3UUBA

The glic pentameric ligand-gated ion channel loop2-21' mutant reduced in solution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 95
structure length 311
sequence length 311
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uubA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uubA01
4FRRA 3UU6A 2Y56A 2BR8A 4BQTA 3U8NA 5J5HA 5TVCA 3P50A 4HFBA 2WN9A 1OEDA 5AFNA 2BG9C 3JAFA 4NPPA 5AFMB 5AFJA 4QH5A 4ILAA 1UV6A 2PH9A 5HCJA 2XNVA 3SH1A 3WTLA 3LSVA 5HEHA 3JAEA 4AFHA 2XZ5A 4HFIA 1UW6A 2BYRA 2YMDA 4ILCA 2M6IA 5AFLA 4UM3A 2BG9A 2LLYA 2BYPA 2BG9B 3UQ7A 5KE4A 3WTOA 3JADA 5FJVA 4LMKA 4Z91A 4HFEA 2VL0A 5AFKA 2LKGA 3WTKA 3PMZA 2LM2A 4HFHA 4IL4A 3EHZA 4UM1A 4EZ1A 4IREA 4HQPA 2KSRA 2QC1B 5J5IA 2M6BA 2XQ6A 4UY2A 4NZBA 4WV9A 3U8JA 4QH1A 2Y58A 4AFGA 2PGZA 3RIFA 3SQ9A 3TLVA 3U8KA 3IGQA 4XK9A 5HEOA 2MAWA 2LKHA 5HEJA 2BG9E 4ZZCA 2YOEA 4ZK4A 4AFTA 2XYSA 5LG3A 4LMLA 5BW2A 4ZK1A 5IUXA 2WZYA 3UU8A 2BR7A 2BYQA 4ILBA 3GUAA 4UM3P 3P4WA 5HCMA 3T4MA 4ZR6A 4D01A 2WNLA 2XQ4A 3TLWA 1OEDB 3U8MA 3SIOA 4HFDA 4ZJSA 3UU4A 5J0ZA 3ZDGA 4DBMA 4ALXA 4Z90A 3C84A 5J5FA 5HEGA 3TLTA 2C9TA 2XYTA 5AINA 4ZZBA 3SQ6A 1UX2A 3UUBA 4TNVA 4HFCA 2BYSA 2XNTA 2W8FA 3TLUA 5BP0A 2YKSA 3WTNA 3EAMA 2XNUA 5AFMA 1OEDC 2YMEA 5CFBA 3WIPA 4QACA 5L47A 2UZ6A 2XZ6A 4ZRUA 2Y7YA 2X00D 3RQWA 3ZKRA 3RI5A 3RIAA 3UQ4A 4ZJTA 2ZJVA 2X00A 4TNWA 4F8HA 4PIRA 4X5TA 3C79A 4COFA 2XQ7A 2W8GA 5SYOA 1I9BA 2WNCA 3UU5A 1OEDE 4IL9A 2ZJUA 4BFQA 5AFHA 5L4HA 2XQ8A 2Y57A 4B5DA 5BRXA 3RQUA 5HEUA 2XQAA 3RHWA 3UU3A 3WTHA 4QAAA 5KZUA 4UM3S 3PEOA 4XHEA 5CO5A 2XQ5A 3TLSA 4A98A 2XQ9A 2XQ3A 2YN6A 5L4EA 3WTIA 2WNJA 4TWHA 4TWFA 4QH4A 4UXUA 3U8LA 3ZDHA 4A97A 3WTMA 4TWDA 3WTJA 5J5GA 3EI0A 5JMEA 2BYNA 2Y54A 4QABA 2BJ0A 4LMJA 5LXBA
chains in the Genus database with same CATH superfamily
3NVOA 3SRZA 2NWBA 4UF0A 4DO0A 3MXZA 4YHHT 5AFNA 4NPPA 4AI6A 2VKDA 2IHR1 3AE6A 4X20E 1JNRA 2M6IA 3KDSE 1IJ6A 2E9XD 2L8KA 5FXWA 1ZV4X 5AFLA 2LLYA 2ACZA 3PJAA 5AQOB 3NBXX 5FNVE 2K3WA 4I43B 2E9XC 2ZLYA 1IZNB 4ZI7E 4CQIA 4HFHA 4X65T 1KEYA 4QXBB 4JI8T 4CXWA 2V1DB 1HTJF 2PGZA 4DBRA 3IGQA 4CZZB 3CQXC 1XMQT 4ZK4A 3C98B 2WS3A 3VRBA 2SPCA 3H3AA 4U2ZA 2QGSA 4ZK1A 5LB7B 5ABEA 2BR7A 2YK0A 2XSAA 4OK0A 3TKLB 3PUAA 2KWHA 4P0BA 3TLTA 2XYTA 2X9YA 2B1EA 3ZMVB 4L9IA 4CI2B 2CPTA 4KUMB 2LRKA 3EAMA 4X1IE 4CN6A 5LG4A 3BQKA 2L3LA 4JI6T 2LEHA 2ZM6T 2ES0A 2E2AA 2XJ7A 2HN1A 3EDVA 2UXNB 3PE0A 5JDNA 3EI0A 4UEMA 4LMJA 2Y8DA 2CEAA 2LRLA 3O1IA 4DV2T 2LHNA 5ADXL 5FVKA 5DQWA 3HKCE 3K8PC 1HG2A 3P4SA 3PU3A 2BVMA 4OYJA 2ACXA 4OHFA 1S35A 1ZKEA 4EXTA 5FY7A 3RRWA 4OYKA 4YY3T 3LBXA 2BBHA 2BBJA 3AE5A 1BR0A 4EZ1A 3IF8B 2XY8B 4HQPA 2M6BA 1E7PA 3RRCA 4UV8B 5JTGA 4C90A 2VASA 4LF8T 3QOFA 5LG3A 3UU8A 1T72A 1Z0PA 4PFOA 3E22E 3DP7A 5J0ZA 5J5FA 2X66A 4X1KE 4IE4A 2WU5A 3SQ6A 4H63H 4HFCA 2W8FA 4JI7T 2YMEA 3FZLB 1E2AA 5C8YE 2Y7YA 4ASKA 3KINB 2J62A 4CXXA 2PBIA 4JV5T 1S94A 3I9YA 4YT0A 2QRXA 2A9UA 4ISSA 5H6RB 4NXMT 3WAJA 3LJCA 2CLYC 1UX5A 3IBPA 3T1YT 4U31A 4DR5T 1KNZA 2A72A 2VQFT 3UULA 3CPZA 5HYAA 5AFMB 4QH5A 4ILAA 3WTLA 3ZMZB 5JQGE 5HEHA 4YXDA 1X9BA 1LKXA 3RC3A 4HFIA 3U3IA 2X67A 2YMDA 2J47A 2CCQA 4HWDA 5LYJE 4B6XA 4U72A 2CXDA 3P8CD 3ETUA 5LCYA 2DLRA 3WTOA 3L3PA 2RA1A 3N2GE 3N9MA 4DV1T 2E5LT 2AXDS 1WR6A 2KSRA 3ANWA 4AQYT 3OKQA 4WV9A 4X62T 3IEEA 1MMDA 2ZM2A 2Q9QB 4XBFB 3FXDB 1XDPA 4LF9T 3CK6A 5HCMA 1FEWA 4C91A 3TLWA 5L3CB 2QA7A 4ALXA 4Z90A 2Q9QC 4PAGA 4IE7A 4JI4T 1SHZC 2WDVA 3K1SA 5AQSB 1N33T 2HPLA 1HR0T 1YKEB 5FYMA 5AQPB 4QACA 1OWAA 1HFAA 3LG7A 4O4JE 3ZKRA 3B13A 5L3DB 3BK9A 5FL0A 3ZMSB 4X5TA 3Q5XA 5IHYA 2DHRA 4COFA 5ABFA 2XHEB 5JDFA 2DCFA 3S4UA 3RHWA 5KZUA 5CO5A 5JDMA 4E7ZA 4NXNT 4TWHA 3PDYA 2BYNA 2WDQA 4FRRA 2Y6XA 4EZHA 2CWYA 2WN9A 3PU8A 4GKJT 4QX7B 3LSVA 4P1NA 3AEAA 2NW8A 5GONE 1T8BA 5EZYE 4ILCA 1MMAA 1J5WA 4G63A 