5AINA

Varenicline interactions at the 5ht3 receptor ligand binding site are revealed by 5htbp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYERQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYESTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCALTFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serotonin binding protein
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Varenicline Interactions at the 5-Ht3 Receptor Ligand Binding Site are Revealed by 5-Htbp.
pubmed doi rcsb
source organism Aplysia californica
total genus 50
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5ainA00
4ILBA 2BG9C 3SIOA 3UU3A 5AFMA 3UU6A 4LMJA 5SYOA 3RI5A 2XQ4A 3U8KA 2Y7YA 5HEJA 4NZBA 2UZ6A 4BQTA 5HEGA 3EI0A 2Y54A 2BG9B 3WTHA 2XYSA 3TLWA 4ZZCA 4TWFA 4HQPA 2BJ0A 5AFKA 3WTMA 4HFBA 4NPPA 3U8LA 5J5IA 3PEOA 3WTKA 4PIRA 3RHWA 3UUBA 4AFTA 4EZ1A 4HFEA 2Y56A 3PMZA 2WZYA 4ALXA 4LMLA 2W8FA 3WTOA 3U8MA 3RQWA 5HCMA 3P4WA 5HEOA 4UM3A 3P50A 4HFDA 2BYSA 4ZZBA 5BRXA 2WN9A 2VL0A 3IGQA 1UV6A 3TLVA 5CO5A 4F8HA 2XQ5A 5L4HA 2BG9A 2XQAA 3EHZA 2XQ6A 4IL4A 5BP0A 4QABA 5JMEA 4IREA 3JADA 3TLTA 3UU4A 5IUXA 3ZKRA 4TWDA 5CFBA 5J0ZA 2BYRA 3WTIA 2X00A 4UM3P 5LG3A 4BFQA 4X5TA 4D01A 5J5HA 4ZR6A 3RQUA 4IL9A 4Z91A 4COFA 5AFHA 4ZK1A 2BG9E 3SH1A 5LXBA 4HFIA 4ZRUA 2XQ9A 5AFNA 2Y57A 1UW6A 2WNJA 5TVCA 3TLUA 4XHEA 3WTLA 4AFGA 3EAMA 2BYQA 4ZJSA 5HCJA 4ILAA 2BR7A 4HFHA 4ZJTA 5AFJA 2X00D 4TNWA 4WV9A 4DBMA 4FRRA 5L4EA 4ZK4A 3TLSA 3UU8A 2YKSA 4QH4A 4XK9A 5HEHA 4A98A 4LMKA 5HEUA 5BW2A 1I9BA 5J5GA 5L47A 4UY2A 5AFLA 3C79A 2BYPA 4HFCA 2ZJUA 3UQ7A 4TWHA 2YN6A 4ILCA 2YOEA 3ZDGA 3C84A 4UM1A 2WNCA 2XQ3A 2XZ5A 2XNVA 2YMDA 4A97A 4B5DA 3WIPA 5J5FA 3RIAA 2YMEA 2QC1B 3RIFA 3WTNA 3JAEA 2XNTA 3ZDHA 3WTJA 2PGZA 5AFMB 3UQ4A 3JAFA 4QAAA 3UU5A 2XZ6A 4QH5A 2XNUA 4QACA 3T4MA 4AFHA 2C9TA 3SQ9A 2W8GA 5KE4A 2PH9A 5AINA 4UM3S 2WNLA 2XQ7A 3LSVA 3U8NA 3U8JA 2XQ8A 2XYTA 4UXUA 4QH1A 3SQ6A 2BR8A 5FJVA 1UX2A 2BYNA 5KZUA 3GUAA 4Z90A 4TNVA 2ZJVA 2Y58A
chains in the Genus database with same CATH superfamily
