUXA 1IBKT 1KK7A 5HYAA 3CMLA 4HFVA 2A9UA 2XZ6A 3AE4A 2LKHA 3GN5A 4U74A 2WWVA 1XZYA 5DQVA 2CEAA 3N9PA 2Y56A 4AKLA 3AE9A 3PUGA 2WU2A 5JRCA 2BYQA 3QK6A 4LFBT 4DR2T 4L0RA 3I0QA 4ZS3A 3PUAA 4YSZA 2HH7A 3JAFA 5LCYA 4TV9E 2UUAT 5IWAT 2WWUA 5SYOA 3SFDA 3RYHE 2KSRA 3TLUA 4IE5A 2KLQA 2BDEA 3ZC0A 5HEHA 3RRCA 4ILBA 3RX6A 5JR9A 4XZCA 1VCSA 2XY8B 3KBTA 2QYWA 1BR4A 2E2AA 4DV2T 3CPZA 2ZJVA 5J2UE 3V5UA 2WDQA 1YD8G 2BJ0A 1MMDA 2XNUA 2ACXA 5TVCA 1XWMA 4ZJSA 1W0BA 4MLKA 5M4YA 2LKGA 2ZJUA 3AVSA 1SUMB 2GK9A 3PU3A 1UGOA 2CWOA 4JYAT 3PV0F 2UXBT 1WYCA 2J1DG 2PG8A 4NIQA 2J47A 2DI4A 2JIWA 5GONE 4HQPA 2Q9QA 1FMVA 2XM2A 4TX5A 3HA4A 4QHOA 2LSIA 2UXXB 1WRDA 1T72A 4UELA 2DWGA 5AFJA 4IIJE 2BS3A 1XNRT 2LSKA 2NOXA 4E7SA 3MXZA 3K3QC 3T1YT 1HTJF 3UQ4A 2YOEA 2W2UA 3M65A 2E8IA 5AFMB 4L5GA 2W61A 4J2CA 1IBMT 2K9AA 5AQHB 2Y7YA 3PURA 2CE7A 5JDFA 5HEUA 5JVDE 4DV7T 4IDQA 4YSYA 4X65T 1MIVA 3ZT5A 2W63A 5CFBA 5ADXL 1BR2A 3PJAA 4ILCA 4TWFA 4DV1T 2YINA 1OXZA 3HL6A 3UUXB 1HNZT 3KVBA 4JV5T 2BG9C 5JREA 1S94A 4UVBB 3ZMTB 3SRZA 5AQVB 3QB5K 1QUUA 2XAFB 4JI7T 5CB4E 2WQYA 2HHHT 5AQSB 3I0OA 3QNUA 4JUYA 4AKHA 3ZCJA 1FMWA 5J5FA 4M1PA 2W8GA 5IYZE 3KV6A 5LXBA 2XSAA 2BBJA 4HGAA 2X9WA 4PJLA 4JI4T 3JC6C 2I59A 4HWCA 2X00D 1WFDA 3PMZA 4ZZBA 4GKJT 2CMRA 2XQ4A 1I94T 4JI2T 3ZT6A 1BR0A 2E5VA 4A5XA 5AQRB 3GWHA 5FL0A 3UU4A 3RIFA 2LRLA 3ZKRA 3AEEA 2Y6XA 4YFSA 2KINB 2WCAA 3DP7A 3ZMSB 3GUAA 3CX8B 4UR9A 5AFHA 5JQGE 3DTOA 1EZ3A 2WMNA 5BMVE 4DMVA 2CHNA 3I9WA 4BA9A 4N78D 4JEUB 2DL1A 3C51A 5FP3A 3AA0B 3U8NA 4DUYT 3BQKA 5JDNA 5J5GA 4AKRB 4YT0A 3A7MA 1LRZA 4AIUA 3Q5XA 3ZMZB 3RIUC 3L8RA 3KINB 2C5IT 4G2AA 3PTRB 4NPPA 3FXEB 4TV8E 4UXNB 3PUQA 5HCJA 4EAHA 4AQFA 1XNQT 4HFIA 4XBFB 2BKOA 5FL1A 4O2AE 3N2KE 5FMNA 3TLWA 4QX8B 2X67A 4K0KT 5FXXA 1V9DA 2UXDT 4AQGA 3C98B 3WI3A 3LG7A 4QAAA 2X9YA 4LMJA 3P50A 5L3CB 3UFGA 2JMKA 4AFGA 2BVLA 3O4XE 1H7CA 2BR8A 2VVNA 3AEGA 2V7LA 2KMFA 2BYPA 2MYSA 2X9XA 2X9HA 3SWHA 2Q9QD 3UUNA 4CN4A 5LBMA 4MHCA 3F31A 3UU6A 2BR7A 2VB6A 3EHZA 2BS4A 4UVCB 1OEDA 4ZK1A 2ACZA 4IHJE 3ANWB 4IE7A 2IHR1 2N9DA 1UX5A 3GMIA 4C90A 2YU1A 3T4MA 3WTKA 3V5SA 4AKGA 1W9RA 3HR0A 4EEDA 2C5JA 2UXCT 2QVAA 3RPUA 3EUHA 3I9YA 4OYJA 4QH5A 3K1SA 5CGMA 2AE9A 3ZLIA 5AQIB 1KNRA 3F2EA 4GOUA 4HFCA 4DV3T 4X1KE 1D1BA 3ZN1B 3BK9A 2VL0A 1E2AA 3OJAA 2JRKA 1VCTA 5KZUA 4KP3C 2IDOB 5L2LA 2XAJB 2LSJA 2XQ9A 4I55E 4X62T 3EVYA 3NKZA 2CBIA 1X9BA 3N9QA 2JJ9A 3Q2MA 3U8LA 3WTIA 4DMWA 2XYTA 4H9NC 3HKCE 4UM3A 3AEAA 4PFOA 4YLHA 3CQXC 3AB3B 2E5LT 3MZKB 3MK7C 1J5ET 4EGWA 4LF9T 4CQIA 4H9RC 1QSDA 3ZYLA 5BR8T 5L3DB 1XMOT 2D2SA 4WW0A 4LFCT 1ZHCA 4EEBA 4HWHA 4ZI7E 5AQUB 4XK9A 1GQEA 3ONXA 3PUYF 4IDZA 5C8YE 4GK0E 2LOSA 5BP0A 4ZI3D 2LSGA 4AFTA 1MMGA 5L3EB 4O4HE 3PUSA 3N2GE 1R8IA 4BJNA 3U8MA 2FBWA 2VWAA 3LFMA 3RGLA 2DHRA 4TUYE 3Q5DA 4ZJTA 4UEMA 5FY1A 2CPTA 4BJMA 4G63A 3I1AA 4XAXB 1IZNB 5FXWA 4U72A 3FHNA 4NXNT 4UF0B 4WZXA 2JQKA 5LNKA 2CXLA 2IIUA 4ZOLE 1T7SA 4FRRA 4KHZF 2VKJA 5JH7E 5LOVE 2CBJA 4DR1T 5LJMA 5A1LA 3ZCIA 3AXJA 3RLFF 4IL4A 4F6RC 4DO0A 1US7B 3BQIA 5DABA 4CI2B 5L47A 3UU3A 2D5UA 4WBNE 3RYFE 2HN1A 2HN2A 2CLYC 2RP4A 4UM1A 4B5DA 1NWMX 2WNLA 2QRXA 4AFHA 3RIAA 2XUEA 5HEGA 4ZI2D 4UY2A 3C79A 2NTYA 2WBLA 2DNXA 2H7VC 4A56A 3MACA 2XNVA 5HCMA 2E9XD 5ABGA 1HR0T 4ZR6A 4LF6T 1NAFA 5AQOB 4O2BE 3P4WA 4I4TE 2BVMA 4YTMA 2WZIA 4PW8A 4Z91A 3PDYA 3N9OA 4ZXLA 3AA6B 2JMHA 3WTHA 1IJ5A 4HFBA 1ZEEA 3SIOA 3ZSSA 4PK4A 2CCQA 3WTOA 2EHOD 4WYVA 4X5TA 4JI3T 4O4LE 1G73A 5CA0E 3AEBA 4QH1A 2WZYA 2CM0A 2X0HA 2A2FX 5ABFA 1MNDA 5ETWA 5FXZA 3X1DA 2X0YA 3RC8A 1UCUA 1MMNA 3AE3A 5J5HA 3ZT7A 1YXRA 