3KV5A 1FMWA 3AA0B 5LJNA 2BG9A 1DU2A 4O2AE 3UQ7A 2WMOA 2J1DG 3DTOA 5EK4A 3WTKA 3FZKB 3M65A 4AKGA 4ZHQE 2E8IA 4KMCA 4H9PC 5AQTB 2YDSA 4TV8E 4WZXA 2H7VC 5HEOA 2WMNA 3ZYMA 1HCIA 4DV0T 5BW2A 2ZMAA 4ILBA 3GUAA 2C5IT 4LFAT 3ZEFB 3AE7A 2C5KT 5J1GA 5JDLA 2IDOB 4B3MT 2LSJA 3FBZA 4IDPA 3P4QA 2JMHA 1XNQT 1XZYA 3ETVA 3RI5A 4JEHB 4E7SA 2V26A 4F8HA 2XQ7A 3VKHA 3UTKA 5L4HA 2XZEA 2KWIB 1WLXA 5HEUA 4IDOA 4PJJA 1UGOA 2H89A 2WNJA 4BA9A 1W0AA 4TWFA 2HH7A 4MLKA 3KVAA 2RPAA 2Y56A 5HAXA 2WAUA 1YW0A 4WYVA 1N32T 4H63V 3UUMA 2VQET 4LFBT 4JI2T 3ZSTA 4HE8A 2IC6A 4P09A 4UF0B 2NW9A 5HXEA 3MJXA 5AFUL 2WWVA 1VRBA 3AA7B 2IIUA 4HN9A 5JRCA 4UVAB 4Z91A 3CQCB 5BMVE 1HS7A 5LGTB 2LT3A 4IL4A 2WM9A 5J5IA 2W63A 4DMWA 2CBIA 4QH1A 1MNEA 4AFGA 4YTNA 2BG9E 5ETWA 5M4YA 4B3RT 4ZR6A 4D01A 3NZPA 2CXFA 1UURA 3AXJB 4DBMA 3QNUA 1IAPA 4BAYB 2WWUA 3TLUA 4IE0A 3VHLA 1X79A 1HNWT 2LOSA 5LGNB 4TZ4C 4ZRUA 4B3TT 4CI1B 2KXPB 2ZJVA 5LJMA 4PIRA 2HHHT 3ESLA 2HN2A 3RYHE 2UUAT 2F4VT 4BFQA 2WCAA 1J5ET 2E9XA 2VKJA 4EYUA 1MIYA 4QAAA 5DQVA 3KV6A 3WTIA 5J2TE 4A97A 4IDNA 1HX8A 3MZKB 4EZ4A 2X51A 3O4XE 3Q5WA 3LK2B 5J2UE 3OPCA 4O4IE 3HKDE 5AFJA 4QXHB 4NIQA 2JJ9A 2V6YA 5CGMA 5LMUT 1UW6A 2BYRA 1MMGA 2W2UA 5ABFB 2I6HA 3W15B 3KBUA 2A2FX 3C4ZA 2XAGB 3ONXA 4DV7T 2JRKA 4EAHA 5LXTE 2X68A 3O1HA 4QKNA 3LBXB 3BQLA 1ZP0A 4KHZF 2IAKA 2XASB 3SQ9A 2MAWA 4CI3B 2YOEA 3ZJ2A 3UFGA 1WRDA 2MTQA 2WNLA 2OA5A 2BS4A 5IYZE 4CN1A 2YU1A 3UU4A 3AXJA 1SUMB 1Y64B 3PUGA 1UX2A 1SA0E 1H7CA 4UIGA 3HR0A 1WYCA 2KZ7B 3P4PA 2V7IA 2VVSA 1V9DA 4X1YE 3VRAA 3AEEA 2X00A 3ZJ1A 3ZSSA 4IL9A 3DJBA 3F31A 3C4XA 4KX6A 4EB6E 5FXZA 4JI3T 1QUUA 3EVYA 3CKDA 4A56A 3WTMA 1IBMT 4GYSA 3WTJA 2HPJA 4MHCA 1QSDA 3OJAA 5LXBA 4DUYT 3LK42 2B76A 3RKOA 4AKLA 5H6QB 3AAIA 2W66A 3SH1A 1M62A 2WQYA 2XZ5A 2D0TA 2Q9QA 5LA6E 4GOUA 3CQGB 1YXRA 5HXRA 4OX9T 5FJVA 3C4WA 3CX8B 3AEBA 4DV3T 4H9NC 3VKGA 4NZBA 3LDQB 3U8JA 1MNDA 2A3DA 1UK5A 3PUZF 4TV9E 4OFZA 3A8YC 4ZS2A 4ISTA 2XAQB 2LE8A 3V5SA 2BYQA 3P4WA 2V5CA 4FJOA 5CA0E 3ZDGA 5HEGA 2C9TA 3AB3B 3UUBA 3RH3A 4A5XA 5LMNT 4KI0F 3H3MA 3WTNA 3ZPOA 4PJMA 5L47A 2XZ6A 2YEVC 4AQFA 5ABHA 4TNWA 4EEDA 2ZJUA 2FUPA 1I94T 3T1HT 3BQIA 2DWGA 1HNXT 4ZXLA 3AEFA 4AXPA 1U5PA 2MPKA 2D0UA 3UU6A 4ZI2D 1U4QA 5AQFB 3NZQA 3AE4A 2WU2A 2PH9A 2LHRA 4AFHA 4X64T 3EUHA 2JIWA 5AFKA 1KNRA 2LKGA 3PUVF 4IREA 2WDRA 5JREA 5HXHA 3K3NA 4IDZA 5L3EB 3VR8A 1HX1B 2CHOA 2WY2A 4H9OC 3EDUA 4L5GA 1QLBA 5AQNB 2K9AA 4QWNB 1I6ZA 4JI1T 1XDOA 3CVRA 5CJ5A 4ZEYA 4I55E 3VR9A 2FJEA 2LSIA 2UZ6A 3FZMB 4K0KT 3RIAA 2E9XB 2N1GA 3ZMUB 2D5UA 1R8IA 5FKYA 5ABGA 3SFEA 4ZI3D 2QYWA 1OEDE 3AAAB 2NOXA 2XQ5A 3KV9A 4PFPA 3AVSA 5LBQB 4U3CA 2K24A 5J5GA 2UXXB 3ZN0B 2CWOA 4WBOA 5TVCA 1W9RA 3L39A 4ANJA 2NW7A 3PURA 2NR4A 2ZM0A 4KBMB 4G2AA 3CWZB 2V7MA 1CUNA 4QX8B 3EHZA 2L9QA 3F2EA 3WAKA 4U74A 5AQLB 2V5DA 1HNZT 5HEJA 4DV4T 3J7Yq 4HWHA 3A5XA 2EHOA 1W0BA 3SIOA 4O4HE 3C51A 1T98A 3OVUA 2NTXA 3RIUA 4PJLA 5BP0A 3NRYA 5CFBA 5JDQA 4ERRA 2GK9A 5TAOA 4PK4A 1XWMA 2H3RA 2VVNA 3Q9DA 3AE8A 3QB5K 3SS1A 4YSXA 2XQ8A 4IE6A 3RQUA 4EEBA 4BJNA 3PV0F 4LF5T 2YDRA 4UXUA 1G8XA 2V7JA 4TWDA 4GK0E 3RX6A 5LP6E 2E5VA 1FMVA 2KINB 5J5HA 1MMNA 1AJ3A 3P50A 5DABA 5L3GB 1YD8G 4PK6A 1KF6A 1G73A 2C5JA 4HKAA 2WB5A 3MK7C 5AQRB 1BR4A 3JC6D 2P9BA 4UV9B 3ZCJA 1D1AA 2QVAA 2FBWA 2CXLA 2IMLA 5JDHA 3F57A 3PTRB 1KK7A 5FL1A 2Y58A 4IDQA 3U8KA 3E08A 2JQ9A 4AFTA 4CXYA 4P0AA 3ZMTB 1E1HB 1FIOA 5F8PA 2X0HA 3NWIA 4ZJSA 4DR4T 5F5WA 5AINA 3K3OA 3CX6B 2XNTA 2XUEA 3N9LA 2YKSA 3P7IA 2VKOA 4UVBB 3WIPA 3U78A 2CE7A 3AAEB 1UUSA 2BDEA 2X00D 4IGUA 3RQWA 3ZLIA 3AVRA 5KX5E 4WW0A 4IIJE 4ZS3A 5JR9C 4JUYA 3L8RA 2XQ3A 1WR0A 2XQYA 3U8LA 2W61A 4GYRA 4DVDA 3PUXF 4DR2T 3SFDA 2NP9A 5AQIB 4QHOA 2OV9A 2J4GA 4AISA 2X0LB 2XNVA 3ZT5A 5C2TA 4WNKA 2X0YA 4YSYA 1VCSA 4DIDB 3PJAJ 2CA5A 2BS3A 4Z8XA 3SWHA 2UXDT 3ZN1B 2RP4A 3UUNA 