1UX2A

X-ray structure of acetylcholine binding protein (achbp)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
207
Chain Sequence
VEFDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoprotein
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Nicotine and Carbamylcholine Binding to Nicotinic Acetylcholine Receptors as Studied in Achbp Crystal Structures
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 51
structure length 207
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1ux2A00
5KZUA 2XQ8A 3TLSA 4D01A 2WZYA 2YMEA 2XQ9A 4LMJA 2XQ4A 4ILBA 3SH1A 3JAEA 2XQAA 5CO5A 4ZK1A 2XZ5A 3SIOA 4Z90A 2PH9A 4COFA 2XQ5A 3ZDHA 1UX2A 2BR7A 2XNUA 2YMDA 3PMZA 4HFIA 2C9TA 4ZK4A 4ZRUA 1UW6A 4HFDA 3RQUA 5LG3A 2XQ7A 2W8FA 4EZ1A 5BRXA 3EHZA 5BW2A 5J5FA 4DBMA 4IL9A 2XQ6A 2Y57A 2Y56A 3PEOA 3RHWA 5JMEA 5AFJA 4QH5A 3C79A 5J0ZA 4IREA 2BG9E 5AFHA 5HCMA 4UM3P 4WV9A 3WIPA 2W8GA 4ILAA 5L4HA 3UU4A 3GUAA 5HCJA 2QC1B 1I9BA 3EAMA 4ILCA 5J5GA 4PIRA 3RI5A 4UM3S 2PGZA 2UZ6A 3EI0A 3P50A 3IGQA 3UU8A 3P4WA 2BYSA 4HQPA 5HEHA 4ZJTA 3TLUA 2XZ6A 5KE4A 4QH1A 2XYTA 3WTJA 3UUBA 2WNJA 3JAFA 3C84A 4QABA 3UU5A 4LMKA 4UY2A 4TNVA 2BG9A 3UU3A 2WNCA 3U8LA 2YKSA 4QAAA 4TNWA 4UXUA 3SQ6A 3RIAA 3WTMA 2BYNA 3UQ4A 2BYRA 4AFHA 4TWFA 2YOEA 3LSVA 4Z91A 5AFMA 4ZR6A 2BG9B 2ZJUA 5HEUA 2WNLA 4BQTA 2YN6A 2X00A 4QH4A 2WN9A 2XYSA 5BP0A 3TLWA 3UU6A 4HFEA 2XQ3A 4ZJSA 4A98A 3U8NA 3ZDGA 1UV6A 4FRRA 4TWDA 3TLTA 2BR8A 5TVCA 4QACA 4XHEA 3RQWA 2BYPA 2BJ0A 5J5HA 4HFHA 3SQ9A 4F8HA 4NPPA 5AINA 2Y7YA 5SYOA 3WTKA 5FJVA 2BYQA 3WTIA 4LMLA 2Y54A 4ZZCA 3U8JA 2VL0A 2XNVA 3U8MA 5HEOA 5AFLA 3RIFA 5L47A 2Y58A 4ZZBA 5J5IA 4AFTA 4B5DA 4A97A 3TLVA 3WTLA 4HFCA 2ZJVA 4X5TA 3WTNA 5AFNA 2X00D 4UM3A 5HEJA 4ALXA 3T4MA 4UM1A 2BG9C 3U8KA 3WTHA 4BFQA 5CFBA 5AFMB 5LXBA 3JADA 4IL4A 5AFKA 4NZBA 4XK9A 3UQ7A 4TWHA 3WTOA 4AFGA 5HEGA 5L4EA 3ZKRA 2XNTA 4HFBA 5IUXA
chains in the Genus database with same CATH superfamily