3C50A 3AE1A 3LK3B 5HEJA 4QKNA 4QXCB 3TKLB 1UX2A 2YMDA 1Z8UA 3AA7B 2YEVC 5AQPB 2UUCT 3FZLB 2WM9A 4CZZB 3PUZF 4QXBB 3VKHA 3U8JA 2ZM8A 3B13A 4DR4T 4HE8A 3ZDHA 5AQJB 2VK9A 4QH4A 5LA6E 5LHIB 4DUZT 2FJDA 3N5LA 2KXPB 2BKPA 3UT5E 1D0YA 5AQMB 1DU2A 5F8PA 4YTNA 3IHRA 4TWHA 5LHGB 3K3OA 1MMAA 5IHYA 2LHNA 2A3DA 2NWBA 5JTGA 2OV9A 2BG9A 2ZM6T 2CHOA 1G8XA 3N9MA 4U2YA 3W15B 4YTPA 3IEEA 2VKDA 2MAWA 3AAAB 5LB7B 3GN5B 4OFZA 1D0XA 3O1HA 5FVKA 1LVFA 3FBLA 5JRCB 1YQ3A 4EYUA 4NZBA 1FIOA 4A98A 5AQFB 5EK4A 3PUWF 4BFQA 5LGNB 1WLXA 4NXMT 3LK42 4U33A 3WTNA 3F57A 2ZM0A 3WIPA 3AVRA 4H9QC 3HKDE 2X68A 1M7KA 5JR9B 1Z0PA 5AQGB 4ANJA 2PH9A 3P4SA 4EOZB 2XYSA 1QLBA 1XMQT 2VKHA 2NR4A 4KMCA 2H7OA 3LBXB 4PK5A 2BYSA 3IBPA 4YJ3E 4PNIA 4ALXA 5FNVE 2WB5A 4O4IE 3PUVF 2YMEA 1WYBA 4ERRA 3CK6A 2YN6A 5DJQC 4V1Av 3H37A 2IMLA 5AFUL 1I6ZA 1HG2A 1UV6A 2H3RA 4JI1T 2FJAA 2LRKA 2XAQB 4H9SE 2LJLA 1SHZC 4ZI3C 1LVKA 3EDVA 4H63H 3ZEFB 2VASA 2W4XA 2BKNA 5H6QB 3IF8B 3AAIA 3A5XA 2XQAA 2Q9QB 4IREA 3RIUA 2CA5A 4H63V 4QX7B 1SE7A 2MBGA 2C5KT 2L9QA 1W0AA 2IUBA 4DBMA 4CXYA 2B76A 1WR0A 1HX1B 5DQWA 4DBRA 1NEKA 5JDLA 1CUNA 2IAKA 4COFA 3ONJA 1YQ4A 5ABHA 4ILUA 4WV9A 2V6YA 3FZMB 2V6XA 5F3JA 2V5DA 5LGUB 3OPCA 4ISSA 5AFKA 2Y58A 5FVLA 4UXUA 1T8BA 3PU8A 1HS7A 4MBQA 2XQ7A 1J5WA 1YKEB 4KI0F 4GYRA 4FI5A 4UM3S 2XZEA 3MJXA 2CWYA 4CN6A 5JDGA 3QOFA 1ZV4X 3OBVE 4U3CA 2V7KA 4ZI2C 5L3BB 4YJ2E 3CKDA 2YU2A 1N32T 3RF1A 5LBQB 4DNDA 4D01A 3S4UA 3OTOT 2WS3A 2JPFA 2XAGB 1KNPA 3EAMA 2V1DB 3EDUA 2RA1A 5C3JA 2LLYA 1E7PA 3EABA 4UVAB 2WAUA 1XDPA 5KE4A 2FJEA 4YHHT 2K24A 4MFRA 5LXTE 4YY3T 4PFPA 4IE6A 5LG3A 4IT4A 2D0UA 4L9IA 3FXDB 4EZ1A 5CO5A 4CI1B 3HKBE 4HWDA 3R6NA 3VR8A 3P4PA 3ZJ1A 4DR5T 5AQTB 1ZOYA 3ONLC 4KBMB 2W0GA 2HPLA 5AINA 2SPCA 2XZ5A 1I9BA 3TLSA 5KMGP 3ZC1A 4QWNB 4I50E 3LJCA 3M3ZB 3C4WA 5HAXA 5LJNA 3O9XA 4PIRA 4EV6A 3OVUA 3KV9A 5HWYA 2IW5B 4HTEA 2N1GA 2JQQA 3UU8A 4EXTA 3P8CD 5KDMC 3UULA 4I43B 3H3MA 3JC6D 2LHRA 3SFEA 4DR3T 2XPKA 2K48A 2B1EA 3LK2B 2LEHA 3VRBA 3L39A 2OLTA 4DV4T 4YXDA 3AE7A 3Q5WA 1MIYA 2NP9A 4B3ST 3WTJA 2C0SA 4UV9B 3C4XA 3Q5EA 4H9OC 2E9XB 4IDNA 3JCFA 5LMNT 2KNDA 2W62A 4HFEA 4IL9A 2UXNB 3O1IA 4HEAA 3PE0A 4HFHA 3E0ZA 3CX6B 2XQYA 4OHFA 3ZSTA 2P9BA 3FZKB 1KEYA 3UUBA 3UQ7A 2WU5A 2VKOA 4NUVA 2UUBT 1VRBA 4AXPA 2AXDS 4OK0A 3RYCE 2XQ5A 2EHOB 3AECA 3O1JA 3SOLA 4CXWA 5AFMA 2XASB 3KVAA 1HX8A 2WY2A 4WBOA 4TN7B 2PGZA 3MA9A 3QUJA 3PUXF 2DWKA 4P0BA 2WDVA 2WP9A 5FYMA 1OEDB 3G06A 4PJJA 3AAEB 3ETUA 3RYIE 4C91A 2X00A 3PJAJ 3TLVA 4CN1A 5FKYA 5FY7A 4O4JE 3J9X1 3WTMA 1N34T 1OEDE 4P1NA 5LYJE 4JLEA 3NVOA 3P4RA 3ZYKA 3U8KA 1SA0E 2M67A 3K3NA 4IDOA 3U78A 1HNXT 3ABVA 1J1JA 3AEFA 3RHWA 2YDQA 4OYKA 3UFEA 3N2OA 4X20E 2WNCA 1W09A 3C4ZA 5LHHB 2Y8DA 5HEOA 3UTKA 4U2ZA 2KWIB 3UUMA 4NUUA 2HPJA 3KBUA 2UZ6A 2XTLA 4ZK4A 1KF6A 2QA7A 2WDRA 3LBXA 5FY0A 3OKQA 5JR9C 2LE8A 3AE5A 1NENA 1UX4A 4B6XA 1WR6A 4TNVA 2VVSA 3RI5A 4PJNA 3JADA 5TAOA 3E08A 3NWIA 4ZS2A 3SQ6A 5AFNA 2ES0A 2XAHB 4F8HA 4EIWA 2WZHA 4X1YE 4YSXA 1HFAA 2ODVA 4ZEYA 2V5CA 2I0MA 2XNTA 2Y54A 2DLRA 2V7MA 1Y01A 2H88A 3VU7H 2W00A 3RKOA 3NRYA 2YDSA 3AE8A 4KUMB 2ODUA 3R84B 2YKSA 5KXJA 2LT3A 3NZPA 2Q9QC 1UK5A 2MTQA 3H3AA 2V7JA 5L4EA 4UM3P 3ESLA 3GA8A 4QXHB 3ETVA 2CLYB 4E7ZA 2BS2A 1HNWT 2BYRA 4ADZA 3AXJB 2J4GA 3N9NA 1X79A 4KHPT 3NRXA 2V26A 1U4QA 2NW8A 3AE6A 2CXFA 2CRBA 2LSYA 2NW7A 1YKHB 4PK6A 2ZM2A 2CXDA 2G0UA 3B5MA 1VOMA 3RH3A 2PJQA 3WTLA 4A97A 5LMUT 4JI8T 4ZZCA 4JI5T 3T1HT 4IGUA 4UV8B 2FJBA 2XHEB 1T98A 3SH1A 3CWZB 4TWDA 2VQET 5FJVA 3WAKA 5LGTB 4JEHB 4IE4A 5BW2A 5FXVA 2PFVA 3MKDA 2K5BB 1ZKEA 4X1IE 