2K48A 4K0UA 2VL0A 4AKIA 2WZIA 2LM2A 2D9DA 4U7YA 4YFSA 4UY2A 4ADZA 3I0OA 2CM0A 4EOZB 2UUBT 3QK6A 4LMLA 3MKDA 5IUXA 3FHNA 3AEGA 2XQ4A 4HWIB 3GMIA 4AQGA 1LVKA 3N2OA 1OEDC 3I1AA 3X1DA 3CMLA 2N9DA 2FJDA 1W09A 2KT9A 5AQQB 3UQ4A 4UELA 4UVCB 3L09A 4I50E 3AA6B 2IUBA 5CB4E 3KFWX 3TLSA 3AE2A 3HI2A 4QH4A 5JMEA 1ZOYA 3N9NA 4QABA 2V7KA 4JI5T 3AEDA 2W67A 4LF7T 3ANWB 3OYZA 3K3QC 1HG5A 3NKZA 5HCJA 5HWYA 4PW8A 3NRXA 2BKNA 5AQGB 3EABA 4UM3A 3J9X1 2WSSV 5F3JA 4DR1T 2UXCT 4LMKA 2VL8A 2IW5B 3RLFF 2YDQA 3PMZA 2X9XA 4MFRA 2OLTA 2N2NA 5LHGB 2V7LA 5KMGP 5DJQC 2YU2A 4PNIA 3WI3A 4EGWA 3N9QA 2KLQA 4UM3P 3FXEB 1NEKA 3U8MA 4DV5T 4HFDA 3AE9A 4DR7T 5FXVA 3A7MA 2EHOC 5AQMB 4DV6T 2LSYA 1YQ3A 4TNVA 1KFYA 3OTOT 2V6XA 4X66T 4QXCB 3RYCE 2W62A 5HWXA 1EZ3A 4ZJTA 5BR8T 2JQQA 1D1CA 4AKRB 1M7KA 2Z6EA 1I9BA 3LK3B 1VCTA 3JC6C 4EYYR 4KP3C 2Y48B 4UM3S 3PEOA 4XHEA 3PUSA 1CHUA 2YN6A 3HKBE 4O4LE 4H9RC 3G06A 2UXBT 3UT5E 2LSGA 4LF6T 4O2BE 4HEAA 2BR8A 4BQTA 3U8NA 3P4RA 5FXXA 4XZCA 3E0ZA 1OEDA 4O8SA 2MYSA 5LHIB 2VKHA 2XAHB 2NTYA 2BKPA 2JPFA 4JLEA 2BYPA 1WCRA 4YSZA 4YHJA 4JI0T 3FBLA 3FB2A 3JADA 4HFEA 3AECA 4EIWA 1GQEA 3RYFE 2W00A 5HXCA 5EK2A 2ODUA 2VURA 2UU9T 4I0UA 3I0QA 3I9WA 4FI5A 5JH7E 3HKEE 1XNRT 4HWCA 3O1JA 3RIUC 2WZYA 2XAFB 2WBLA 2FJAA 4UXNB 1FJGT 3GN5B 1MIVA 4H9QC 1D0XA 5LHHB 2BYSA 4YTMA 1MIWA 3ZYLA 5LGUB 5AFMA 5A1LA 4DR3T 1VOMA 3UUXB 2R6GF 5FY1A 1IBKT 2C0SA 5JVDE 2XSBA 2WNCA 4N78D 5BRXA 4DR6T 1IJ5A 2D2SA 5L4EA 2AE9A 5JR9A 2CLYB 5KXJA 3MACA 3OBVE 5AQHB 3RKGA 2BJ0A 1O3XA 3CX7B 5LBMA 4U7IA 1J1JA 3V5UA 1UV6A 1D0YA 2X9WA 4L0RA 2I59A 4H9SE 1BR2A 4IT4A 4IHJE 2G0UA 3GWHA 5KE4A 2BKOA 1Z8UA 4YTPA 1NENA 4IE5A 4DNDA 3AE1A 4J2CA 4NUVA 2XQ6A 2PG8A 5JDGA 4LFCT 2WP9A 4M1PA 2VWAA 3M3ZB 3B5MA 3N9OA 2LKHA 3B57A 2UUCT 1B7TA 3UFEA 3O9XA 4B3ST 4CN4A 4F6RC 3QB5A 3CIRA 2CRBA 3C84A 4TX5A 2W4XA 3N5LA 3RC8A 1ZEEA 4JBWF 2XNUA 1YQ4A 3PUWF 2MBGA 5JR9B 4LF4T 3KBTA 2XM2A 3SOLA 2LJLA 3ZT6A 2YINA 4KHPT 4DUZT 3RGLA 5SYOA 2MOZA 1D1BA 5AFHA 2Y57A 4B5DA 3FZFB 2Q9QD 4GK5E 3WTHA 1NWMX 3RPUA 3H37A 5AQJB 4ZI2C 3R84B 3ZDHA 3GA8A 3LFMA 5KDMC 4ZOLE 2KMFA 3GN5A 4ILUA 5AQUB 3ZYKA 2BG9C 3JAFA 5AQKB 2CBJA 3ZCIA 3AE3A 2VK9A 3Q5EA 3PUYF 4AQFC 1SE7A 3QUJA 3C50A 3ONLC 3PUQA 1HF8A 5AQVB 4U33A 5FP3A 2BG9B 1UX4A 4JEUB 5FVLA 5LOVE 2BVLA 4DMVA 4UM1A 4HTEA 1XMOT 4JYAT 2H88A 3ZC1A 1BR1A 2ODVA 4AKHA 2LM9A 3RIFA 3TLVA 3D0TA 3Q5DA 2H7OA 2XYSA 2JMKA 2ZM8A 2PJQA 2V8SV 5L3FB 2FJBA 3HA4A 2CHNA 2JQHA 1UCUA 3MA9A 1OEDB 5L3BB 2XTLA 3RYIE 3OYXA 4ZZBA 1KNPA 3ONJA 2M67A 2WZHA 2DWKA 3IHRA 4TN7B 5FY0A 3HL6A 3IA3A 5HXSA 3KVBA 1D0ZA 3ZT7A 1LVFA 3VU7H 4PK5A 4ZI3C 3UU5A 4HGAA 3R6NA 2XQAA 2W0GA 4HWFA 4WBNE 2IC9A 3T8OA 3N9PA 1L0VA 1OXZA 2XPKA 3RF1A 4I4TE 2Y54A 2DL1A 3Q2MA 4YJ2E 4Q25A 4MALA 4BJMA 4GKKT 2VB6A 1US7B 4HFBA 5IWAT 2DNXA 2PFVA 3JAEA 2LOPA 3KV4A 3QC9A 1N34T 4V1Av 5LNKA 4HFVA 1WFDA 2I0MA 2X9HA 2BZBA 4YLHA 2V6YB 3FZHB 4PJNA 2QC1B 1IBLT 4MBQA 1Y01A 3C64A 3AA1B 4XK9A 2K5BB 2PTFA 4ZZCA 2BS2A 1NAFA 3JCFA 2EHOB 5CA1E 4TUYE 1WYBA 2DI4A 3T4MA 3ABVA 2XM1A 1T7SA 1JNZA 4NUUA 4U2YA 2EHOD 5FMNA 3N2KE 1LRZA 4AIUA 1N36T 5EK3A 4UR9A 2KNDA 5C3JA 2JQKA 4XAXB 4EV6A 4DBQA 3C79A 2W8GA 1ZHCA 3ZC0A 5L2LA 2CMRA 4GIWA 3UU3A 2LSKA 2XAJB 4YJ3E 4A98A 2XQ9A 5E0OA 5JRCB 1YKHB
chains in the Genus database with same CATH topology
