1UX2A

X-ray structure of acetylcholine binding protein (achbp)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
207
Chain Sequence
VEFDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Nicotine and Carbamylcholine Binding to Nicotinic Acetylcholine Receptors as Studied in Achbp Crystal Structures
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Glycoprotein
total genus 51
structure length 207
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1ux2A00
1UW6A 4UM1A 3TLTA 2ZJUA 5LG3A 4NPPA 3U8NA 5HEGA 4BFQA 4X5TA 4ZK1A 5AFNA 3ZDHA 5SYOA 3WTKA 2XZ5A 4UXUA 5J0ZA 3TLSA 4AFHA 2W8FA 3ZDGA 5BP0A 3WIPA 4A98A 4F8HA 5J5HA 1UX2A 4HFBA 3SQ9A 4ZJSA 5HEHA 2WZYA 3UQ4A 4QH5A 3U8LA 4ILBA 3U8KA 2XQ7A 2XNTA 5CO5A 5J5IA 2X00A 4UY2A 2BYRA 3RIAA 2BG9E 3RQUA 4IL9A 4UM3P 4FRRA 5FJVA 3UU6A 1I9BA 2XQ8A 3UU4A 4ZJTA 4AFTA 4HFIA 4TWHA 5AFMB 4QH4A 2Y57A 2XQ9A 3EAMA 4HQPA 3SQ6A 4TWDA 3JAFA 5J5FA 3C84A 2YKSA 4Z90A 4ZZCA 2YN6A 3JADA 3P50A 3UU3A 2YMEA 2VL0A 2WN9A 3SIOA 5AFMA 2BYPA 4UM3S 3UU8A 4LMJA 2BR7A 2UZ6A 5J5GA 5CFBA 2XNUA 2Y56A 3P4WA 2WNLA 4TNWA 3WTJA 4QAAA 3UU5A 5AINA 3UUBA 3RHWA 4BQTA 3LSVA 3WTMA 5L4EA 2Y7YA 3ZKRA 3PMZA 4DBMA 2BR8A 3SH1A 2C9TA 4UM3A 5HEJA 2BYSA 4XK9A 5HEUA 3WTLA 5AFHA 5L4HA 4HFHA 4ZK4A 4QH1A 2WNCA 4IL4A 2XQ3A 2BJ0A 4ILAA 2XQAA 4HFDA 2BG9C 2QC1B 3WTHA 4AFGA 4B5DA 3UQ7A 4ILCA 4ZZBA 3U8MA 3T4MA 5TVCA 3EHZA 3U8JA 4HFEA 2BYNA 2BYQA 2XQ5A 4NZBA 4QABA 4QACA 3TLUA 2XQ4A 3PEOA 2XNVA 4HFCA 4A97A 2X00D 2PH9A 4PIRA 3RI5A 5JMEA 2BG9B 1UV6A 2ZJVA 3EI0A 4LMKA 5AFKA 4LMLA 3GUAA 4COFA 3TLVA 4XHEA 2YMDA 2XYSA 3C79A 3TLWA 2YOEA 4EZ1A 5BW2A 5KE4A 4IREA 5KZUA 3RQWA 2Y58A 3WTOA 2WNJA 3IGQA 5AFJA 5LXBA 3WTNA 2XYTA 2Y54A 5L47A 5BRXA 4ZRUA 4TWFA 5HCMA 2PGZA 3WTIA 4ALXA 5IUXA 4WV9A 5HCJA 4D01A 2W8GA 4ZR6A 2XQ6A 2XZ6A 4Z91A 3RIFA 5AFLA 2BG9A 3JAEA 4TNVA 5HEOA
chains in the Genus database with same CATH superfamily
1UW6A 4UM1A 3TLTA 2ZJUA 5LG3A 4NPPA 3U8NA 5HEGA 4BFQA 4X5TA 4ZK1A 5AFNA 3ZDHA 5SYOA 3WTKA 2XZ5A 4UXUA 5J0ZA 3TLSA 4AFHA 2W8FA 3ZDGA 5BP0A 3WIPA 4A98A 4F8HA 5J5HA 1UX2A 4HFBA 3SQ9A 4ZJSA 5HEHA 2WZYA 3UQ4A 4QH5A 3U8LA 4ILBA 3U8KA 2XQ7A 2XNTA 5CO5A 5J5IA 2X00A 4UY2A 2BYRA 3RIAA 2BG9E 3RQUA 4IL9A 4UM3P 4FRRA 5FJVA 3UU6A 1I9BA 2XQ8A 3UU4A 4ZJTA 4AFTA 4HFIA 4TWHA 5AFMB 4QH4A 2Y57A 2XQ9A 3EAMA 4HQPA 3SQ6A 4TWDA 3JAFA 5J5FA 3C84A 2YKSA 4Z90A 4ZZCA 2YN6A 3JADA 3P50A 3UU3A 2YMEA 2VL0A 2WN9A 3SIOA 5AFMA 2BYPA 4UM3S 3UU8A 4LMJA 2BR7A 2UZ6A 5J5GA 5CFBA 2XNUA 2Y56A 3P4WA 2WNLA 4TNWA 3WTJA 4QAAA 3UU5A 5AINA 3UUBA 3RHWA 4BQTA 3LSVA 3WTMA 5L4EA 2Y7YA 3ZKRA 3PMZA 4DBMA 2BR8A 3SH1A 2C9TA 4UM3A 5HEJA 2BYSA 4XK9A 5HEUA 3WTLA 5AFHA 5L4HA 4HFHA 4ZK4A 4QH1A 2WNCA 4IL4A 2XQ3A 2BJ0A 4ILAA 2XQAA 4HFDA 2BG9C 2QC1B 3WTHA 4AFGA 4B5DA 3UQ7A 4ILCA 4ZZBA 3U8MA 3T4MA 5TVCA 3EHZA 3U8JA 4HFEA 2BYNA 2BYQA 2XQ5A 4NZBA 4QABA 4QACA 3TLUA 2XQ4A 3PEOA 2XNVA 4HFCA 4A97A 2X00D 2PH9A 4PIRA 3RI5A 5JMEA 2BG9B 1UV6A 2ZJVA 3EI0A 4LMKA 5AFKA 4LMLA 3GUAA 4COFA 3TLVA 4XHEA 2YMDA 2XYSA 3C79A 3TLWA 2YOEA 4EZ1A 5BW2A 5KE4A 4IREA 5KZUA 3RQWA 2Y58A 3WTOA 2WNJA 3IGQA 5AFJA 5LXBA 3WTNA 2XYTA 2Y54A 5L47A 5BRXA 4ZRUA 4TWFA 5HCMA 2PGZA 3WTIA 4ALXA 5IUXA 4WV9A 5HCJA 4D01A 2W8GA 4ZR6A 2XQ6A 2XZ6A 4Z91A 3RIFA 5AFLA 2BG9A 3JAEA 4TNVA 5HEOA
chains in the Genus database with same CATH topology
1UW6A 4UM1A 3TLTA 2ZJUA 5LG3A 4NPPA 3U8NA 5HEGA 4BFQA 4X5TA 4ZK1A 5AFNA 3ZDHA 5SYOA 3WTKA 2XZ5A 4UXUA 5J0ZA 3TLSA 4AFHA 2W8FA 3ZDGA 5BP0A 3WIPA 4A98A 4F8HA 5J5HA 1UX2A 4HFBA 3SQ9A 4ZJSA 5HEHA 2WZYA 3UQ4A 4QH5A 3U8LA 4ILBA 3U8KA 2XQ7A 2XNTA 5CO5A 5J5IA 2X00A 4UY2A 2BYRA 3RIAA 2BG9E 3RQUA 4IL9A 4UM3P 4FRRA 5FJVA 3UU6A 1I9BA 2XQ8A 3UU4A 4ZJTA 4AFTA 4HFIA 4TWHA 5AFMB 4QH4A 2Y57A 2XQ9A 3EAMA 4HQPA 3SQ6A 4TWDA 3JAFA 5J5FA 3C84A 2YKSA 4Z90A 4ZZCA 2YN6A 3JADA 3P50A 3UU3A 2YMEA 2VL0A 2WN9A 3SIOA 5AFMA 2BYPA 4UM3S 3UU8A 4LMJA 2BR7A 2UZ6A 5J5GA 5CFBA 2XNUA 2Y56A 3P4WA 2WNLA 4TNWA 3WTJA 4QAAA 3UU5A 5AINA 3UUBA 3RHWA 4BQTA 3LSVA 3WTMA 5L4EA 2Y7YA 3ZKRA 3PMZA 4DBMA 2BR8A 3SH1A 2C9TA 4UM3A 5HEJA 2BYSA 4XK9A 5HEUA 3WTLA 5AFHA 5L4HA 4HFHA 4ZK4A 4QH1A 2WNCA 4IL4A 2XQ3A 2BJ0A 4ILAA 2XQAA 4HFDA 2BG9C 2QC1B 3WTHA 4AFGA 4B5DA 3UQ7A 4ILCA 4ZZBA 3U8MA 3T4MA 5TVCA 3EHZA 3U8JA 4HFEA 2BYNA 2BYQA 2XQ5A 4NZBA 4QABA 4QACA 3TLUA 2XQ4A 3PEOA 2XNVA 4HFCA 4A97A 2X00D 2PH9A 4PIRA 3RI5A 5JMEA 2BG9B 1UV6A 2ZJVA 3EI0A 4LMKA 5AFKA 4LMLA 3GUAA 4COFA 3TLVA 