5KZUA 2XQ8A 3TLSA 4D01A 2WZYA 2YMEA 2XQ9A 4LMJA 2XQ4A 4ILBA 3SH1A 3JAEA 2XQAA 5CO5A 4ZK1A 2XZ5A 3SIOA 4Z90A 2PH9A 4COFA 2XQ5A 3ZDHA 1UX2A 2BR7A 2XNUA 2YMDA 3PMZA 4HFIA 2C9TA 4ZK4A 4ZRUA 1UW6A 4HFDA 3RQUA 5LG3A 2XQ7A 2W8FA 4EZ1A 5BRXA 3EHZA 5BW2A 5J5FA 4DBMA 4IL9A 2XQ6A 2Y57A 2Y56A 3PEOA 3RHWA 5JMEA 5AFJA 4QH5A 3C79A 5J0ZA 4IREA 2BG9E 5AFHA 5HCMA 4UM3P 4WV9A 3WIPA 2W8GA 4ILAA 5L4HA 3UU4A 3GUAA 5HCJA 2QC1B 1I9BA 3EAMA 4ILCA 5J5GA 4PIRA 3RI5A 4UM3S 2PGZA 2UZ6A 3EI0A 3P50A 3IGQA 3UU8A 3P4WA 2BYSA 4HQPA 5HEHA 4ZJTA 3TLUA 2XZ6A 5KE4A 4QH1A 2XYTA 3WTJA 3UUBA 2WNJA 3JAFA 3C84A 4QABA 3UU5A 4LMKA 4UY2A 4TNVA 2BG9A 3UU3A 2WNCA 3U8LA 2YKSA 4QAAA 4TNWA 4UXUA 3SQ6A 3RIAA 3WTMA 2BYNA 3UQ4A 2BYRA 4AFHA 4TWFA 2YOEA 3LSVA 4Z91A 5AFMA 4ZR6A 2BG9B 2ZJUA 5HEUA 2WNLA 4BQTA 2YN6A 2X00A 4QH4A 2WN9A 2XYSA 5BP0A 3TLWA 3UU6A 4HFEA 2XQ3A 4ZJSA 4A98A 3U8NA 3ZDGA 1UV6A 4FRRA 4TWDA 3TLTA 2BR8A 5TVCA 4QACA 4XHEA 3RQWA 2BYPA 2BJ0A 5J5HA 4HFHA 3SQ9A 4F8HA 4NPPA 5AINA 2Y7YA 5SYOA 3WTKA 5FJVA 2BYQA 3WTIA 4LMLA 2Y54A 4ZZCA 3U8JA 2VL0A 2XNVA 3U8MA 5HEOA 5AFLA 3RIFA 5L47A 2Y58A 4ZZBA 5J5IA 4AFTA 4B5DA 4A97A 3TLVA 3WTLA 4HFCA 2ZJVA 4X5TA 3WTNA 5AFNA 2X00D 4UM3A 5HEJA 4ALXA 3T4MA 4UM1A 2BG9C 3U8KA 3WTHA 4BFQA 5CFBA 5AFMB 5LXBA 3JADA 4IL4A 5AFKA 4NZBA 4XK9A 3UQ7A 4TWHA 3WTOA 4AFGA 5HEGA 5L4EA 3ZKRA 2XNTA 4HFBA 5IUXA
chains in the Genus database with same CATH topology
5KZUA 2XQ8A 3TLSA 4D01A 2WZYA 2YMEA 2XQ9A 4LMJA 2XQ4A 4ILBA 3SH1A 3JAEA 2XQAA 5CO5A 4ZK1A 2XZ5A 3SIOA 4Z90A 2PH9A 4COFA 2XQ5A 3ZDHA 1UX2A 2BR7A 2XNUA 2YMDA 3PMZA 4HFIA 2C9TA 4ZK4A 4ZRUA 1UW6A 4HFDA 3RQUA 5LG3A 2XQ7A 2W8FA 4EZ1A 5BRXA 3EHZA 5BW2A 5J5FA 4DBMA 4IL9A 2XQ6A 2Y57A 2Y56A 3PEOA 3RHWA 5JMEA 5AFJA 4QH5A 3C79A 5J0ZA 4IREA 2BG9E 5AFHA 5HCMA 4UM3P 4WV9A 3WIPA 2W8GA 4ILAA 5L4HA 3UU4A 3GUAA 5HCJA 2QC1B 1I9BA 3EAMA 4ILCA 5J5GA 4PIRA 3RI5A 4UM3S 2PGZA 2UZ6A 3EI0A 3P50A 3IGQA 3UU8A 3P4WA 2BYSA 4HQPA 5HEHA 4ZJTA 3TLUA 2XZ6A 5KE4A 4QH1A 2XYTA 3WTJA 3UUBA 2WNJA 3JAFA 3C84A 4QABA 3UU5A 4LMKA 4UY2A 4TNVA 2BG9A 3UU3A 2WNCA 3U8LA 2YKSA 4QAAA 4TNWA 4UXUA 3SQ6A 3RIAA 3WTMA 2BYNA 3UQ4A 2BYRA 4AFHA 4TWFA 2YOEA 3LSVA 4Z91A 5AFMA 4ZR6A 2BG9B 2ZJUA 5HEUA 2WNLA 4BQTA 2YN6A 2X00A 4QH4A 2WN9A 2XYSA 5BP0A 3TLWA 3UU6A 4HFEA 2XQ3A 4ZJSA 4A98A 3U8NA 3ZDGA 1UV6A 4FRRA 4TWDA 3TLTA 2BR8A 5TVCA 4QACA 4XHEA 3RQWA 2BYPA 2BJ0A 5J5HA 4HFHA 3SQ9A 4F8HA 4NPPA 5AINA 2Y7YA 5SYOA 3WTKA 5FJVA 2BYQA 3WTIA 4LMLA 2Y54A 4ZZCA 3U8JA 