4FRRA 3UU6A 2Y56A 2BR8A 4BQTA 3U8NA 5J5HA 5TVCA 3P50A 4HFBA 2WN9A 1OEDA 5AFNA 2BG9C 3JAFA 4NPPA 5AFMB 5AFJA 4QH5A 4ILAA 1UV6A 2PH9A 5HCJA 2XNVA 3SH1A 3WTLA 3LSVA 5HEHA 3JAEA 4AFHA 2XZ5A 4HFIA 1UW6A 2BYRA 2YMDA 4ILCA 2M6IA 5AFLA 4UM3A 2BG9A 2LLYA 2BYPA 2BG9B 3UQ7A 5KE4A 3WTOA 3JADA 5FJVA 4LMKA 4Z91A 4HFEA 2VL0A 5AFKA 2LKGA 3WTKA 3PMZA 2LM2A 4HFHA 4IL4A 3EHZA 4UM1A 4EZ1A 4IREA 4HQPA 2KSRA 2QC1B 5J5IA 2M6BA 2XQ6A 4UY2A 4NZBA 4WV9A 3U8JA 4QH1A 2Y58A 4AFGA 2PGZA 3RIFA 3SQ9A 3TLVA 3U8KA 3IGQA 4XK9A 5HEOA 2MAWA 2LKHA 5HEJA 2BG9E 4ZZCA 2YOEA 4ZK4A 4AFTA 2XYSA 5LG3A 4LMLA 5BW2A 4ZK1A 5IUXA 2WZYA 3UU8A 2BR7A 2BYQA 4ILBA 3GUAA 4UM3P 3P4WA 5HCMA 3T4MA 4ZR6A 4D01A 2WNLA 2XQ4A 3TLWA 1OEDB 3U8MA 3SIOA 4HFDA 4ZJSA 3UU4A 5J0ZA 3ZDGA 4DBMA 4ALXA 4Z90A 3C84A 5J5FA 5HEGA 3TLTA 2C9TA 2XYTA 5AINA 4ZZBA 3SQ6A 1UX2A 3UUBA 4TNVA 4HFCA 2BYSA 2XNTA 2W8FA 3TLUA 5BP0A 2YKSA 3WTNA 3EAMA 2XNUA 5AFMA 1OEDC 2YMEA 5CFBA 3WIPA 4QACA 5L47A 2UZ6A 2XZ6A 4ZRUA 2Y7YA 2X00D 3RQWA 3ZKRA 3RI5A 3RIAA 3UQ4A 4ZJTA 2ZJVA 2X00A 4TNWA 4F8HA 4PIRA 4X5TA 3C79A 4COFA 2XQ7A 2W8GA 5SYOA 1I9BA 2WNCA 3UU5A 1OEDE 4IL9A 2ZJUA 4BFQA 5AFHA 5L4HA 2XQ8A 2Y57A 4B5DA 5BRXA 3RQUA 5HEUA 2XQAA 3RHWA 3UU3A 3WTHA 4QAAA 5KZUA 4UM3S 3PEOA 4XHEA 5CO5A 2XQ5A 3TLSA 4A98A 2XQ9A 2XQ3A 2YN6A 5L4EA 3WTIA 2WNJA 4TWHA 4TWFA 4QH4A 4UXUA 3U8LA 3ZDHA 4A97A 3WTMA 4TWDA 3WTJA 5J5GA 3EI0A 5JMEA 2BYNA 2Y54A 4QABA 2BJ0A 4LMJA 5LXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRR A;  3UU6 A;  2Y56 A;  2BR8 A;  4BQT A;  3U8N A;  5J5H A;  5TVC A;  3P50 A;  4HFB A;  2WN9 A;  1OED A;  5AFN A;  2BG9 C;  3JAF A;  4NPP A;  5AFM B;  5AFJ A;  4QH5 A;  4ILA A;  1UV6 A;  2PH9 A;  5HCJ A;  2XNV A;  3SH1 A;  3WTL A;  3LSV A;  5HEH A;  3JAE A;  4AFH A;  2XZ5 A;  4HFI A;  1UW6 A;  2BYR A;  2YMD A;  4ILC A;  2M6I A;  5AFL A;  4UM3 A;  2BG9 A;  2LLY A;  2BYP A;  2BG9 B;  3UQ7 A;  5KE4 A;  3WTO A;  3JAD A;  5FJV A;  4LMK A;  4Z91 A;  4HFE A;  2VL0 A;  5AFK A;  2LKG A;  3WTK A;  3PMZ A;  2LM2 A;  4HFH A;  4IL4 A;  3EHZ A;  4UM1 A;  4EZ1 A;  4IRE A;  4HQP A;  2KSR A;  2QC1 B;  5J5I A;  2M6B A;  2XQ6 A;  4UY2 A;  4NZB A;  4WV9 A;  3U8J A;  4QH1 A;  2Y58 A;  4AFG A;  2PGZ A;  3RIF A;  3SQ9 A;  3TLV A;  3U8K A;  3IGQ A;  4XK9 A;  5HEO A;  2MAW A;  2LKH A;  5HEJ A;  2BG9 E;  4ZZC A;  2YOE A;  4ZK4 A;  4AFT A;  2XYS A;  5LG3 A;  4LML A;  5BW2 A;  4ZK1 A;  5IUX A;  2WZY A;  3UU8 A;  2BR7 A;  2BYQ A;  4ILB A;  3GUA A;  4UM3 P;  3P4W A;  5HCM A;  3T4M A;  4ZR6 A;  4D01 A;  2WNL A;  2XQ4 A;  3TLW A;  1OED B;  3U8M A;  3SIO A;  4HFD A;  4ZJS A;  3UU4 A;  5J0Z A;  3ZDG A;  4DBM A;  4ALX A;  4Z90 A;  3C84 A;  5J5F A;  5HEG A;  3TLT A;  2C9T A;  2XYT A;  5AIN A;  4ZZB A;  3SQ6 A;  1UX2 A;  3UUB A;  4TNV A;  4HFC A;  2BYS A;  2XNT A;  2W8F A;  3TLU A;  5BP0 A;  2YKS A;  3WTN A;  3EAM A;  2XNU A;  5AFM A;  1OED C;  2YME A;  5CFB A;  3WIP A;  4QAC A;  5L47 A;  2UZ6 A;  2XZ6 A;  4ZRU A;  2Y7Y A;  2X00 D;  3RQW A;  3ZKR A;  3RI5 A;  3RIA A;  3UQ4 A;  4ZJT A;  2ZJV A;  2X00 A;  4TNW A;  4F8H A;  4PIR A;  4X5T A;  3C79 A;  4COF A;  2XQ7 A;  2W8G A;  5SYO A;  1I9B A;  2WNC A;  3UU5 A;  1OED E;  4IL9 A;  2ZJU A;  4BFQ A;  5AFH A;  5L4H A;  2XQ8 A;  2Y57 A;  4B5D A;  5BRX A;  3RQU A;  5HEU A;  2XQA A;  3RHW A;  3UU3 A;  3WTH A;  4QAA A;  5KZU A;  4UM3 S;  3PEO A;  4XHE A;  5CO5 A;  2XQ5 A;  3TLS A;  4A98 A;  2XQ9 A;  2XQ3 A;  2YN6 A;  5L4E A;  3WTI A;  2WNJ A;  4TWH A;  4TWF A;  4QH4 A;  4UXU A;  3U8L A;  3ZDH A;  4A97 A;  3WTM A;  4TWD A;  3WTJ A;  5J5G A;  3EI0 A;  5JME A;  2BYN A;  2Y54 A;  4QAB A;  2BJ0 A;  4LMJ A;  5LXB A; 
#chains in the Genus database with same CATH topology
 3NVO A;  3SRZ A;  2NWB A;  4UF0 A;  4DO0 A;  3MXZ A;  4YHH T;  5AFN A;  4NPP A;  4AI6 A;  2VKD A;  2IHR 1;  3AE6 A;  4X20 E;  1JNR A;  2M6I A;  3KDS E;  1IJ6 A;  2E9X D;  2L8K A;  5FXW A;  1ZV4 X;  5AFL A;  2LLY A;  2ACZ A;  3PJA A;  5AQO B;  3NBX X;  5FNV E;  2K3W A;  4I43 B;  2E9X C;  2ZLY A;  1IZN B;  4ZI7 E;  4CQI A;  4HFH A;  4X65 T;  1KEY A;  4QXB B;  4JI8 T;  4CXW A;  2V1D B;  1HTJ F;  2PGZ A;  4DBR A;  3IGQ A;  4CZZ B;  3CQX C;  1XMQ T;  4ZK4 A;  3C98 B;  2WS3 A;  3VRB A;  2SPC A;  3H3A A;  4U2Z A;  2QGS A;  4ZK1 A;  5LB7 B;  5ABE A;  2BR7 A;  2YK0 A;  2XSA A;  