2Y57A 4LF7T 2VL8A 4P0AA 2N2NA 2JQ9A 5EK2A 3RQUA 4MALA 1IJ6A 3OYXA 3ANWA 5AQNB 3KDSE 4B3TT 4AKIA 5JDMA 1YW0A 3VRAA 3TLTA 4K0UA 2BYNA 5ABFB 3KV4A 1JNRA 3AE2A 1D1CA 3P4QA 4GK5E 1S35A 4DV5T 2VURA 3CVRA 3DJBA 1E1HB 5EK3A 5JMEA 4HN9A 2KWHA 2LM2A 4U7IA 1XDOA 2IC6A 1AJ3A 1U5PA 5AQQB 2A72A 2IC9A 3L3PA 5LG4A 2F4VT 2LOPA 1LKXA 2BZBA 2BBHA 2V8SV 4X66T 5F5WA 3JAEA 3ZMVB 1HG5A 4HWFA 3FBZA 4Z8XA 2JQHA 4EB6E 5H6RB 5L3FB 2ZMAA 4QACA 5LP6E 1WCRA 2VQFT 2XQ3A 1MIWA 3Q9DA 2XJ7A 2PBIA 4EZHA 3N9LA 4JBWF 3C84A 1JNZA 2YDRA 1IBLT 5JDHA 4B3MT 4ZRUA 3VR9A 1UURA 5HXSA 2MOZA 4H9PC 2H89A 3VKGA 4UIGA 2XSBA 2I6HA 1BR1A 3C64A 2K3WA 3ZMUB 4ILAA 2BG9B 2L3LA 3RKGA 5HXHA 3B57A 5J2TE 1IAPA 2W66A 2E9XA 3CQGB 3QB5A 4IDPA 2KZ7B 4AISA 3RQWA 4AQFC 3E22E 3BQLA 5J5IA 4DVDA 2BG9E 2W67A 4OX9T 3D0TA 5HXRA 4DBQA 2E9XC 4LMLA 4UF0A 4EZ4A 3FZHB 2X51A 2M6IA 4IE0A 2XQ6A 3U3IA 5ABEA 4CXXA 4DR6T 3KV5A 3VHLA 4AQYT 3CIRA 4AI6A 1O3XA 1N36T 3SQ9A 2EHOA 1KFYA 4GYSA 3AA1B 2WNJA 2D0TA 4GIWA 2NW9A 2L8KA 3CQCB 2ZLYA 4LF5T 5J0ZA 2R6GF 4HWIB 1M62A 4P09A 2EHOC 3NZQA 2QGSA 5HWXA 2LM9A 4DV6T 3OYZA 3FB2A 2XM1A 1UW6A 3LSVA 4HFDA 4CI3B 1HF8A 1KNZA 1OEDC 5HXCA 1FEWA 5BRXA 4LF4T 4LF8T 4DV0T 4LMKA 4JI0T 5KX5E 4XHEA 2W8FA 3HI2A 1OWAA 3QC9A 3AEDA 5J1GA 5CA1E 3FZFB 3IGQA 2PTFA 1HCIA 2Y48B 2J62A 1D1AA 4BQTA 2KT9A 3NBXX 4Z90A 4U7YA 3UU5A 5AQKB 3P7IA 4TZ4C 4YHJA 4LFAT 4TNWA 5C2TA 3CX7B 4PJMA 3PEOA 5JDQA 2C9TA 2Z6EA 3SS1A 4ASKA 3IA3A 1Y64B 2FUPA 5AQLB 3RC3A 1MNEA 1B7TA 4HKAA 4ISTA 3ZDGA 1ZP0A 4JI6T 4FJOA 4PAGA 4X64T 1L0VA 2M6BA 3KFWX 3RRWA 2OA5A 3LDQB 2UU9T 2X66A 5HXEA 5L4HA 2NTXA 4DR7T 1UUSA 3HKEE 3L09A 4Q25A 3J7Yq 2WN9A 2V6YB 4B3RT 2WMOA 1FJGT 4BAYB 2V7IA 5CJ5A 3ZN0B 3ZJ2A 5AFLA 3T8OA 3ZPOA 1D0ZA 4U31A 4EYYR 3WAJA 4DIDB 2WSSV 2QC1B 1N33T 2D9DA
chains in the Genus database with same CATH topology
5BW2A 1OEDA 3P4WA 5CFBA 5BP0A 3GUAA 2X00A 4ZK1A 2XQ8A 2XNUA 3TLVA 4AFTA 2Y57A 4LMKA 2YMEA 5TVCA 5AFHA 4ILCA 4XHEA 2W8FA 4TWFA 4Z91A 4ZJSA 2YN6A 2XNTA 3RQUA 3U8MA 2Y54A 4TWHA 4D01A 3WTMA 3IGQA 1OEDE 4ILAA 2BG9C 3T4MA 3WTKA 3WTHA 3U8NA 4HFBA 1UV6A 3SIOA 2BG9B 4BQTA 3EAMA 2LKGA 3U8KA 2ZJUA 4Z90A 5J5GA 3WTOA 3TLTA 2BG9A 4X5TA 3EI0A 4ZJTA 3UU5A 2BYNA 2LLYA 4QH5A 4QH1A 2WZYA 4QABA 5IUXA 5KE4A 2YKSA 3RQWA 5J5IA 3WTJA 4TNWA 2MAWA 4NPPA 4HFCA 5J5FA 2BG9E 2XQAA 3RHWA 5HCJA 4IREA 3SQ6A 2W8GA 5L4EA 3PEOA 4HFIA 2C9TA 2XZ6A 4UM3P 5JMEA 4LMLA 2LKHA 2VL0A 2LM2A 4HQPA 5LG3A 4FRRA 2M6IA 5KZUA 2XQ6A 2BYRA 5LXBA 2Y56A 4DBMA 3TLWA 4HFEA 4IL9A 4NZBA 4EZ1A 5J5HA 2WNCA 5CO5A 3ZDGA 2BYQA 4A98A 5AFJA 4HFHA 2XQ9A 3SQ9A 4BFQA 5HEJA 4IL4A 5HEOA 2M6BA 1UX2A 2YMDA 3U8LA 5L47A 2WNJA 3UU3A 3WTIA 4QAAA 2UZ6A 4ZK4A 3WTNA 4LMJA 2X00D 3P50A 2XYTA 3JAEA 3JAFA 3UUBA 5AINA 5L4HA 3UQ7A 3WIPA 2XZ5A 3UQ4A 4ZZBA 5J0ZA 3PMZA 2YOEA 4COFA 4UM1A 4UM3A 4B5DA 1I9BA 2XQ4A 2WNLA 5SYOA 2WN9A 4AFHA 3TLSA 3RIAA 4AFGA 5AFMB 3WTLA 2KSRA 5HEGA 2BR8A 3TLUA 4A97A 4UY2A 4QACA 4WV9A 2XQ5A 5HEHA 3C79A 2BYPA 4ZZCA 4TNVA 2Y7YA 5AFMA 4ILBA 2XQ3A 3RI5A 3JADA 2PH9A 5AFKA 3SH1A 3U8JA 2PGZA 2Y58A 4PIRA 3UU4A 1UW6A 2XYSA 4UXUA 3LSVA 4HFDA 5AFLA 3RIFA 2XNVA 2XQ7A 4TWDA 5HCMA 1OEDC 5HEUA 3ZKRA 2ZJVA 3C84A 5FJVA 3ZDHA 2BYSA 4ZR6A 5AFNA 4QH4A 5BRXA 1OEDB 3UU6A 4XK9A 4ZRUA 4F8HA 2BR7A 2QC1B 4UM3S 3EHZA 3UU8A 2BJ0A 4ALXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BW2 A;  1OED A;  3P4W A;  5CFB A;  5BP0 A;  3GUA A;  2X00 A;  4ZK1 A;  2XQ8 A;  2XNU A;  3TLV A;  4AFT A;  2Y57 A;  4LMK A;  2YME A;  5TVC A;  5AFH A;  4ILC A;  4XHE A;  2W8F A;  4TWF A;  4Z91 A;  4ZJS A;  2YN6 A;  2XNT