4XHEA 2YMDA 2XYSA 3C79A 3TLWA 2YOEA 4EZ1A 5BW2A 5KE4A 4IREA 5KZUA 3RQWA 2Y58A 3WTOA 2WNJA 3IGQA 5AFJA 5LXBA 3WTNA 2XYTA 2Y54A 5L47A 5BRXA 4ZRUA 4TWFA 5HCMA 2PGZA 3WTIA 4ALXA 5IUXA 4WV9A 5HCJA 4D01A 2W8GA 4ZR6A 2XQ6A 2XZ6A 4Z91A 3RIFA 5AFLA 2BG9A 3JAEA 4TNVA 5HEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW6 A;  4UM1 A;  3TLT A;  2ZJU A;  5LG3 A;  4NPP A;  3U8N A;  5HEG A;  4BFQ A;  4X5T A;  4ZK1 A;  5AFN A;  3ZDH A;  5SYO A;  3WTK A;  2XZ5 A;  4UXU A;  5J0Z A;  3TLS A;  4AFH A;  2W8F A;  3ZDG A;  5BP0 A;  3WIP A;  4A98 A;  4F8H A;  5J5H A;  1UX2 A;  4HFB A;  3SQ9 A;  4ZJS A;  5HEH A;  2WZY A;  3UQ4 A;  4QH5 A;  3U8L A;  4ILB A;  3U8K A;  2XQ7 A;  2XNT A;  5CO5 A;  5J5I A;  2X00 A;  4UY2 A;  2BYR A;  3RIA A;  2BG9 E;  3RQU A;  4IL9 A;  4UM3 P;  4FRR A;  5FJV A;  3UU6 A;  1I9B A;  2XQ8 A;  3UU4 A;  4ZJT A;  4AFT A;  4HFI A;  4TWH A;  5AFM B;  4QH4 A;  2Y57 A;  2XQ9 A;  3EAM A;  4HQP A;  3SQ6 A;  4TWD A;  3JAF A;  5J5F A;  3C84 A;  2YKS A;  4Z90 A;  4ZZC A;  2YN6 A;  3JAD A;  3P50 A;  3UU3 A;  2YME A;  2VL0 A;  2WN9 A;  3SIO A;  5AFM A;  2BYP A;  4UM3 S;  3UU8 A;  4LMJ A;  2BR7 A;  2UZ6 A;  5J5G A;  5CFB A;  2XNU A;  2Y56 A;  3P4W A;  2WNL A;  4TNW A;  3WTJ A;  4QAA A;  3UU5 A;  5AIN A;  3UUB A;  3RHW A;  4BQT A;  3LSV A;  3WTM A;  5L4E A;  2Y7Y A;  3ZKR A;  3PMZ A;  4DBM A;  2BR8 A;  3SH1 A;  2C9T A;  4UM3 A;  5HEJ A;  2BYS A;  4XK9 A;  5HEU A;  3WTL A;  5AFH A;  5L4H A;  4HFH A;  4ZK4 A;  4QH1 A;  2WNC A;  4IL4 A;  2XQ3 A;  2BJ0 A;  4ILA A;  2XQA A;  4HFD A;  2BG9 C;  2QC1 B;  3WTH A;  4AFG A;  4B5D A;  3UQ7 A;  4ILC A;  4ZZB A;  3U8M A;  3T4M A;  5TVC A;  3EHZ A;  3U8J A;  4HFE A;  2BYN A;  2BYQ A;  2XQ5 A;  4NZB A;  4QAB A;  4QAC A;  3TLU A;  2XQ4 A;  3PEO A;  2XNV A;  4HFC A;  4A97 A;  2X00 D;  2PH9 A;  4PIR A;  3RI5 A;  5JME A;  2BG9 B;  1UV6 A;  2ZJV A;  3EI0 A;  4LMK A;  5AFK A;  4LML A;  3GUA A;  4COF A;  3TLV A;  4XHE A;  2YMD A;  2XYS A;  3C79 A;  3TLW A;  2YOE A;  4EZ1 A;  5BW2 A;  5KE4 A;  4IRE A;  5KZU A;  3RQW A;  2Y58 A;  3WTO A;  2WNJ A;  3IGQ A;  5AFJ A;  5LXB A;  3WTN A;  2XYT A;  2Y54 A;  5L47 A;  5BRX A;  4ZRU A;  4TWF A;  5HCM A;  2PGZ A;  3WTI A;  4ALX A;  5IUX A;  4WV9 A;  5HCJ A;  4D01 A;  2W8G A;  4ZR6 A;  2XQ6 A;  2XZ6 A;  4Z91 A;  3RIF A;  5AFL A;  2BG9 A;  3JAE A;  4TNV A;  5HEO A; 