4OK0 A;  3TKL B;  3PUA A;  2KWH A;  4P0B A;  3TLT A;  2XYT A;  2X9Y A;  2B1E A;  3ZMV B;  4L9I A;  4CI2 B;  2CPT A;  4KUM B;  2LRK A;  3EAM A;  4X1I E;  4CN6 A;  5LG4 A;  3BQK A;  2L3L A;  4JI6 T;  2LEH A;  2ZM6 T;  2ES0 A;  2E2A A;  2XJ7 A;  2HN1 A;  3EDV A;  2UXN B;  3PE0 A;  5JDN A;  3EI0 A;  4UEM A;  4LMJ A;  2Y8D A;  2CEA A;  2LRL A;  3O1I A;  4DV2 T;  2LHN A;  5ADX L;  5FVK A;  5DQW A;  3HKC E;  3K8P C;  1HG2 A;  3P4S A;  3PU3 A;  2BVM A;  4OYJ A;  2ACX A;  4OHF A;  1S35 A;  1ZKE A;  4EXT A;  5FY7 A;  3RRW A;  4OYK A;  4YY3 T;  3LBX A;  2BBH A;  2BBJ A;  3AE5 A;  1BR0 A;  4EZ1 A;  3IF8 B;  2XY8 B;  4HQP A;  2M6B A;  1E7P A;  3RRC A;  4UV8 B;  5JTG A;  4C90 A;  2VAS A;  4LF8 T;  3QOF A;  5LG3 A;  3UU8 A;  1T72 A;  1Z0P A;  4PFO A;  3E22 E;  3DP7 A;  5J0Z A;  5J5F A;  2X66 A;  4X1K E;  4IE4 A;  2WU5 A;  3SQ6 A;  4H63 H;  4HFC A;  2W8F A;  4JI7 T;  2YME A;  3FZL B;  1E2A A;  5C8Y E;  2Y7Y A;  4ASK A;  3KIN B;  2J62 A;  4CXX A;  2PBI A;  4JV5 T;  1S94 A;  3I9Y A;  4YT0 A;  2QRX A;  2A9U A;  4ISS A;  5H6R B;  4NXM T;  3WAJ A;  3LJC A;  2CLY C;  1UX5 A;  3IBP A;  3T1Y T;  4U31 A;  4DR5 T;  1KNZ A;  2A72 A;  2VQF T;  3UUL A;  3CPZ A;  5HYA A;  5AFM B;  4QH5 A;  4ILA A;  3WTL A;  3ZMZ B;  5JQG E;  5HEH A;  4YXD A;  1X9B A;  1LKX A;  3RC3 A;  4HFI A;  3U3I A;  2X67 A;  2YMD A;  2J47 A;  2CCQ A;  4HWD A;  5LYJ E;  4B6X A;  4U72 A;  2CXD A;  3P8C D;  3ETU A;  5LCY A;  2DLR A;  3WTO A;  3L3P A;  2RA1 A;  3N2G E;  3N9M A;  4DV1 T;  2E5L T;  2AXD S;  1WR6 A;  2KSR A;  3ANW A;  4AQY T;  3OKQ A;  4WV9 A;  4X62 T;  3IEE A;  1MMD A;  2ZM2 A;  2Q9Q B;  4XBF B;  3FXD B;  1XDP A;  4LF9 T;  3CK6 A;  5HCM A;  1FEW A;  4C91 A;  3TLW A;  5L3C B;  2QA7 A;  4ALX A;  4Z90 A;  2Q9Q C;  4PAG A;  4IE7 A;  4JI4 T;  1SHZ C;  2WDV A;  3K1S A;  5AQS B;  1N33 T;  2HPL A;  1HR0 T;  1YKE B;  5FYM A;  5AQP B;  4QAC A;  1OWA A;  1HFA A;  3LG7 A;  4O4J E;  3ZKR A;  3B13 A;  5L3D B;  3BK9 A;  5FL0 A;  3ZMS B;  4X5T A;  3Q5X A;  5IHY A;  2DHR A;  4COF A;  5ABF A;  2XHE B;  5JDF A;  2DCF A;  3S4U A;  3RHW A;  5KZU A;  5CO5 A;  5JDM A;  4E7Z A;  4NXN T;  4TWH A;  3PDY A;  2BYN A;  2WDQ A;  4FRR A;  2Y6X A;  4EZH A;  2CWY A;  2WN9 A;  3PU8 A;  4GKJ T;  4QX7 B;  3LSV A;  4P1N A;  3AEA A;  2NW8 A;  5GON E;  1T8B A;  5EZY E;  4ILC A;  1MMA A;  1J5W A;  4G63 A;  3KV5 A;  1FMW A;  3AA0 B;  5LJN A;  2BG9 A;  1DU2 A;  4O2A E;  3UQ7 A;  2WMO A;  2J1D G;  3DTO A;  5EK4 A;  3WTK A;  3FZK B;  3M65 A;  4AKG A;  4ZHQ E;  2E8I A;  4KMC A;  4H9P C;  5AQT B;  2YDS A;  4TV8 E;  4WZX A;  2H7V C;  5HEO A;  2WMN A;  3ZYM A;  1HCI A;  4DV0 T;  5BW2 A;  2ZMA A;  4ILB A;  3GUA A;  2C5I T;  4LFA T;  3ZEF B;  3AE7 A;  2C5K T;  5J1G A;  5JDL A;  2IDO B;  4B3M T;  2LSJ A;  3FBZ A;  4IDP A;  3P4Q A;  2JMH A;  1XNQ T;  1XZY A;  3ETV A;  3RI5 A;  4JEH B;  4E7S A;  2V26 A;  4F8H A;  2XQ7 A;  3VKH A;  3UTK A;  5L4H A;  2XZE A;  2KWI B;  1WLX A;  5HEU A;  4IDO A;  4PJJ A;  1UGO A;  2H89 A;  2WNJ A;  4BA9 A;  1W0A A;  4TWF A;  2HH7 A;  4MLK A;  3KVA A;  2RPA A;  2Y56 A;  5HAX A;  2WAU A;  1YW0 A;  4WYV A;  1N32 T;  4H63 V;  3UUM A;  2VQE T;  4LFB T;  4JI2 T;  3ZST A;  4HE8 A;  2IC6 A;  4P09 A;  4UF0 B;  2NW9 A;  5HXE A;  3MJX A;  5AFU L;  2WWV A;  1VRB A;  3AA7 B;  2IIU A;  4HN9 A;  5JRC A;  4UVA B;  4Z91 A;  3CQC B;  5BMV E;  1HS7 A;  5LGT B;  2LT3 A;  4IL4 A;  2WM9 A;  5J5I A;  2W63 A;  4DMW A;  2CBI A;  4QH1 A;  1MNE A;  4AFG A;  4YTN A;  2BG9 E;  5ETW A;  5M4Y A;  4B3R T;  4ZR6 A;  4D01 A;  3NZP A;  2CXF A;  1UUR A;  3AXJ B;  4DBM A;  3QNU A;  1IAP A;  4BAY B;  2WWU A;  3TLU A;  4IE0 A;  3VHL A;  1X79 A;  1HNW T;  2LOS A;  5LGN B;  4TZ4 C;  4ZRU A;  4B3T T;  4CI1 B;  2KXP B;  2ZJV A;  5LJM A;  4PIR A;  2HHH T;  3ESL A;  