A;  3RQU A;  3U8M A;  2Y54 A;  4TWH A;  4D01 A;  3WTM A;  3IGQ A;  1OED E;  4ILA A;  2BG9 C;  3T4M A;  3WTK A;  3WTH A;  3U8N A;  4HFB A;  1UV6 A;  3SIO A;  2BG9 B;  4BQT A;  3EAM A;  2LKG A;  3U8K A;  2ZJU A;  4Z90 A;  5J5G A;  3WTO A;  3TLT A;  2BG9 A;  4X5T A;  3EI0 A;  4ZJT A;  3UU5 A;  2BYN A;  2LLY A;  4QH5 A;  4QH1 A;  2WZY A;  4QAB A;  5IUX A;  5KE4 A;  2YKS A;  3RQW A;  5J5I A;  3WTJ A;  4TNW A;  2MAW A;  4NPP A;  4HFC A;  5J5F A;  2BG9 E;  2XQA A;  3RHW A;  5HCJ A;  4IRE A;  3SQ6 A;  2W8G A;  5L4E A;  3PEO A;  4HFI A;  2C9T A;  2XZ6 A;  4UM3 P;  5JME A;  4LML A;  2LKH A;  2VL0 A;  2LM2 A;  4HQP A;  5LG3 A;  4FRR A;  2M6I A;  5KZU A;  2XQ6 A;  2BYR A;  5LXB A;  2Y56 A;  4DBM A;  3TLW A;  4HFE A;  4IL9 A;  4NZB A;  4EZ1 A;  5J5H A;  2WNC A;  5CO5 A;  3ZDG A;  2BYQ A;  4A98 A;  5AFJ A;  4HFH A;  2XQ9 A;  3SQ9 A;  4BFQ A;  5HEJ A;  4IL4 A;  5HEO A;  2M6B A;  1UX2 A;  2YMD A;  3U8L A;  5L47 A;  2WNJ A;  3UU3 A;  3WTI A;  4QAA A;  2UZ6 A;  4ZK4 A;  3WTN A;  4LMJ A;  2X00 D;  3P50 A;  2XYT A;  3JAE A;  3JAF A;  3UUB A;  5AIN A;  5L4H A;  3UQ7 A;  3WIP A;  2XZ5 A;  3UQ4 A;  4ZZB A;  5J0Z A;  3PMZ A;  2YOE A;  4COF A;  4UM1 A;  4UM3 A;  4B5D A;  1I9B A;  2XQ4 A;  2WNL A;  5SYO A;  2WN9 A;  4AFH A;  3TLS A;  3RIA A;  4AFG A;  5AFM B;  3WTL A;  2KSR A;  5HEG A;  2BR8 A;  3TLU A;  4A97 A;  4UY2 A;  4QAC A;  4WV9 A;  2XQ5 A;  5HEH A;  3C79 A;  2BYP A;  4ZZC A;  4TNV A;  2Y7Y A;  5AFM A;  4ILB A;  2XQ3 A;  3RI5 A;  3JAD A;  2PH9 A;  5AFK A;  3SH1 A;  3U8J A;  2PGZ A;  2Y58 A;  4PIR A;  3UU4 A;  1UW6 A;  2XYS A;  4UXU A;  3LSV A;  4HFD A;  5AFL A;  3RIF A;  2XNV A;  2XQ7 A;  4TWD A;  5HCM A;  1OED C;  5HEU A;  3ZKR A;  2ZJV A;  3C84 A;  5FJV A;  3ZDH A;  2BYS A;  4ZR6 A;  5AFN A;  4QH4 A;  5BRX A;  1OED B;  3UU6 A;  4XK9 A;  4ZRU A;  4F8H A;  2BR7 A;  2QC1 B;  4UM3 S;  3EHZ A;  3UU8 A;  2BJ0 A;  4ALX A; 
#chains in the Genus database with same CATH topology
 4GKK T;  2XQ8 A;  3K8P C;  2MPK A;  2X0L B;  4O8S A;  4WNK A;  2YK0 A;  4KX6 A;  1CHU A;  5L3G B;  4ZHQ E;  5E0O A;  2RPA A;  3A8Y C;  3EI0 A;  4I0U A;  2DCF A;  3ZYM A;  5EZY E;  4QAB A;  5IUX A;  1IBK T;  1KK7 A;  5HYA A;  3CML A;  4HFV A;  2A9U A;  2XZ6 A;  3AE4 A;  2LKH A;  3GN5 A;  4U74 A;  2WWV A;  1XZY A;  5DQV A;  2CEA A;  3N9P A;  2Y56 A;  4AKL A;  3AE9 A;  3PUG A;  2WU2 A;  5JRC A;  2BYQ A;  3QK6 A;  4LFB T;  4DR2 T;  4L0R A;  3I0Q A;  4ZS3 A;  3PUA A;  4YSZ A;  2HH7 A;  3JAF A;  5LCY A;  4TV9 E;  2UUA T;  5IWA T;  2WWU A;  5SYO A;  3SFD A;  3RYH E;  2KSR A;  3TLU A;  4IE5 A;  2KLQ A;  2BDE A;  3ZC0 A;  5HEH A;  3RRC A;  4ILB A;  3RX6 A;  5JR9 A;  4XZC A;  1VCS A;  2XY8 B;  3KBT A;  2QYW A;  1BR4 A;  2E2A A;  4DV2 T;  3CPZ A;  2ZJV A;  5J2U E;  3V5U A;  2WDQ A;  1YD8 G;  2BJ0 A;  1MMD A;  2XNU A;  2ACX A;  5TVC A;  1XWM A;  4ZJS A;  1W0B A;  4MLK A;  5M4Y A;  2LKG A;  2ZJU A;  3AVS A;  1SUM B;  2GK9 A;  3PU3 A;  1UGO A;  2CWO A;  4JYA T;  3PV0 F;  2UXB T;  1WYC A;  2J1D G;  2PG8 A;  4NIQ A;  2J47 A;  2DI4 A;  2JIW A;  5GON E;  4HQP A;  2Q9Q A;  1FMV A;  2XM2 A;  4TX5 A;  3HA4 A;  4QHO A;  2LSI A;  2UXX B;  1WRD A;  1T72 A;  4UEL A;  2DWG A;  5AFJ A;  4IIJ E;  2BS3 A;  1XNR T;  2LSK A;  2NOX A;  4E7S A;  3MXZ A;  3K3Q C;  3T1Y T;  1HTJ F;  3UQ4 A;  2YOE A;  2W2U A;  3M65 A;  2E8I A;  5AFM B;  4L5G A;  2W61 A;  4J2C A;  1IBM T;  2K9A A;  5AQH B;  2Y7Y A;  3PUR A;  2CE7 A;  5JDF A;  5HEU A;  5JVD E;  4DV7 T;  4IDQ A;  4YSY A;  4X65 T;  1MIV A;  3ZT5 A;  2W63 A;  5CFB A;  