4ILBA 2BG9C 3SIOA 3UU3A 5AFMA 3UU6A 4LMJA 5SYOA 3RI5A 2XQ4A 3U8KA 2Y7YA 5HEJA 4NZBA 2UZ6A 4BQTA 5HEGA 3EI0A 2Y54A 2BG9B 3WTHA 2XYSA 3TLWA 4ZZCA 4TWFA 4HQPA 2BJ0A 5AFKA 3WTMA 4HFBA 4NPPA 3U8LA 5J5IA 3PEOA 3WTKA 4PIRA 3RHWA 3UUBA 4AFTA 4EZ1A 4HFEA 2Y56A 3PMZA 2WZYA 4ALXA 4LMLA 2W8FA 3WTOA 3U8MA 3RQWA 5HCMA 3P4WA 5HEOA 4UM3A 3P50A 4HFDA 2BYSA 4ZZBA 5BRXA 2WN9A 2VL0A 3IGQA 1UV6A 3TLVA 5CO5A 4F8HA 2XQ5A 5L4HA 2BG9A 2XQAA 3EHZA 2XQ6A 4IL4A 5BP0A 4QABA 5JMEA 4IREA 3JADA 3TLTA 3UU4A 5IUXA 3ZKRA 4TWDA 5CFBA 5J0ZA 2BYRA 3WTIA 2X00A 4UM3P 5LG3A 4BFQA 4X5TA 4D01A 5J5HA 4ZR6A 3RQUA 4IL9A 4Z91A 4COFA 5AFHA 4ZK1A 2BG9E 3SH1A 5LXBA 4HFIA 4ZRUA 2XQ9A 5AFNA 2Y57A 1UW6A 2WNJA 5TVCA 3TLUA 4XHEA 3WTLA 4AFGA 3EAMA 2BYQA 4ZJSA 5HCJA 4ILAA 2BR7A 4HFHA 4ZJTA 5AFJA 2X00D 4TNWA 4WV9A 4DBMA 4FRRA 5L4EA 4ZK4A 3TLSA 3UU8A 2YKSA 4QH4A 4XK9A 5HEHA 4A98A 4LMKA 5HEUA 5BW2A 1I9BA 5J5GA 5L47A 4UY2A 5AFLA 3C79A 2BYPA 4HFCA 2ZJUA 3UQ7A 4TWHA 2YN6A 4ILCA 2YOEA 3ZDGA 3C84A 4UM1A 2WNCA 2XQ3A 2XZ5A 2XNVA 2YMDA 4A97A 4B5DA 3WIPA 5J5FA 3RIAA 2YMEA 2QC1B 3RIFA 3WTNA 3JAEA 2XNTA 3ZDHA 3WTJA 2PGZA 5AFMB 3UQ4A 3JAFA 4QAAA 3UU5A 2XZ6A 4QH5A 2XNUA 4QACA 3T4MA 4AFHA 2C9TA 3SQ9A 2W8GA 5KE4A 2PH9A 5AINA 4UM3S 2WNLA 2XQ7A 3LSVA 3U8NA 3U8JA 2XQ8A 2XYTA 4UXUA 4QH1A 3SQ6A 2BR8A 5FJVA 1UX2A 2BYNA 5KZUA 3GUAA 4Z90A 4TNVA 2ZJVA 2Y58A
chains in the Genus database with same CATH topology
4ILBA 2BG9C 3SIOA 3UU3A 5AFMA 3UU6A 4LMJA 5SYOA 3RI5A 2XQ4A 3U8KA 2Y7YA 5HEJA 4NZBA 2UZ6A 4BQTA 5HEGA 3EI0A 2Y54A 2BG9B 3WTHA 2XYSA 3TLWA 4ZZCA 4TWFA 4HQPA 2BJ0A 5AFKA 3WTMA 4HFBA 4NPPA 3U8LA 5J5IA 3PEOA 3WTKA 4PIRA 3RHWA 3UUBA 4AFTA 4EZ1A 4HFEA 2Y56A 3PMZA 2WZYA 4ALXA 4LMLA 2W8FA 3WTOA 3U8MA 3RQWA 5HCMA 3P4WA 5HEOA 4UM3A 3P50A 4HFDA 2BYSA 4ZZBA 5BRXA 2WN9A 2VL0A 3IGQA 1UV6A 3TLVA 5CO5A 4F8HA 2XQ5A 5L4HA 2BG9A 2XQAA 3EHZA 2XQ6A 4IL4A 5BP0A 4QABA 5JMEA 4IREA 3JADA 3TLTA 3UU4A 5IUXA 3ZKRA 4TWDA 5CFBA 5J0ZA 2BYRA 3WTIA 2X00A 4UM3P 5LG3A 4BFQA 4X5TA 4D01A 5J5HA 4ZR6A 3RQUA 4IL9A 4Z91A 4COFA 5AFHA 4ZK1A 2BG9E 3SH1A 5LXBA 4HFIA 4ZRUA 2XQ9A 5AFNA 2Y57A 1UW6A 2WNJA 5TVCA 3TLUA 4XHEA 3WTLA 4AFGA 3EAMA 2BYQA 4ZJSA 5HCJA 4ILAA 2BR7A 4HFHA 4ZJTA 5AFJA 2X00D 4TNWA 4WV9A 4DBMA 4FRRA 5L4EA 4ZK4A 3TLSA 3UU8A 2YKSA 4QH4A 4XK9A 5HEHA 4A98A 4LMKA 5HEUA 5BW2A 1I9BA 5J5GA 5L47A 4UY2A 5AFLA 3C79A 2BYPA 4HFCA 2ZJUA 3UQ7A 4TWHA 2YN6A 4ILCA 2YOEA 3ZDGA 