2HN2 A;  3RYH E;  2UUA T;  2F4V T;  4BFQ A;  2WCA A;  1J5E T;  2E9X A;  2VKJ A;  4EYU A;  1MIY A;  4QAA A;  5DQV A;  3KV6 A;  3WTI A;  5J2T E;  4A97 A;  4IDN A;  1HX8 A;  3MZK B;  4EZ4 A;  2X51 A;  3O4X E;  3Q5W A;  3LK2 B;  5J2U E;  3OPC A;  4O4I E;  3HKD E;  5AFJ A;  4QXH B;  4NIQ A;  2JJ9 A;  2V6Y A;  5CGM A;  5LMU T;  1UW6 A;  2BYR A;  1MMG A;  2W2U A;  5ABF B;  2I6H A;  3W15 B;  3KBU A;  2A2F X;  3C4Z A;  2XAG B;  3ONX A;  4DV7 T;  2JRK A;  4EAH A;  5LXT E;  2X68 A;  3O1H A;  4QKN A;  3LBX B;  3BQL A;  1ZP0 A;  4KHZ F;  2IAK A;  2XAS B;  3SQ9 A;  2MAW A;  4CI3 B;  2YOE A;  3ZJ2 A;  3UFG A;  1WRD A;  2MTQ A;  2WNL A;  2OA5 A;  2BS4 A;  5IYZ E;  4CN1 A;  2YU1 A;  3UU4 A;  3AXJ A;  1SUM B;  1Y64 B;  3PUG A;  1UX2 A;  1SA0 E;  1H7C A;  4UIG A;  3HR0 A;  1WYC A;  2KZ7 B;  3P4P A;  2V7I A;  2VVS A;  1V9D A;  4X1Y E;  3VRA A;  3AEE A;  2X00 A;  3ZJ1 A;  3ZSS A;  4IL9 A;  3DJB A;  3F31 A;  3C4X A;  4KX6 A;  4EB6 E;  5FXZ A;  4JI3 T;  1QUU A;  3EVY A;  3CKD A;  4A56 A;  3WTM A;  1IBM T;  4GYS A;  3WTJ A;  2HPJ A;  4MHC A;  1QSD A;  3OJA A;  5LXB A;  4DUY T;  3LK4 2;  2B76 A;  3RKO A;  4AKL A;  5H6Q B;  3AAI A;  2W66 A;  3SH1 A;  1M62 A;  2WQY A;  2XZ5 A;  2D0T A;  2Q9Q A;  5LA6 E;  4GOU A;  3CQG B;  1YXR A;  5HXR A;  4OX9 T;  5FJV A;  3C4W A;  3CX8 B;  3AEB A;  4DV3 T;  4H9N C;  3VKG A;  4NZB A;  3LDQ B;  3U8J A;  1MND A;  2A3D A;  1UK5 A;  3PUZ F;  4TV9 E;  4OFZ A;  3A8Y C;  4ZS2 A;  4IST A;  2XAQ B;  2LE8 A;  3V5S A;  2BYQ A;  3P4W A;  2V5C A;  4FJO A;  5CA0 E;  3ZDG A;  5HEG A;  2C9T A;  3AB3 B;  3UUB A;  3RH3 A;  4A5X A;  5LMN T;  4KI0 F;  3H3M A;  3WTN A;  3ZPO A;  4PJM A;  5L47 A;  2XZ6 A;  2YEV C;  4AQF A;  5ABH A;  4TNW A;  4EED A;  2ZJU A;  2FUP A;  1I94 T;  3T1H T;  3BQI A;  2DWG A;  1HNX T;  4ZXL A;  3AEF A;  4AXP A;  1U5P A;  2MPK A;  2D0U A;  3UU6 A;  4ZI2 D;  1U4Q A;  5AQF B;  3NZQ A;  3AE4 A;  2WU2 A;  2PH9 A;  2LHR A;  4AFH A;  4X64 T;  3EUH A;  2JIW A;  5AFK A;  1KNR A;  2LKG A;  3PUV F;  4IRE A;  2WDR A;  5JRE A;  5HXH A;  3K3N A;  4IDZ A;  5L3E B;  3VR8 A;  1HX1 B;  2CHO A;  2WY2 A;  4H9O C;  3EDU A;  4L5G A;  1QLB A;  5AQN B;  2K9A A;  4QWN B;  1I6Z A;  4JI1 T;  1XDO A;  3CVR A;  5CJ5 A;  4ZEY A;  4I55 E;  3VR9 A;  2FJE A;  2LSI A;  2UZ6 A;  3FZM B;  4K0K T;  3RIA A;  2E9X B;  2N1G A;  3ZMU B;  2D5U A;  1R8I A;  5FKY A;  5ABG A;  3SFE A;  4ZI3 D;  2QYW A;  1OED E;  3AAA B;  2NOX A;  2XQ5 A;  3KV9 A;  4PFP A;  3AVS A;  5LBQ B;  4U3C A;  2K24 A;  5J5G A;  2UXX B;  3ZN0 B;  2CWO A;  4WBO A;  5TVC A;  1W9R A;  3L39 A;  4ANJ A;  2NW7 A;  3PUR A;  2NR4 A;  2ZM0 A;  4KBM B;  4G2A A;  3CWZ B;  2V7M A;  1CUN A;  4QX8 B;  3EHZ A;  2L9Q A;  3F2E A;  3WAK A;  4U74 A;  5AQL B;  2V5D A;  1HNZ T;  5HEJ A;  4DV4 T;  3J7Y q;  4HWH A;  3A5X A;  2EHO A;  1W0B A;  3SIO A;  4O4H E;  3C51 A;  1T98 A;  3OVU A;  2NTX A;  3RIU A;  4PJL A;  5BP0 A;  3NRY A;  5CFB A;  5JDQ A;  4ERR A;  2GK9 A;  5TAO A;  4PK4 A;  1XWM A;  2H3R A;  2VVN A;  3Q9D A;  3AE8 A;  3QB5 K;  3SS1 A;  4YSX A;  2XQ8 A;  4IE6 A;  3RQU A;  4EEB A;  4BJN A;  3PV0 F;  4LF5 T;  2YDR A;  4UXU A;  1G8X A;  2V7J A;  4TWD A;  4GK0 E;  3RX6 A;  5LP6 E;  2E5V A;  1FMV A;  2KIN B;  5J5H A;  1MMN A;  1AJ3 A;  3P50 A;  5DAB A;  5L3G B;  1YD8 G;  4PK6 A;  1KF6 A;  1G73 A;  2C5J A;  4HKA A;  2WB5 A;  3MK7 C;  5AQR B;  1BR4 A;  3JC6 D;  2P9B A;  4UV9 B;  3ZCJ A;  1D1A A;  2QVA A;  2FBW A;  2CXL A;  2IML A;  5JDH A;  3F57 A;  3PTR B;  1KK7 A;  5FL1 A;  2Y58 A;  4IDQ A;  3U8K A;  3E08 A;  2JQ9 A;  4AFT A;  4CXY A;  4P0A A;  3ZMT B;  1E1H B;  1FIO A;  5F8P A;  2X0H A;  3NWI A;  4ZJS A;  4DR4 T;  5F5W A;  5AIN A;  3K3O A;  3CX6 B;  2XNT A;  2XUE A;  3N9L A;  2YKS A;  3P7I A;  2VKO A;  4UVB B;  3WIP A;  3U78 