5ADX L;  1BR2 A;  3PJA A;  4ILC A;  4TWF A;  4DV1 T;  2YIN A;  1OXZ A;  3HL6 A;  3UUX B;  1HNZ T;  3KVB A;  4JV5 T;  2BG9 C;  5JRE A;  1S94 A;  4UVB B;  3ZMT B;  3SRZ A;  5AQV B;  3QB5 K;  1QUU A;  2XAF B;  4JI7 T;  5CB4 E;  2WQY A;  2HHH T;  5AQS B;  3I0O A;  3QNU A;  4JUY A;  4AKH A;  3ZCJ A;  1FMW A;  5J5F A;  4M1P A;  2W8G A;  5IYZ E;  3KV6 A;  5LXB A;  2XSA A;  2BBJ A;  4HGA A;  2X9W A;  4PJL A;  4JI4 T;  3JC6 C;  2I59 A;  4HWC A;  2X00 D;  1WFD A;  3PMZ A;  4ZZB A;  4GKJ T;  2CMR A;  2XQ4 A;  1I94 T;  4JI2 T;  3ZT6 A;  1BR0 A;  2E5V A;  4A5X A;  5AQR B;  3GWH A;  5FL0 A;  3UU4 A;  3RIF A;  2LRL A;  3ZKR A;  3AEE A;  2Y6X A;  4YFS A;  2KIN B;  2WCA A;  3DP7 A;  3ZMS B;  3GUA A;  3CX8 B;  4UR9 A;  5AFH A;  5JQG E;  3DTO A;  1EZ3 A;  2WMN A;  5BMV E;  4DMV A;  2CHN A;  3I9W A;  4BA9 A;  4N78 D;  4JEU B;  2DL1 A;  3C51 A;  5FP3 A;  3AA0 B;  3U8N A;  4DUY T;  3BQK A;  5JDN A;  5J5G A;  4AKR B;  4YT0 A;  3A7M A;  1LRZ A;  4AIU A;  3Q5X A;  3ZMZ B;  3RIU C;  3L8R A;  3KIN B;  2C5I T;  4G2A A;  3PTR B;  4NPP A;  3FXE B;  4TV8 E;  4UXN B;  3PUQ A;  5HCJ A;  4EAH A;  4AQF A;  1XNQ T;  4HFI A;  4XBF B;  2BKO A;  5FL1 A;  4O2A E;  3N2K E;  5FMN A;  3TLW A;  4QX8 B;  2X67 A;  4K0K T;  5FXX A;  1V9D A;  2UXD T;  4AQG A;  3C98 B;  3WI3 A;  3LG7 A;  4QAA A;  2X9Y A;  4LMJ A;  3P50 A;  5L3C B;  3UFG A;  2JMK A;  4AFG A;  2BVL A;  3O4X E;  1H7C A;  2BR8 A;  2VVN A;  3AEG A;  2V7L A;  2KMF A;  2BYP A;  2MYS A;  2X9X A;  2X9H A;  3SWH A;  2Q9Q D;  3UUN A;  4CN4 A;  5LBM A;  4MHC A;  3F31 A;  3UU6 A;  2BR7 A;  2VB6 A;  3EHZ A;  2BS4 A;  4UVC B;  1OED A;  4ZK1 A;  2ACZ A;  4IHJ E;  3ANW B;  4IE7 A;  2IHR 1;  2N9D A;  1UX5 A;  3GMI A;  4C90 A;  2YU1 A;  3T4M A;  3WTK A;  3V5S A;  4AKG A;  1W9R A;  3HR0 A;  4EED A;  2C5J A;  2UXC T;  2QVA A;  3RPU A;  3EUH A;  3I9Y A;  4OYJ A;  4QH5 A;  3K1S A;  5CGM A;  2AE9 A;  3ZLI A;  5AQI B;  1KNR A;  3F2E A;  4GOU A;  4HFC A;  4DV3 T;  4X1K E;  1D1B A;  3ZN1 B;  3BK9 A;  2VL0 A;  1E2A A;  3OJA A;  2JRK A;  1VCT A;  5KZU A;  4KP3 C;  2IDO B;  5L2L A;  2XAJ B;  2LSJ A;  2XQ9 A;  4I55 E;  4X62 T;  3EVY A;  3NKZ A;  2CBI A;  1X9B A;  3N9Q A;  2JJ9 A;  3Q2M A;  3U8L A;  3WTI A;  4DMW A;  2XYT A;  4H9N C;  3HKC E;  4UM3 A;  3AEA A;  4PFO A;  4YLH A;  3CQX C;  3AB3 B;  2E5L T;  3MZK B;  3MK7 C;  1J5E T;  4EGW A;  4LF9 T;  4CQI A;  4H9R C;  1QSD A;  3ZYL A;  5BR8 T;  5L3D B;  1XMO T;  2D2S A;  4WW0 A;  4LFC T;  1ZHC A;  4EEB A;  4HWH A;  4ZI7 E;  5AQU B;  4XK9 A;  1GQE A;  3ONX A;  3PUY F;  4IDZ A;  5C8Y E;  4GK0 E;  2LOS A;  5BP0 A;  4ZI3 D;  2LSG A;  4AFT A;  1MMG A;  5L3E B;  4O4H E;  3PUS A;  3N2G E;  1R8I A;  4BJN A;  3U8M A;  2FBW A;  2VWA A;  3LFM A;  3RGL A;  2DHR A;  4TUY E;  3Q5D A;  4ZJT A;  4UEM A;  5FY1 A;  2CPT A;  4BJM A;  4G63 A;  3I1A A;  4XAX B;  1IZN B;  5FXW A;  4U72 A;  3FHN A;  4NXN T;  4UF0 B;  4WZX A;  2JQK A;  5LNK A;  2CXL A;  2IIU A;  4ZOL E;  1T7S A;  4FRR A;  4KHZ F;  2VKJ A;  5JH7 E;  5LOV E;  2CBJ A;  4DR1 T;  5LJM A;  5A1L A;  3ZCI A;  3AXJ A;  3RLF F;  4IL4 A;  4F6R C;  4DO0 A;  1US7 B;  3BQI A;  5DAB A;  4CI2 B;  5L47 A;  3UU3 A;  2D5U A;  4WBN E;  3RYF E;  2HN1 A;  2HN2 A;  2CLY C;  2RP4 A;  4UM1 A;  4B5D A;  1NWM X;  2WNL A;  2QRX A;  4AFH A;  3RIA A;  2XUE A;  5HEG A;  4ZI2 D;  4UY2 A;  3C79 A;  2NTY A;  2WBL A;  2DNX A;  2H7V C;  4A56 A;  3MAC A;  2XNV A;  5HCM A;  2E9X D;  5ABG A;  1HR0 T;  4ZR6 A;  4LF6 T;  1NAF A;  5AQO B;  4O2B E;  3P4W A;  4I4T E;  2BVM A;  4YTM A;  