2VL0A 2XNVA 3U8MA 5HEOA 5AFLA 3RIFA 5L47A 2Y58A 4ZZBA 5J5IA 4AFTA 4B5DA 4A97A 3TLVA 3WTLA 4HFCA 2ZJVA 4X5TA 3WTNA 5AFNA 2X00D 4UM3A 5HEJA 4ALXA 3T4MA 4UM1A 2BG9C 3U8KA 3WTHA 4BFQA 5CFBA 5AFMB 5LXBA 3JADA 4IL4A 5AFKA 4NZBA 4XK9A 3UQ7A 4TWHA 3WTOA 4AFGA 5HEGA 5L4EA 3ZKRA 2XNTA 4HFBA 5IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KZU A;  2XQ8 A;  3TLS A;  4D01 A;  2WZY A;  2YME A;  2XQ9 A;  4LMJ A;  2XQ4 A;  4ILB A;  3SH1 A;  3JAE A;  2XQA A;  5CO5 A;  4ZK1 A;  2XZ5 A;  3SIO A;  4Z90 A;  2PH9 A;  4COF A;  2XQ5 A;  3ZDH A;  1UX2 A;  2BR7 A;  2XNU A;  2YMD A;  3PMZ A;  4HFI A;  2C9T A;  4ZK4 A;  4ZRU A;  1UW6 A;  4HFD A;  3RQU A;  5LG3 A;  2XQ7 A;  2W8F A;  4EZ1 A;  5BRX A;  3EHZ A;  5BW2 A;  5J5F A;  4DBM A;  4IL9 A;  2XQ6 A;  2Y57 A;  2Y56 A;  3PEO A;  3RHW A;  5JME A;  5AFJ A;  4QH5 A;  3C79 A;  5J0Z A;  4IRE A;  2BG9 E;  5AFH A;  5HCM A;  4UM3 P;  4WV9 A;  3WIP A;  2W8G A;  4ILA A;  5L4H A;  3UU4 A;  3GUA A;  5HCJ A;  2QC1 B;  1I9B A;  3EAM A;  4ILC A;  5J5G A;  4PIR A;  3RI5 A;  4UM3 S;  2PGZ A;  2UZ6 A;  3EI0 A;  3P50 A;  3IGQ A;  3UU8 A;  3P4W A;  2BYS A;  4HQP A;  5HEH A;  4ZJT A;  3TLU A;  2XZ6 A;  5KE4 A;  4QH1 A;  2XYT A;  3WTJ A;  3UUB A;  2WNJ A;  3JAF A;  3C84 A;  4QAB A;  3UU5 A;  4LMK A;  4UY2 A;  4TNV A;  2BG9 A;  3UU3 A;  2WNC A;  3U8L A;  2YKS A;  4QAA A;  4TNW A;  4UXU A;  3SQ6 A;  3RIA A;  3WTM A;  2BYN A;  3UQ4 A;  2BYR A;  4AFH A;  4TWF A;  2YOE A;  3LSV A;  4Z91 A;  5AFM A;  4ZR6 A;  2BG9 B;  2ZJU A;  5HEU A;  2WNL A;  4BQT A;  2YN6 A;  2X00 A;  4QH4 A;  2WN9 A;  2XYS A;  5BP0 A;  3TLW A;  3UU6 A;  4HFE A;  2XQ3 A;  4ZJS A;  4A98 A;  3U8N A;  3ZDG A;  1UV6 A;  4FRR A;  4TWD A;  3TLT A;  2BR8 A;  5TVC A;  4QAC A;  4XHE A;  3RQW A;  2BYP A;  2BJ0 A;  5J5H A;  4HFH A;  3SQ9 A;  4F8H A;  4NPP A;  5AIN A;  2Y7Y A;  5SYO A;  3WTK A;  5FJV A;  2BYQ A;  3WTI A;  4LML A;  2Y54 A;  4ZZC A;  3U8J A;  2VL0 A;  2XNV A;  3U8M A;  5HEO A;  5AFL A;  3RIF A;  5L47 A;  2Y58 A;  4ZZB A;  5J5I A;  4AFT A;  4B5D A;  4A97 A;  3TLV A;  3WTL A;  4HFC A;  2ZJV A;  4X5T A;  3WTN A;  5AFN A;  2X00 D;  4UM3 A;  5HEJ A;  4ALX A;  3T4M A;  4UM1 A;  2BG9 C;  3U8K A;  3WTH A;  4BFQ A;  5CFB A;  5AFM B;  5LXB A;  3JAD A;  4IL4 A;  5AFK A;  4NZB A;  4XK9 A;  3UQ7 A;  4TWH A;  3WTO A;  4AFG A;  5HEG A;  5L4E A;  3ZKR A;  2XNT A;  4HFB A;  5IUX A; 