A;  2CE7 A;  3AAE B;  1UUS A;  2BDE A;  2X00 D;  4IGU A;  3RQW A;  3ZLI A;  3AVR A;  5KX5 E;  4WW0 A;  4IIJ E;  4ZS3 A;  5JR9 C;  4JUY A;  3L8R A;  2XQ3 A;  1WR0 A;  2XQY A;  3U8L A;  2W61 A;  4GYR A;  4DVD A;  3PUX F;  4DR2 T;  3SFD A;  2NP9 A;  5AQI B;  4QHO A;  2OV9 A;  2J4G A;  4AIS A;  2X0L B;  2XNV A;  3ZT5 A;  5C2T A;  4WNK A;  2X0Y A;  4YSY A;  1VCS A;  4DID B;  3PJA J;  2CA5 A;  2BS3 A;  4Z8X A;  3SWH A;  2UXD T;  3ZN1 B;  2RP4 A;  3UUN A;  2K48 A;  4K0U A;  2VL0 A;  4AKI A;  2WZI A;  2LM2 A;  2D9D A;  4U7Y A;  4YFS A;  4UY2 A;  4ADZ A;  3I0O A;  2CM0 A;  4EOZ B;  2UUB T;  3QK6 A;  4LML A;  3MKD A;  5IUX A;  3FHN A;  3AEG A;  2XQ4 A;  4HWI B;  3GMI A;  4AQG A;  1LVK A;  3N2O A;  1OED C;  3I1A A;  3X1D A;  3CML A;  2N9D A;  2FJD A;  1W09 A;  2KT9 A;  5AQQ B;  3UQ4 A;  4UEL A;  4UVC B;  3L09 A;  4I50 E;  3AA6 B;  2IUB A;  5CB4 E;  3KFW X;  3TLS A;  3AE2 A;  3HI2 A;  4QH4 A;  5JME A;  1ZOY A;  3N9N A;  4QAB A;  2V7K A;  4JI5 T;  3AED A;  2W67 A;  4LF7 T;  3ANW B;  3OYZ A;  3K3Q C;  1HG5 A;  3NKZ A;  5HCJ A;  5HWY A;  4PW8 A;  3NRX A;  2BKN A;  5AQG B;  3EAB A;  4UM3 A;  3J9X 1;  2WSS V;  5F3J A;  4DR1 T;  2UXC T;  4LMK A;  2VL8 A;  2IW5 B;  3RLF F;  2YDQ A;  3PMZ A;  2X9X A;  4MFR A;  2OLT A;  2N2N A;  5LHG B;  2V7L A;  5KMG P;  5DJQ C;  2YU2 A;  4PNI A;  3WI3 A;  4EGW A;  3N9Q A;  2KLQ A;  4UM3 P;  3FXE B;  1NEK A;  3U8M A;  4DV5 T;  4HFD A;  3AE9 A;  4DR7 T;  5FXV A;  3A7M A;  2EHO C;  5AQM B;  4DV6 T;  2LSY A;  1YQ3 A;  4TNV A;  1KFY A;  3OTO T;  2V6X A;  4X66 T;  4QXC B;  3RYC E;  2W62 A;  5HWX A;  1EZ3 A;  4ZJT A;  5BR8 T;  2JQQ A;  1D1C A;  4AKR B;  1M7K A;  2Z6E A;  1I9B A;  3LK3 B;  1VCT A;  3JC6 C;  4EYY R;  4KP3 C;  2Y48 B;  4UM3 S;  3PEO A;  4XHE A;  3PUS A;  1CHU A;  2YN6 A;  3HKB E;  4O4L E;  4H9R C;  3G06 A;  2UXB T;  3UT5 E;  2LSG A;  4LF6 T;  4O2B E;  4HEA A;  2BR8 A;  4BQT A;  3U8N A;  3P4R A;  5FXX A;  4XZC A;  3E0Z A;  1OED A;  4O8S A;  2MYS A;  5LHI B;  2VKH A;  2XAH B;  2NTY A;  2BKP A;  2JPF A;  4JLE A;  2BYP A;  1WCR A;  4YSZ A;  4YHJ A;  4JI0 T;  3FBL A;  3FB2 A;  3JAD A;  4HFE A;  3AEC A;  4EIW A;  1GQE A;  3RYF E;  2W00 A;  5HXC A;  5EK2 A;  2ODU A;  2VUR A;  2UU9 T;  4I0U A;  3I0Q A;  3I9W A;  4FI5 A;  5JH7 E;  3HKE E;  1XNR T;  4HWC A;  3O1J A;  3RIU C;  2WZY A;  2XAF B;  2WBL A;  2FJA A;  4UXN B;  1FJG T;  3GN5 B;  1MIV A;  4H9Q C;  1D0X A;  5LHH B;  2BYS A;  4YTM A;  1MIW A;  3ZYL A;  5LGU B;  5AFM A;  5A1L A;  4DR3 T;  1VOM A;  3UUX B;  2R6G F;  5FY1 A;  1IBK T;  2C0S A;  5JVD E;  2XSB A;  2WNC A;  4N78 D;  5BRX A;  4DR6 T;  1IJ5 A;  2D2S A;  5L4E A;  2AE9 A;  5JR9 A;  2CLY B;  5KXJ A;  3MAC A;  3OBV E;  5AQH B;  3RKG A;  2BJ0 A;  1O3X A;  3CX7 B;  5LBM A;  4U7I A;  1J1J A;  3V5U A;  1UV6 A;  1D0Y A;  2X9W A;  4L0R A;  2I59 A;  4H9S E;  1BR2 A;  4IT4 A;  4IHJ E;  2G0U A;  3GWH A;  5KE4 A;  2BKO A;  1Z8U A;  4YTP A;  1NEN A;  4IE5 A;  4DND A;  3AE1 A;  4J2C A;  4NUV A;  2XQ6 A;  2PG8 A;  5JDG A;  4LFC T;  2WP9 A;  4M1P A;  2VWA A;  3M3Z B;  3B5M A;  3N9O A;  2LKH A;  3B57 A;  2UUC T;  1B7T A;  3UFE A;  3O9X A;  4B3S T;  4CN4 A;  4F6R C;  3QB5 A;  3CIR A;  2CRB A;  3C84 A;  4TX5 A;  2W4X A;  3N5L A;  3RC8 A;  1ZEE A;  4JBW F;  2XNU A;  1YQ4 A;  3PUW F;  2MBG A;  5JR9 B;  4LF4 T;  3KBT A;  2XM2 A;  3SOL A;  2LJL A;  3ZT6 A;  2YIN A;  4KHP T;  4DUZ T;  3RGL A;  5SYO A;  2MOZ A;  1D1B A;  5AFH A;  2Y57 A;  4B5D A;  3FZF B;  2Q9Q D;  4GK5 E;  3WTH A;  1NWM X;  3RPU A;  3H37 A;  5AQJ B;  4ZI2 C;  3R84 B;  3ZDH A;  3GA8 A;  3LFM A;  5KDM C;  4ZOL E;  2KMF A;  3GN5 A;  4ILU A;  5AQU B;  3ZYK A;  2BG9 C;  3JAF A;  5AQK B;  2CBJ A;  3ZCI A;  3AE3 A;  2VK9 A;  3Q5E A;  3PUY F;  4AQF C;  1SE7 A;  3QUJ A;  3C50 A;  3ONL C;  3PUQ A;  1HF8 A;  5AQV B;  4U33 A;  5FP3 A;  2BG9 B;  1UX4 A;  4JEU B;  5FVL A;  5LOV E;  2BVL A;  4DMV A;  4UM1 A;  4HTE A;  1XMO T;  4JYA T;  2H88 A;  3ZC1 A;  1BR1 A;  2ODV A;  4AKH A;  2LM9 A;  3RIF A;  3TLV A;  3D0T A;  3Q5D A;  2H7O A;  2XYS A;  2JMK A;  2ZM8 A;  2PJQ A;  2V8S V;  5L3F B;  2FJB A;  3HA4 A;  2CHN A;  2JQH A;  1UCU A;  3MA9 A;  1OED B;  5L3B B;  2XTL A;  3RYI E;  3OYX A;  4ZZB A;  1KNP A;  3ONJ A;  2M67 A;  2WZH A;  2DWK A;  3IHR A;  4TN7 B;  5FY0 A;  3HL6 A;  3IA3 A;  5HXS A;  3KVB A;  1D0Z A;  3ZT7 A;  1LVF A;  3VU7 H;  4PK5 A;  4ZI3 C;  3UU5 A;  4HGA A;  3R6N A;  2XQA A;  2W0G A;  4HWF A;  4WBN E;  2IC9 A;  3T8O A;  3N9P A;  1L0V A;  1OXZ A;  2XPK A;  3RF1 A;  4I4T E;  2Y54 A;  2DL1 A;  3Q2M A;  4YJ2 E;  4Q25 A;  4MAL A;  4BJM A;  4GKK T;  2VB6 A;  1US7 B;  4HFB A;  5IWA T;  2DNX A;  2PFV A;  3JAE A;  2LOP A;  3KV4 A;  3QC9 A;  1N34 T;  4V1A v;  5LNK A;  4HFV A;  1WFD A;  2I0M A;  2X9H A;  2BZB A;  4YLH A;  2V6Y B;  3FZH B;  4PJN A;  2QC1 B;  1IBL T;  4MBQ A;  1Y01 A;  3C64 A;  3AA1 B;  4XK9 A;  2K5B B;  2PTF A;  4ZZC A;  2BS2 A;  1NAF A;  3JCF A;  2EHO B;  5CA1 E;  4TUY E;  1WYB A;  2DI4 A;  3T4M A;  3ABV A;  2XM1 A;  1T7S A;  1JNZ A;  4NUU A;  4U2Y A;  2EHO D;  5FMN A;  3N2K E;  1LRZ A;  4AIU A;  1N36 T;  5EK3 A;  4UR9 A;  2KND A;  5C3J A;  2JQK A;  4XAX B;  4EV6 A;  4DBQ A;  3C79 A;  2W8G A;  1ZHC A;  3ZC0 A;  5L2L A;  2CMR A;  4GIW A;  3UU3 A;  2LSK A;  2XAJ B;  4YJ3 E;  4A98 A;  2XQ9 A;  5E0O A;  5JRC B;  1YKH B; 
#chains in the Genus database with same CATH homology
 4FRR A;  3UU6 A;  2Y56 A;  2BR8 A;  4BQT A;  3U8N A;  5J5H A;  5TVC A;  3P50 A;  4HFB A;  2WN9 A;  1OED A;  5AFN A;  2BG9 C;  3JAF A;  4NPP A;  5AFM B;  5AFJ A;  4QH5 A;  4ILA A;  1UV6 A;  2PH9 A;  5HCJ A;  2XNV A;  3SH1 A;  3WTL A;  3LSV A;  5HEH A;  3JAE A;  4AFH A;  2XZ5 A;  4HFI A;  1UW6 A;  2BYR A;  2YMD A;  4ILC A;  2M6I A;  5AFL A;  4UM3 A;  2BG9 A;  2LLY A;  2BYP A;  2BG9 B;  3UQ7 A;  5KE4 A;  3WTO A;  3JAD A;  5FJV A;  4LMK A;  4Z91 A;  4HFE A;  2VL0 A;  5AFK A;  2LKG A;  3WTK A;  3PMZ A;  2LM2 A;  4HFH A;  4IL4 A;  3EHZ A;  4UM1 A;  4EZ1 A;  4IRE A;  4HQP A;  2KSR A;  2QC1 B;  5J5I A;  2M6B A;  2XQ6 A;  4UY2 A;  4NZB A;  4WV9 A;  3U8J A;  4QH1 A;  2Y58 A;  4AFG A;  2PGZ A;  3RIF A;  3SQ9 A;  3TLV A;  3U8K A;  3IGQ A;  4XK9 A;  5HEO A;  2MAW A;  2LKH A;  5HEJ A;  2BG9 E;  4ZZC A;  2YOE A;  4ZK4 A;  4AFT A;  2XYS A;  5LG3 A;  4LML A;  5BW2 A;  4ZK1 A;  5IUX A;  2WZY A;  3UU8 A;  2BR7 A;  2BYQ A;  4ILB A;  3GUA A;  4UM3 P;  3P4W A;  5HCM A;  3T4M A;  4ZR6 A;  4D01 A;  2WNL A;  2XQ4 A;  3TLW A;  1OED B;  3U8M A;  3SIO A;  4HFD A;  4ZJS A;  3UU4 A;  5J0Z A;  3ZDG A;  4DBM A;  4ALX A;  4Z90 A;  3C84 A;  5J5F A;  5HEG A;  3TLT A;  2C9T A;  2XYT A;  5AIN A;  4ZZB A;  3SQ6 A;  1UX2 A;  3UUB A;  4TNV A;  4HFC A;  2BYS A;  2XNT A;  2W8F A;  3TLU A;  5BP0 A;  2YKS A;  3WTN A;  3EAM A;  2XNU A;  5AFM A;  1OED C;  2YME A;  5CFB A;  3WIP A;  4QAC A;  5L47 A;  2UZ6 A;  2XZ6 A;  4ZRU A;  2Y7Y A;  2X00 D;  3RQW A;  3ZKR A;  3RI5 A;  3RIA A;  3UQ4 A;  4ZJT A;  2ZJV A;  2X00 A;  4TNW A;  4F8H A;  4PIR A;  4X5T A;  3C79 A;  4COF A;  2XQ7 A;  2W8G A;  5SYO A;  1I9B A;  2WNC A;  3UU5 A;  1OED E;  4IL9 A;  2ZJU A;  4BFQ A;  5AFH A;  5L4H A;  2XQ8 A;  2Y57 A;  4B5D A;  5BRX A;  3RQU A;  5HEU A;  2XQA A;  3RHW A;  3UU3 A;  3WTH A;  4QAA A;  5KZU A;  4UM3 S;  3PEO A;  4XHE A;  5CO5 A;  2XQ5 A;  3TLS A;  4A98 A;  2XQ9 A;  2XQ3 A;  2YN6 A;  5L4E A;  3WTI A;  2WNJ A;  4TWH A;  4TWF A;  4QH4 A;  4UXU A;  3U8L A;  3ZDH A;  4A97 A;  3WTM A;  4TWD A;  3WTJ A;  5J5G A;  3EI0 A;  5JME A;  2BYN A;  2Y54 A;  4QAB A;  2BJ0 A;  4LMJ A;  5LXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...