2WZI A;  4PW8 A;  4Z91 A;  3PDY A;  3N9O A;  4ZXL A;  3AA6 B;  2JMH A;  3WTH A;  1IJ5 A;  4HFB A;  1ZEE A;  3SIO A;  3ZSS A;  4PK4 A;  2CCQ A;  3WTO A;  2EHO D;  4WYV A;  4X5T A;  4JI3 T;  4O4L E;  1G73 A;  5CA0 E;  3AEB A;  4QH1 A;  2WZY A;  2CM0 A;  2X0H A;  2A2F X;  5ABF A;  1MND A;  5ETW A;  5FXZ A;  3X1D A;  2X0Y A;  3RC8 A;  1UCU A;  1MMN A;  3AE3 A;  5J5H A;  3ZT7 A;  1YXR A;  3C50 A;  3AE1 A;  3LK3 B;  5HEJ A;  4QKN A;  4QXC B;  3TKL B;  1UX2 A;  2YMD A;  1Z8U A;  3AA7 B;  2YEV C;  5AQP B;  2UUC T;  3FZL B;  2WM9 A;  4CZZ B;  3PUZ F;  4QXB B;  3VKH A;  3U8J A;  2ZM8 A;  3B13 A;  4DR4 T;  4HE8 A;  3ZDH A;  5AQJ B;  2VK9 A;  4QH4 A;  5LA6 E;  5LHI B;  4DUZ T;  2FJD A;  3N5L A;  2KXP B;  2BKP A;  3UT5 E;  1D0Y A;  5AQM B;  1DU2 A;  5F8P A;  4YTN A;  3IHR A;  4TWH A;  5LHG B;  3K3O A;  1MMA A;  5IHY A;  2LHN A;  2A3D A;  2NWB A;  5JTG A;  2OV9 A;  2BG9 A;  2ZM6 T;  2CHO A;  1G8X A;  3N9M A;  4U2Y A;  3W15 B;  4YTP A;  3IEE A;  2VKD A;  2MAW A;  3AAA B;  5LB7 B;  3GN5 B;  4OFZ A;  1D0X A;  3O1H A;  5FVK A;  1LVF A;  3FBL A;  5JRC B;  1YQ3 A;  4EYU A;  4NZB A;  1FIO A;  4A98 A;  5AQF B;  5EK4 A;  3PUW F;  4BFQ A;  5LGN B;  1WLX A;  4NXM T;  3LK4 2;  4U33 A;  3WTN A;  3F57 A;  2ZM0 A;  3WIP A;  3AVR A;  4H9Q C;  3HKD E;  2X68 A;  1M7K A;  5JR9 B;  1Z0P A;  5AQG B;  4ANJ A;  2PH9 A;  3P4S A;  4EOZ B;  2XYS A;  1QLB A;  1XMQ T;  2VKH A;  2NR4 A;  4KMC A;  2H7O A;  3LBX B;  4PK5 A;  2BYS A;  3IBP A;  4YJ3 E;  4PNI A;  4ALX A;  5FNV E;  2WB5 A;  4O4I E;  3PUV F;  2YME A;  1WYB A;  4ERR A;  3CK6 A;  2YN6 A;  5DJQ C;  4V1A v;  3H37 A;  2IML A;  5AFU L;  1I6Z A;  1HG2 A;  1UV6 A;  2H3R A;  4JI1 T;  2FJA A;  2LRK A;  2XAQ B;  4H9S E;  2LJL A;  1SHZ C;  4ZI3 C;  1LVK A;  3EDV A;  4H63 H;  3ZEF B;  2VAS A;  2W4X A;  2BKN A;  5H6Q B;  3IF8 B;  3AAI A;  3A5X A;  2XQA A;  2Q9Q B;  4IRE A;  3RIU A;  2CA5 A;  4H63 V;  4QX7 B;  1SE7 A;  2MBG A;  2C5K T;  2L9Q A;  1W0A A;  2IUB A;  4DBM A;  4CXY A;  2B76 A;  1WR0 A;  1HX1 B;  5DQW A;  4DBR A;  1NEK A;  5JDL A;  1CUN A;  2IAK A;  4COF A;  3ONJ A;  1YQ4 A;  5ABH A;  4ILU A;  4WV9 A;  2V6Y A;  3FZM B;  2V6X A;  5F3J A;  2V5D A;  5LGU B;  3OPC A;  4ISS A;  5AFK A;  2Y58 A;  5FVL A;  4UXU A;  1T8B A;  3PU8 A;  1HS7 A;  4MBQ A;  2XQ7 A;  1J5W A;  1YKE B;  4KI0 F;  4GYR A;  4FI5 A;  4UM3 S;  2XZE A;  3MJX A;  2CWY A;  4CN6 A;  5JDG A;  3QOF A;  1ZV4 X;  3OBV E;  4U3C A;  2V7K A;  4ZI2 C;  5L3B B;  4YJ2 E;  3CKD A;  2YU2 A;  1N32 T;  3RF1 A;  5LBQ B;  4DND A;  4D01 A;  3S4U A;  3OTO T;  2WS3 A;  2JPF A;  2XAG B;  1KNP A;  3EAM A;  2V1D B;  3EDU A;  2RA1 A;  5C3J A;  2LLY A;  1E7P A;  3EAB A;  4UVA B;  2WAU A;  1XDP A;  5KE4 A;  2FJE A;  4YHH T;  2K24 A;  4MFR A;  5LXT E;  4YY3 T;  4PFP A;  4IE6 A;  5LG3 A;  4IT4 A;  2D0U A;  4L9I A;  3FXD B;  4EZ1 A;  5CO5 A;  4CI1 B;  3HKB E;  4HWD A;  3R6N A;  3VR8 A;  3P4P A;  3ZJ1 A;  4DR5 T;  5AQT B;  1ZOY A;  3ONL C;  4KBM B;  2W0G A;  2HPL A;  5AIN A;  2SPC A;  2XZ5 A;  1I9B A;  3TLS A;  5KMG P;  3ZC1 A;  4QWN B;  4I50 E;  3LJC A;  3M3Z B;  3C4W A;  5HAX A;  5LJN A;  3O9X A;  4PIR A;  4EV6 A;  3OVU A;  3KV9 A;  5HWY A;  2IW5 B;  4HTE A;  2N1G A;  2JQQ A;  3UU8 A;  4EXT A;  3P8C D;  5KDM C;  3UUL A;  4I43 B;  3H3M A;  3JC6 D;  2LHR A;  3SFE A;  4DR3 T;  2XPK A;  2K48 A;  2B1E A;  3LK2 B;  2LEH A;  3VRB A;  3L39 A;  2OLT A;  4DV4 T;  4YXD A;  3AE7 A;  3Q5W A;  1MIY A;  2NP9 A;  4B3S T;  3WTJ A;  2C0S A;  4UV9 B;  3C4X A;  3Q5E A;  4H9O C;  2E9X B;  4IDN A;  3JCF