3C84A 4UM1A 2WNCA 2XQ3A 2XZ5A 2XNVA 2YMDA 4A97A 4B5DA 3WIPA 5J5FA 3RIAA 2YMEA 2QC1B 3RIFA 3WTNA 3JAEA 2XNTA 3ZDHA 3WTJA 2PGZA 5AFMB 3UQ4A 3JAFA 4QAAA 3UU5A 2XZ6A 4QH5A 2XNUA 4QACA 3T4MA 4AFHA 2C9TA 3SQ9A 2W8GA 5KE4A 2PH9A 5AINA 4UM3S 2WNLA 2XQ7A 3LSVA 3U8NA 3U8JA 2XQ8A 2XYTA 4UXUA 4QH1A 3SQ6A 2BR8A 5FJVA 1UX2A 2BYNA 5KZUA 3GUAA 4Z90A 4TNVA 2ZJVA 2Y58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILB A;  2BG9 C;  3SIO A;  3UU3 A;  5AFM A;  3UU6 A;  4LMJ A;  5SYO A;  3RI5 A;  2XQ4 A;  3U8K A;  2Y7Y A;  5HEJ A;  4NZB A;  2UZ6 A;  4BQT A;  5HEG A;  3EI0 A;  2Y54 A;  2BG9 B;  3WTH A;  2XYS A;  3TLW A;  4ZZC A;  4TWF A;  4HQP A;  2BJ0 A;  5AFK A;  3WTM A;  4HFB A;  4NPP A;  3U8L A;  5J5I A;  3PEO A;  3WTK A;  4PIR A;  3RHW A;  3UUB A;  4AFT A;  4EZ1 A;  4HFE A;  2Y56 A;  3PMZ A;  2WZY A;  4ALX A;  4LML A;  2W8F A;  3WTO A;  3U8M A;  3RQW A;  5HCM A;  3P4W A;  5HEO A;  4UM3 A;  3P50 A;  4HFD A;  2BYS A;  4ZZB A;  5BRX A;  2WN9 A;  2VL0 A;  3IGQ A;  1UV6 A;  3TLV A;  5CO5 A;  4F8H A;  2XQ5 A;  5L4H A;  2BG9 A;  2XQA A;  3EHZ A;  2XQ6 A;  4IL4 A;  5BP0 A;  4QAB A;  5JME A;  4IRE A;  3JAD A;  3TLT A;  3UU4 A;  5IUX A;  3ZKR A;  4TWD A;  5CFB A;  5J0Z A;  2BYR A;  3WTI A;  2X00 A;  4UM3 P;  5LG3 A;  4BFQ A;  4X5T A;  4D01 A;  5J5H A;  4ZR6 A;  3RQU A;  4IL9 A;  4Z91 A;  4COF A;  5AFH A;  4ZK1 A;  2BG9 E;  3SH1 A;  5LXB A;  4HFI A;  4ZRU A;  2XQ9 A;  5AFN A;  2Y57 A;  1UW6 A;  2WNJ A;  5TVC A;  3TLU A;  4XHE A;  3WTL A;  4AFG A;  3EAM A;  2BYQ A;  4ZJS A;  5HCJ A;  4ILA A;  2BR7 A;  4HFH A;  4ZJT A;  5AFJ A;  2X00 D;  4TNW A;  4WV9 A;  4DBM A;  4FRR A;  5L4E A;  4ZK4 A;  3TLS A;  3UU8 A;  2YKS A;  4QH4 A;  4XK9 A;  5HEH A;  4A98 A;  4LMK A;  5HEU A;  5BW2 A;  1I9B A;  5J5G A;  5L47 A;  4UY2 A;  5AFL A;  3C79 A;  2BYP A;  4HFC A;  2ZJU A;  3UQ7 A;  4TWH A;  2YN6 A;  4ILC A;  2YOE A;  3ZDG A;  3C84 A;  4UM1 A;  2WNC A;  2XQ3 A;  2XZ5 A;  2XNV A;  2YMD A;  4A97 A;  4B5D A;  3WIP A;  5J5F A;  3RIA A;  2YME A;  2QC1 B;  3RIF A;  3WTN A;  3JAE A;  2XNT A;  3ZDH A;  3WTJ A;  2PGZ A;  5AFM B;  3UQ4 A;  3JAF A;  4QAA A;  3UU5 A;  2XZ6 A;  4QH5 A;  2XNU A;  4QAC A;  3T4M A;  4AFH A;  2C9T A;  3SQ9 A;  2W8G A;  5KE4 A;  2PH9 A;  5AIN A;  4UM3 S;  2WNL A;  2XQ7 A;  3LSV A;  3U8N A;  3U8J A;  2XQ8 A;  2XYT A;  4UXU A;  4QH1 A;  3SQ6 A;  2BR8 A;  5FJV A;  1UX2 A;  2BYN A;  5KZU A;  3GUA A;  4Z90 A;  4TNV A;  2ZJV A;  2Y58 A; 