#chains in the Genus database with same CATH topology
 1UW6 A;  4UM1 A;  3TLT A;  2ZJU A;  5LG3 A;  4NPP A;  3U8N A;  5HEG A;  4BFQ A;  4X5T A;  4ZK1 A;  5AFN A;  3ZDH A;  5SYO A;  3WTK A;  2XZ5 A;  4UXU A;  5J0Z A;  3TLS A;  4AFH A;  2W8F A;  3ZDG A;  5BP0 A;  3WIP A;  4A98 A;  4F8H A;  5J5H A;  1UX2 A;  4HFB A;  3SQ9 A;  4ZJS A;  5HEH A;  2WZY A;  3UQ4 A;  4QH5 A;  3U8L A;  4ILB A;  3U8K A;  2XQ7 A;  2XNT A;  5CO5 A;  5J5I A;  2X00 A;  4UY2 A;  2BYR A;  3RIA A;  2BG9 E;  3RQU A;  4IL9 A;  4UM3 P;  4FRR A;  5FJV A;  3UU6 A;  1I9B A;  2XQ8 A;  3UU4 A;  4ZJT A;  4AFT A;  4HFI A;  4TWH A;  5AFM B;  4QH4 A;  2Y57 A;  2XQ9 A;  3EAM A;  4HQP A;  3SQ6 A;  4TWD A;  3JAF A;  5J5F A;  3C84 A;  2YKS A;  4Z90 A;  4ZZC A;  2YN6 A;  3JAD A;  3P50 A;  3UU3 A;  2YME A;  2VL0 A;  2WN9 A;  3SIO A;  5AFM A;  2BYP A;  4UM3 S;  3UU8 A;  4LMJ A;  2BR7 A;  2UZ6 A;  5J5G A;  5CFB A;  2XNU A;  2Y56 A;  3P4W A;  2WNL A;  4TNW A;  3WTJ A;  4QAA A;  3UU5 A;  5AIN A;  3UUB A;  3RHW A;  4BQT A;  3LSV A;  3WTM A;  5L4E A;  2Y7Y A;  3ZKR A;  3PMZ A;  4DBM A;  2BR8 A;  3SH1 A;  2C9T A;  4UM3 A;  5HEJ A;  2BYS A;  4XK9 A;  5HEU A;  3WTL A;  5AFH A;  5L4H A;  4HFH A;  4ZK4 A;  4QH1 A;  2WNC A;  4IL4 A;  2XQ3 A;  2BJ0 A;  4ILA A;  2XQA A;  4HFD A;  2BG9 C;  2QC1 B;  3WTH A;  4AFG A;  4B5D A;  3UQ7 A;  4ILC A;  4ZZB A;  3U8M A;  3T4M A;  5TVC A;  3EHZ A;  3U8J A;  4HFE A;  2BYN A;  2BYQ A;  2XQ5 A;  4NZB A;  4QAB A;  4QAC A;  3TLU A;  2XQ4 A;  3PEO A;  2XNV A;  4HFC A;  4A97 A;  2X00 D;  2PH9 A;  4PIR A;  3RI5 A;  5JME A;  2BG9 B;  1UV6 A;  2ZJV A;  3EI0 A;  4LMK A;  5AFK A;  4LML A;  3GUA A;  4COF A;  3TLV A;  4XHE A;  2YMD A;  2XYS A;  3C79 A;  3TLW A;  2YOE A;  4EZ1 A;  5BW2 A;  5KE4 A;  4IRE A;  5KZU A;  3RQW A;  2Y58 A;  3WTO A;  2WNJ A;  3IGQ A;  5AFJ A;  5LXB A;  3WTN A;  2XYT A;  2Y54 A;  5L47 A;  5BRX A;  4ZRU A;  4TWF A;  5HCM A;  2PGZ A;  3WTI A;  4ALX A;  5IUX A;  4WV9 A;  5HCJ A;  4D01 A;  2W8G A;  4ZR6 A;  2XQ6 A;  2XZ6 A;  4Z91 A;  3RIF A;  5AFL A;  2BG9 A;  3JAE A;  4TNV A;  5HEO A; 