A;  5LMN T;  2KND A;  2W62 A;  4HFE A;  4IL9 A;  2UXN B;  3O1I A;  4HEA A;  3PE0 A;  4HFH A;  3E0Z A;  3CX6 B;  2XQY A;  4OHF A;  3ZST A;  2P9B A;  3FZK B;  1KEY A;  3UUB A;  3UQ7 A;  2WU5 A;  2VKO A;  4NUV A;  2UUB T;  1VRB A;  4AXP A;  2AXD S;  4OK0 A;  3RYC E;  2XQ5 A;  2EHO B;  3AEC A;  3O1J A;  3SOL A;  4CXW A;  5AFM A;  2XAS B;  3KVA A;  1HX8 A;  2WY2 A;  4WBO A;  4TN7 B;  2PGZ A;  3MA9 A;  3QUJ A;  3PUX F;  2DWK A;  4P0B A;  2WDV A;  2WP9 A;  5FYM A;  1OED B;  3G06 A;  4PJJ A;  3AAE B;  3ETU A;  3RYI E;  4C91 A;  2X00 A;  3PJA J;  3TLV A;  4CN1 A;  5FKY A;  5FY7 A;  4O4J E;  3J9X 1;  3WTM A;  1N34 T;  1OED E;  4P1N A;  5LYJ E;  4JLE A;  3NVO A;  3P4R A;  3ZYK A;  3U8K A;  1SA0 E;  2M67 A;  3K3N A;  4IDO A;  3U78 A;  1HNX T;  3ABV A;  1J1J A;  3AEF A;  3RHW A;  2YDQ A;  4OYK A;  3UFE A;  3N2O A;  4X20 E;  2WNC A;  1W09 A;  3C4Z A;  5LHH B;  2Y8D A;  5HEO A;  3UTK A;  4U2Z A;  2KWI B;  3UUM A;  4NUU A;  2HPJ A;  3KBU A;  2UZ6 A;  2XTL A;  4ZK4 A;  1KF6 A;  2QA7 A;  2WDR A;  3LBX A;  5FY0 A;  3OKQ A;  5JR9 C;  2LE8 A;  3AE5 A;  1NEN A;  1UX4 A;  4B6X A;  1WR6 A;  4TNV A;  2VVS A;  3RI5 A;  4PJN A;  3JAD A;  5TAO A;  3E08 A;  3NWI A;  4ZS2 A;  3SQ6 A;  5AFN A;  2ES0 A;  2XAH B;  4F8H A;  4EIW A;  2WZH A;  4X1Y E;  4YSX A;  1HFA A;  2ODV A;  4ZEY A;  2V5C A;  2I0M A;  2XNT A;  2Y54 A;  2DLR A;  2V7M A;  1Y01 A;  2H88 A;  3VU7 H;  2W00 A;  3RKO A;  3NRY A;  2YDS A;  3AE8 A;  4KUM B;  2ODU A;  3R84 B;  2YKS A;  5KXJ A;  2LT3 A;  3NZP A;  2Q9Q C;  1UK5 A;  2MTQ A;  3H3A A;  2V7J A;  5L4E A;  4UM3 P;  3ESL A;  3GA8 A;  4QXH B;  3ETV A;  2CLY B;  4E7Z A;  2BS2 A;  1HNW T;  2BYR A;  4ADZ A;  3AXJ B;  2J4G A;  3N9N A;  1X79 A;  4KHP T;  3NRX A;  2V26 A;  1U4Q A;  2NW8 A;  3AE6 A;  2CXF A;  2CRB A;  2LSY A;  2NW7 A;  1YKH B;  4PK6 A;  2ZM2 A;  2CXD A;  2G0U A;  3B5M A;  1VOM A;  3RH3 A;  2PJQ A;  3WTL A;  4A97 A;  5LMU T;  4JI8 T;  4ZZC A;  4JI5 T;  3T1H T;  4IGU A;  4UV8 B;  2FJB A;  2XHE B;  1T98 A;  3SH1 A;  3CWZ B;  4TWD A;  2VQE T;  5FJV A;  3WAK A;  5LGT B;  4JEH B;  4IE4 A;  5BW2 A;  5FXV A;  2PFV A;  3MKD A;  2K5B B;  1ZKE A;  4X1I E;  2Y57 A;  4LF7 T;  2VL8 A;  4P0A A;  2N2N A;  2JQ9 A;  5EK2 A;  3RQU A;  4MAL A;  1IJ6 A;  3OYX A;  3ANW A;  5AQN B;  3KDS E;  4B3T T;  4AKI A;  5JDM A;  1YW0 A;  3VRA A;  3TLT A;  4K0U A;  2BYN A;  5ABF B;  3KV4 A;  1JNR A;  3AE2 A;  1D1C A;  3P4Q A;  4GK5 E;  1S35 A;  4DV5 T;  2VUR A;  3CVR A;  3DJB A;  1E1H B;  5EK3 A;  5JME A;  4HN9 A;  2KWH A;  2LM2 A;  4U7I A;  1XDO A;  2IC6 A;  1AJ3 A;  1U5P A;  5AQQ B;  2A72 A;  2IC9 A;  3L3P A;  5LG4 A;  2F4V T;  2LOP A;  1LKX A;  2BZB A;  2BBH A;  2V8S V;  4X66 T;  5F5W A;  3JAE A;  3ZMV B;  1HG5 A;  4HWF A;  3FBZ A;  4Z8X A;  2JQH A;  4EB6 E;  5H6R B;  5L3F B;  2ZMA A;  4QAC A;  5LP6 E;  1WCR A;  2VQF T;  2XQ3 A;  1MIW A;  3Q9D A;  2XJ7 A;  2PBI A;  4EZH A;  3N9L A;  4JBW F;  3C84 A;  1JNZ A;  2YDR A;  1IBL T;  5JDH A;  4B3M T;  4ZRU A;  3VR9 A;  1UUR A;  5HXS A;  2MOZ A;  4H9P C;  2H89 A;  3VKG A;  4UIG A;  2XSB A;  2I6H A;  1BR1 A;  3C64 A;  2K3W A;  3ZMU B;  4ILA A;  2BG9 B;  2L3L A;  3RKG A;  5HXH A;  3B57 A;  5J2T E;  1IAP A;  2W66 A;  2E9X A;  3CQG B;  3QB5 A;  4IDP A;  2KZ7 B;  4AIS A;  3RQW A;  4AQF C;  3E22 E;  3BQL A;  5J5I A;  4DVD A;  2BG9 E;  2W67 A;  4OX9 T;  3D0T A;  5HXR A;  4DBQ A;  2E9X C;  4LML A;  4UF0 A;  4EZ4 A;  3FZH B;  2X51 A;  2M6I A;  4IE0 A;  2XQ6 A;  3U3I A;  5ABE A;  4CXX A;  4DR6 T;  3KV5 A;  3VHL A;  4AQY T;  3CIR