#chains in the Genus database with same CATH topology
 4ILB A;  2BG9 C;  3SIO A;  3UU3 A;  5AFM A;  3UU6 A;  4LMJ A;  5SYO A;  3RI5 A;  2XQ4 A;  3U8K A;  2Y7Y A;  5HEJ A;  4NZB A;  2UZ6 A;  4BQT A;  5HEG A;  3EI0 A;  2Y54 A;  2BG9 B;  3WTH A;  2XYS A;  3TLW A;  4ZZC A;  4TWF A;  4HQP A;  2BJ0 A;  5AFK A;  3WTM A;  4HFB A;  4NPP A;  3U8L A;  5J5I A;  3PEO A;  3WTK A;  4PIR A;  3RHW A;  3UUB A;  4AFT A;  4EZ1 A;  4HFE A;  2Y56 A;  3PMZ A;  2WZY A;  4ALX A;  4LML A;  2W8F A;  3WTO A;  3U8M A;  3RQW A;  5HCM A;  3P4W A;  5HEO A;  4UM3 A;  3P50 A;  4HFD A;  2BYS A;  4ZZB A;  5BRX A;  2WN9 A;  2VL0 A;  3IGQ A;  1UV6 A;  3TLV A;  5CO5 A;  4F8H A;  2XQ5 A;  5L4H A;  2BG9 A;  2XQA A;  3EHZ A;  2XQ6 A;  4IL4 A;  5BP0 A;  4QAB A;  5JME A;  4IRE A;  3JAD A;  3TLT A;  3UU4 A;  5IUX A;  3ZKR A;  4TWD A;  5CFB A;  5J0Z A;  2BYR A;  3WTI A;  2X00 A;  4UM3 P;  5LG3 A;  4BFQ A;  4X5T A;  4D01 A;  5J5H A;  4ZR6 A;  3RQU A;  4IL9 A;  4Z91 A;  4COF A;  5AFH A;  4ZK1 A;  2BG9 E;  3SH1 A;  5LXB A;  4HFI A;  4ZRU A;  2XQ9 A;  5AFN A;  2Y57 A;  1UW6 A;  2WNJ A;  5TVC A;  3TLU A;  4XHE A;  3WTL A;  4AFG A;  3EAM A;  2BYQ A;  4ZJS A;  5HCJ A;  4ILA A;  2BR7 A;  4HFH A;  4ZJT A;  5AFJ A;  2X00 D;  4TNW A;  4WV9 A;  4DBM A;  4FRR A;  5L4E A;  4ZK4 A;  3TLS A;  3UU8 A;  2YKS A;  4QH4 A;  4XK9 A;  5HEH A;  4A98 A;  4LMK A;  5HEU A;  5BW2 A;  1I9B A;  5J5G A;  5L47 A;  4UY2 A;  5AFL A;  3C79 A;  2BYP A;  4HFC A;  2ZJU A;  3UQ7 A;  4TWH A;  2YN6 A;  4ILC A;  2YOE A;  3ZDG A;  3C84 A;  4UM1 A;  2WNC A;  2XQ3 A;  2XZ5 A;  2XNV A;  2YMD A;  4A97 A;  4B5D A;  3WIP A;  5J5F A;  3RIA A;  2YME A;  2QC1 B;  3RIF A;  3WTN A;  3JAE A;  2XNT A;  3ZDH A;  3WTJ A;  2PGZ A;  5AFM B;  3UQ4 A;  3JAF A;  4QAA A;  3UU5 A;  2XZ6 A;  4QH5 A;  2XNU A;  4QAC A;  3T4M A;  4AFH A;  2C9T A;  3SQ9 A;  2W8G A;  5KE4 A;  2PH9 A;  5AIN A;  4UM3 S;  2WNL A;  2XQ7 A;  3LSV A;  3U8N A;  3U8J A;  2XQ8 A;  2XYT A;  4UXU A;  4QH1 A;  3SQ6 A;  2BR8 A;  5FJV A;  1UX2 A;  2BYN A;  5KZU A;  3GUA A;  4Z90 A;  4TNV A;  2ZJV A;  2Y58 A; 