#chains in the Genus database with same CATH homology
 1UW6 A;  4UM1 A;  3TLT A;  2ZJU A;  5LG3 A;  4NPP A;  3U8N A;  5HEG A;  4BFQ A;  4X5T A;  4ZK1 A;  5AFN A;  3ZDH A;  5SYO A;  3WTK A;  2XZ5 A;  4UXU A;  5J0Z A;  3TLS A;  4AFH A;  2W8F A;  3ZDG A;  5BP0 A;  3WIP A;  4A98 A;  4F8H A;  5J5H A;  1UX2 A;  4HFB A;  3SQ9 A;  4ZJS A;  5HEH A;  2WZY A;  3UQ4 A;  4QH5 A;  3U8L A;  4ILB A;  3U8K A;  2XQ7 A;  2XNT A;  5CO5 A;  5J5I A;  2X00 A;  4UY2 A;  2BYR A;  3RIA A;  2BG9 E;  3RQU A;  4IL9 A;  4UM3 P;  4FRR A;  5FJV A;  3UU6 A;  1I9B A;  2XQ8 A;  3UU4 A;  4ZJT A;  4AFT A;  4HFI A;  4TWH A;  5AFM B;  4QH4 A;  2Y57 A;  2XQ9 A;  3EAM A;  4HQP A;  3SQ6 A;  4TWD A;  3JAF A;  5J5F A;  3C84 A;  2YKS A;  4Z90 A;  4ZZC A;  2YN6 A;  3JAD A;  3P50 A;  3UU3 A;  2YME A;  2VL0 A;  2WN9 A;  3SIO A;  5AFM A;  2BYP A;  4UM3 S;  3UU8 A;  4LMJ A;  2BR7 A;  2UZ6 A;  5J5G A;  5CFB A;  2XNU A;  2Y56 A;  3P4W A;  2WNL A;  4TNW A;  3WTJ A;  4QAA A;  3UU5 A;  5AIN A;  3UUB A;  3RHW A;  4BQT A;  3LSV A;  3WTM A;  5L4E A;  2Y7Y A;  3ZKR A;  3PMZ A;  4DBM A;  2BR8 A;  3SH1 A;  2C9T A;  4UM3 A;  5HEJ A;  2BYS A;  4XK9 A;  5HEU A;  3WTL A;  5AFH A;  5L4H A;  4HFH A;  4ZK4 A;  4QH1 A;  2WNC A;  4IL4 A;  2XQ3 A;  2BJ0 A;  4ILA A;  2XQA A;  4HFD A;  2BG9 C;  2QC1 B;  3WTH A;  4AFG A;  4B5D A;  3UQ7 A;  4ILC A;  4ZZB A;  3U8M A;  3T4M A;  5TVC A;  3EHZ A;  3U8J A;  4HFE A;  2BYN A;  2BYQ A;  2XQ5 A;  4NZB A;  4QAB A;  4QAC A;  3TLU A;  2XQ4 A;  3PEO A;  2XNV A;  4HFC A;  4A97 A;  2X00 D;  2PH9 A;  4PIR A;  3RI5 A;  5JME A;  2BG9 B;  1UV6 A;  2ZJV A;  3EI0 A;  4LMK A;  5AFK A;  4LML A;  3GUA A;  4COF A;  3TLV A;  4XHE A;  2YMD A;  2XYS A;  3C79 A;  3TLW A;  2YOE A;  4EZ1 A;  5BW2 A;  5KE4 A;  4IRE A;  5KZU A;  3RQW A;  2Y58 A;  3WTO A;  2WNJ A;  3IGQ A;  5AFJ A;  5LXB A;  3WTN A;  2XYT A;  2Y54 A;  5L47 A;  5BRX A;  4ZRU A;  4TWF A;  5HCM A;  2PGZ A;  3WTI A;  4ALX A;  5IUX A;  4WV9 A;  5HCJ A;  4D01 A;  2W8G A;  4ZR6 A;  2XQ6 A;  2XZ6 A;  4Z91 A;  3RIF A;  5AFL A;  2BG9 A;  3JAE A;  4TNV A;  5HEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...