#chains in the Genus database with same CATH topology
 5KZU A;  2XQ8 A;  3TLS A;  4D01 A;  2WZY A;  2YME A;  2XQ9 A;  4LMJ A;  2XQ4 A;  4ILB A;  3SH1 A;  3JAE A;  2XQA A;  5CO5 A;  4ZK1 A;  2XZ5 A;  3SIO A;  4Z90 A;  2PH9 A;  4COF A;  2XQ5 A;  3ZDH A;  1UX2 A;  2BR7 A;  2XNU A;  2YMD A;  3PMZ A;  4HFI A;  2C9T A;  4ZK4 A;  4ZRU A;  1UW6 A;  4HFD A;  3RQU A;  5LG3 A;  2XQ7 A;  2W8F A;  4EZ1 A;  5BRX A;  3EHZ A;  5BW2 A;  5J5F A;  4DBM A;  4IL9 A;  2XQ6 A;  2Y57 A;  2Y56 A;  3PEO A;  3RHW A;  5JME A;  5AFJ A;  4QH5 A;  3C79 A;  5J0Z A;  4IRE A;  2BG9 E;  5AFH A;  5HCM A;  4UM3 P;  4WV9 A;  3WIP A;  2W8G A;  4ILA A;  5L4H A;  3UU4 A;  3GUA A;  5HCJ A;  2QC1 B;  1I9B A;  3EAM A;  4ILC A;  5J5G A;  4PIR A;  3RI5 A;  4UM3 S;  2PGZ A;  2UZ6 A;  3EI0 A;  3P50 A;  3IGQ A;  3UU8 A;  3P4W A;  2BYS A;  4HQP A;  5HEH A;  4ZJT A;  3TLU A;  2XZ6 A;  5KE4 A;  4QH1 A;  2XYT A;  3WTJ A;  3UUB A;  2WNJ A;  3JAF A;  3C84 A;  4QAB A;  3UU5 A;  4LMK A;  4UY2 A;  4TNV A;  2BG9 A;  3UU3 A;  2WNC A;  3U8L A;  2YKS A;  4QAA A;  4TNW A;  4UXU A;  3SQ6 A;  3RIA A;  3WTM A;  2BYN A;  3UQ4 A;  2BYR A;  4AFH A;  4TWF A;  2YOE A;  3LSV A;  4Z91 A;  5AFM A;  4ZR6 A;  2BG9 B;  2ZJU A;  5HEU A;  2WNL A;  4BQT A;  2YN6 A;  2X00 A;  4QH4 A;  2WN9 A;  2XYS A;  5BP0 A;  3TLW A;  3UU6 A;  4HFE A;  2XQ3 A;  4ZJS A;  4A98 A;  3U8N A;  3ZDG A;  1UV6 A;  4FRR A;  4TWD A;  3TLT A;  2BR8 A;  5TVC A;  4QAC A;  4XHE A;  3RQW A;  2BYP A;  2BJ0 A;  5J5H A;  4HFH A;  3SQ9 A;  4F8H A;  4NPP A;  5AIN A;  2Y7Y A;  5SYO A;  3WTK A;  5FJV A;  2BYQ A;  3WTI A;  4LML A;  2Y54 A;  4ZZC A;  3U8J A;  2VL0 A;  2XNV A;  3U8M A;  5HEO A;  5AFL A;  3RIF A;  5L47 A;  2Y58 A;  4ZZB A;  5J5I A;  4AFT A;  4B5D A;  4A97 A;  3TLV A;  3WTL A;  4HFC A;  2ZJV A;  4X5T A;  3WTN A;  5AFN A;  2X00 D;  4UM3 A;  5HEJ A;  4ALX A;  3T4M A;  4UM1 A;  2BG9 C;  3U8K A;  3WTH A;  4BFQ A;  5CFB A;  5AFM B;  5LXB A;  3JAD A;  4IL4 A;  5AFK A;  4NZB A;  4XK9 A;  3UQ7 A;  4TWH A;  3WTO A;  4AFG A;  5HEG A;  5L4E A;  3ZKR A;  2XNT A;  4HFB A;  5IUX A; 