#chains in the Genus database with same CATH homology
 4ILB A;  2BG9 C;  3SIO A;  3UU3 A;  5AFM A;  3UU6 A;  4LMJ A;  5SYO A;  3RI5 A;  2XQ4 A;  3U8K A;  2Y7Y A;  5HEJ A;  4NZB A;  2UZ6 A;  4BQT A;  5HEG A;  3EI0 A;  2Y54 A;  2BG9 B;  3WTH A;  2XYS A;  3TLW A;  4ZZC A;  4TWF A;  4HQP A;  2BJ0 A;  5AFK A;  3WTM A;  4HFB A;  4NPP A;  3U8L A;  5J5I A;  3PEO A;  3WTK A;  4PIR A;  3RHW A;  3UUB A;  4AFT A;  4EZ1 A;  4HFE A;  2Y56 A;  3PMZ A;  2WZY A;  4ALX A;  4LML A;  2W8F A;  3WTO A;  3U8M A;  3RQW A;  5HCM A;  3P4W A;  5HEO A;  4UM3 A;  3P50 A;  4HFD A;  2BYS A;  4ZZB A;  5BRX A;  2WN9 A;  2VL0 A;  3IGQ A;  1UV6 A;  3TLV A;  5CO5 A;  4F8H A;  2XQ5 A;  5L4H A;  2BG9 A;  2XQA A;  3EHZ A;  2XQ6 A;  4IL4 A;  5BP0 A;  4QAB A;  5JME A;  4IRE A;  3JAD A;  3TLT A;  3UU4 A;  5IUX A;  3ZKR A;  4TWD A;  5CFB A;  5J0Z A;  2BYR A;  3WTI A;  2X00 A;  4UM3 P;  5LG3 A;  4BFQ A;  4X5T A;  4D01 A;  5J5H A;  4ZR6 A;  3RQU A;  4IL9 A;  4Z91 A;  4COF A;  5AFH A;  4ZK1 A;  2BG9 E;  3SH1 A;  5LXB A;  4HFI A;  4ZRU A;  2XQ9 A;  5AFN A;  2Y57 A;  1UW6 A;  2WNJ A;  5TVC A;  3TLU A;  4XHE A;  3WTL A;  4AFG A;  3EAM A;  2BYQ A;  4ZJS A;  5HCJ A;  4ILA A;  2BR7 A;  4HFH A;  4ZJT A;  5AFJ A;  2X00 D;  4TNW A;  4WV9 A;  4DBM A;  4FRR A;  5L4E A;  4ZK4 A;  3TLS A;  3UU8 A;  2YKS A;  4QH4 A;  4XK9 A;  5HEH A;  4A98 A;  4LMK A;  5HEU A;  5BW2 A;  1I9B A;  5J5G A;  5L47 A;  4UY2 A;  5AFL A;  3C79 A;  2BYP A;  4HFC A;  2ZJU A;  3UQ7 A;  4TWH A;  2YN6 A;  4ILC A;  2YOE A;  3ZDG A;  3C84 A;  4UM1 A;  2WNC A;  2XQ3 A;  2XZ5 A;  2XNV A;  2YMD A;  4A97 A;  4B5D A;  3WIP A;  5J5F A;  3RIA A;  2YME A;  2QC1 B;  3RIF A;  3WTN A;  3JAE A;  2XNT A;  3ZDH A;  3WTJ A;  2PGZ A;  5AFM B;  3UQ4 A;  3JAF A;  4QAA A;  3UU5 A;  2XZ6 A;  4QH5 A;  2XNU A;  4QAC A;  3T4M A;  4AFH A;  2C9T A;  3SQ9 A;  2W8G A;  5KE4 A;  2PH9 A;  5AIN A;  4UM3 S;  2WNL A;  2XQ7 A;  3LSV A;  3U8N A;  3U8J A;  2XQ8 A;  2XYT A;  4UXU A;  4QH1 A;  3SQ6 A;  2BR8 A;  5FJV A;  1UX2 A;  2BYN A;  5KZU A;  3GUA A;  4Z90 A;  4TNV A;  2ZJV A;  2Y58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...