A;  4AI6 A;  1O3X A;  1N36 T;  3SQ9 A;  2EHO A;  1KFY A;  4GYS A;  3AA1 B;  2WNJ A;  2D0T A;  4GIW A;  2NW9 A;  2L8K A;  3CQC B;  2ZLY A;  4LF5 T;  5J0Z A;  2R6G F;  4HWI B;  1M62 A;  4P09 A;  2EHO C;  3NZQ A;  2QGS A;  5HWX A;  2LM9 A;  4DV6 T;  3OYZ A;  3FB2 A;  2XM1 A;  1UW6 A;  3LSV A;  4HFD A;  4CI3 B;  1HF8 A;  1KNZ A;  1OED C;  5HXC A;  1FEW A;  5BRX A;  4LF4 T;  4LF8 T;  4DV0 T;  4LMK A;  4JI0 T;  5KX5 E;  4XHE A;  2W8F A;  3HI2 A;  1OWA A;  3QC9 A;  3AED A;  5J1G A;  5CA1 E;  3FZF B;  3IGQ A;  2PTF A;  1HCI A;  2Y48 B;  2J62 A;  1D1A A;  4BQT A;  2KT9 A;  3NBX X;  4Z90 A;  4U7Y A;  3UU5 A;  5AQK B;  3P7I A;  4TZ4 C;  4YHJ A;  4LFA T;  4TNW A;  5C2T A;  3CX7 B;  4PJM A;  3PEO A;  5JDQ A;  2C9T A;  2Z6E A;  3SS1 A;  4ASK A;  3IA3 A;  1Y64 B;  2FUP A;  5AQL B;  3RC3 A;  1MNE A;  1B7T A;  4HKA A;  4IST A;  3ZDG A;  1ZP0 A;  4JI6 T;  4FJO A;  4PAG A;  4X64 T;  1L0V A;  2M6B A;  3KFW X;  3RRW A;  2OA5 A;  3LDQ B;  2UU9 T;  2X66 A;  5HXE A;  5L4H A;  2NTX A;  4DR7 T;  1UUS A;  3HKE E;  3L09 A;  4Q25 A;  3J7Y q;  2WN9 A;  2V6Y B;  4B3R T;  2WMO A;  1FJG T;  4BAY B;  2V7I A;  5CJ5 A;  3ZN0 B;  3ZJ2 A;  5AFL A;  3T8O A;  3ZPO A;  1D0Z A;  4U31 A;  4EYY R;  3WAJ A;  4DID B;  2WSS V;  2QC1 B;  1N33 T;  2D9D A; 
#chains in the Genus database with same CATH homology
 5BW2 A;  1OED A;  3P4W A;  5CFB A;  5BP0 A;  3GUA A;  2X00 A;  4ZK1 A;  2XQ8 A;  2XNU A;  3TLV A;  4AFT A;  2Y57 A;  4LMK A;  2YME A;  5TVC A;  5AFH A;  4ILC A;  4XHE A;  2W8F A;  4TWF A;  4Z91 A;  4ZJS A;  2YN6 A;  2XNT A;  3RQU A;  3U8M A;  2Y54 A;  4TWH A;  4D01 A;  3WTM A;  3IGQ A;  1OED E;  4ILA A;  2BG9 C;  3T4M A;  3WTK A;  3WTH A;  3U8N A;  4HFB A;  1UV6 A;  3SIO A;  2BG9 B;  4BQT A;  3EAM A;  2LKG A;  3U8K A;  2ZJU A;  4Z90 A;  5J5G A;  3WTO A;  3TLT A;  2BG9 A;  4X5T A;  3EI0 A;  4ZJT A;  3UU5 A;  2BYN A;  2LLY A;  4QH5 A;  4QH1 A;  2WZY A;  4QAB A;  5IUX A;  5KE4 A;  2YKS A;  3RQW A;  5J5I A;  3WTJ A;  4TNW A;  2MAW A;  4NPP A;  4HFC A;  5J5F A;  2BG9 E;  2XQA A;  3RHW A;  5HCJ A;  4IRE A;  3SQ6 A;  2W8G A;  5L4E A;  3PEO A;  4HFI A;  2C9T A;  2XZ6 A;  4UM3 P;  5JME A;  4LML A;  2LKH A;  2VL0 A;  2LM2 A;  4HQP A;  5LG3 A;  4FRR A;  2M6I A;  5KZU A;  2XQ6 A;  2BYR A;  5LXB A;  2Y56 A;  4DBM A;  3TLW A;  4HFE A;  4IL9 A;  4NZB A;  4EZ1 A;  5J5H A;  2WNC A;  5CO5 A;  3ZDG A;  2BYQ A;  4A98 A;  5AFJ A;  4HFH A;  2XQ9 A;  3SQ9 A;  4BFQ A;  5HEJ A;  4IL4 A;  5HEO A;  2M6B A;  1UX2 A;  2YMD A;  3U8L A;  5L47 A;  2WNJ A;  3UU3 A;  3WTI A;  4QAA A;  2UZ6 A;  4ZK4 A;  3WTN A;  4LMJ A;  2X00 D;  3P50 A;  2XYT A;  3JAE A;  3JAF A;  3UUB A;  5AIN A;  5L4H A;  3UQ7 A;  3WIP A;  2XZ5 A;  3UQ4 A;  4ZZB A;  5J0Z A;  3PMZ A;  2YOE A;  4COF A;  4UM1 A;  4UM3 A;  4B5D A;  1I9B A;  2XQ4 A;  2WNL A;  5SYO A;  2WN9 A;  4AFH A;  3TLS A;  3RIA A;  4AFG A;  5AFM B;  3WTL A;  2KSR A;  5HEG A;  2BR8 A;  3TLU A;  4A97 A;  4UY2 A;  4QAC A;  4WV9 A;  2XQ5 A;  5HEH A;  3C79 A;  2BYP A;  4ZZC A;  4TNV A;  2Y7Y A;  5AFM A;  4ILB A;  2XQ3 A;  3RI5 A;  3JAD A;  2PH9 A;  5AFK A;  3SH1 A;  3U8J A;  2PGZ A;  2Y58 A;  4PIR A;  3UU4 A;  1UW6 A;  2XYS A;  4UXU A;  3LSV A;  4HFD A;  5AFL A;  3RIF A;  2XNV A;  2XQ7 A;  4TWD A;  5HCM A;  1OED C;  5HEU A;  3ZKR A;  2ZJV A;  3C84 A;  5FJV A;  3ZDH A;  2BYS A;  4ZR6 A;  5AFN A;  4QH4 A;  5BRX A;  1OED B;  3UU6 A;  4XK9 A;  4ZRU A;  4F8H A;  2BR7 A;  2QC1 B;  4UM3 S;  3EHZ A;  3UU8 A;  2BJ0 A;  4ALX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...