#chains in the Genus database with same CATH homology
 5KZU A;  2XQ8 A;  3TLS A;  4D01 A;  2WZY A;  2YME A;  2XQ9 A;  4LMJ A;  2XQ4 A;  4ILB A;  3SH1 A;  3JAE A;  2XQA A;  5CO5 A;  4ZK1 A;  2XZ5 A;  3SIO A;  4Z90 A;  2PH9 A;  4COF A;  2XQ5 A;  3ZDH A;  1UX2 A;  2BR7 A;  2XNU A;  2YMD A;  3PMZ A;  4HFI A;  2C9T A;  4ZK4 A;  4ZRU A;  1UW6 A;  4HFD A;  3RQU A;  5LG3 A;  2XQ7 A;  2W8F A;  4EZ1 A;  5BRX A;  3EHZ A;  5BW2 A;  5J5F A;  4DBM A;  4IL9 A;  2XQ6 A;  2Y57 A;  2Y56 A;  3PEO A;  3RHW A;  5JME A;  5AFJ A;  4QH5 A;  3C79 A;  5J0Z A;  4IRE A;  2BG9 E;  5AFH A;  5HCM A;  4UM3 P;  4WV9 A;  3WIP A;  2W8G A;  4ILA A;  5L4H A;  3UU4 A;  3GUA A;  5HCJ A;  2QC1 B;  1I9B A;  3EAM A;  4ILC A;  5J5G A;  4PIR A;  3RI5 A;  4UM3 S;  2PGZ A;  2UZ6 A;  3EI0 A;  3P50 A;  3IGQ A;  3UU8 A;  3P4W A;  2BYS A;  4HQP A;  5HEH A;  4ZJT A;  3TLU A;  2XZ6 A;  5KE4 A;  4QH1 A;  2XYT A;  3WTJ A;  3UUB A;  2WNJ A;  3JAF A;  3C84 A;  4QAB A;  3UU5 A;  4LMK A;  4UY2 A;  4TNV A;  2BG9 A;  3UU3 A;  2WNC A;  3U8L A;  2YKS A;  4QAA A;  4TNW A;  4UXU A;  3SQ6 A;  3RIA A;  3WTM A;  2BYN A;  3UQ4 A;  2BYR A;  4AFH A;  4TWF A;  2YOE A;  3LSV A;  4Z91 A;  5AFM A;  4ZR6 A;  2BG9 B;  2ZJU A;  5HEU A;  2WNL A;  4BQT A;  2YN6 A;  2X00 A;  4QH4 A;  2WN9 A;  2XYS A;  5BP0 A;  3TLW A;  3UU6 A;  4HFE A;  2XQ3 A;  4ZJS A;  4A98 A;  3U8N A;  3ZDG A;  1UV6 A;  4FRR A;  4TWD A;  3TLT A;  2BR8 A;  5TVC A;  4QAC A;  4XHE A;  3RQW A;  2BYP A;  2BJ0 A;  5J5H A;  4HFH A;  3SQ9 A;  4F8H A;  4NPP A;  5AIN A;  2Y7Y A;  5SYO A;  3WTK A;  5FJV A;  2BYQ A;  3WTI A;  4LML A;  2Y54 A;  4ZZC A;  3U8J A;  2VL0 A;  2XNV A;  3U8M A;  5HEO A;  5AFL A;  3RIF A;  5L47 A;  2Y58 A;  4ZZB A;  5J5I A;  4AFT A;  4B5D A;  4A97 A;  3TLV A;  3WTL A;  4HFC A;  2ZJV A;  4X5T A;  3WTN A;  5AFN A;  2X00 D;  4UM3 A;  5HEJ A;  4ALX A;  3T4M A;  4UM1 A;  2BG9 C;  3U8K A;  3WTH A;  4BFQ A;  5CFB A;  5AFM B;  5LXB A;  3JAD A;  4IL4 A;  5AFK A;  4NZB A;  4XK9 A;  3UQ7 A;  4TWH A;  3WTO A;  4AFG A;  5HEG A;  5L4E A;  3ZKR A;  2XNT A;  4HFB A;  5IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...