1UX2A

X-ray structure of acetylcholine binding protein (achbp)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
207
structure length
207
Chain Sequence
VEFDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Nicotine and Carbamylcholine Binding to Nicotinic Acetylcholine Receptors as Studied in Achbp Crystal Structures
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Glycoprotein
total genus 51
structure length 207
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1ux2A00
5TVCA 3RQUA 3TLTA 3RI5A 2YMDA 2XNUA 2XQ4A 3WTKA 2XQ7A 2YKSA 4QABA 4TNVA 2X00D 4HFIA 4UM3P 5HEOA 5IUXA 5AFKA 1UX2A 4UXUA 3ZKRA 2BYPA 2XNVA 3U8NA 3WTNA 5J5GA 2PGZA 4FRRA 3RIAA 2WNCA 2Y7YA 5J5FA 3WTHA 3JAFA 3UU4A 5HEUA 5HEHA 4ZK4A 2ZJUA 4IL9A 3RQWA 5AFNA 4AFTA 2Y57A 4NZBA 2XQ6A 2XZ6A 3U8LA 3EAMA 3TLUA 3UQ7A 2BG9C 4BQTA 3RHWA 2Y56A 3P50A 2BG9E 4HFHA 3WTJA 3RIFA 3SIOA 2Y58A 2WNJA 4QH4A 3EHZA 4Z91A 2XQAA 3WTOA 4QH1A 2VL0A 4BFQA 5HEGA 3PEOA 3P4WA 3WTMA 3WTLA 2XQ8A 4TWDA 4HQPA 5HCMA 4A98A 4ILAA 3WTIA 5CFBA 2X00A 4EZ1A 4TWHA 3LSVA 2XYTA 3U8KA 5AFHA 5HCJA 3ZDHA 5BP0A 4AFHA 3SQ6A 2BYNA 3WIPA 2XQ3A 5AFLA 4LMKA 4QACA 2ZJVA 4ILBA 4XK9A 2BJ0A 4XHEA 4A97A 2WN9A 2WZYA 4ZR6A 4DBMA 1I9BA 3EI0A 4PIRA 2YN6A 5FJVA 4Z90A 2WNLA 5BW2A 4TNWA 3UU5A 3T4MA 2BYRA 3UQ4A 3UU6A 4HFCA 4UM1A 4LMJA 4ZRUA 5KE4A 1UW6A 5HEJA 4QAAA 3UU3A 1UV6A 3JADA 4UY2A 3UU8A 4ZZCA 2BG9B 5BRXA 4AFGA 2BR7A 2YMEA 3SQ9A 2YOEA 4HFBA 2C9TA 5L4EA 2W8FA 3TLSA 4ZK1A 2QC1B 3SH1A 4ZZBA 3C79A 4F8HA 5KZUA 2UZ6A 5SYOA 4UM3S 4NPPA 2BG9A 4ZJTA 4X5TA 4ZJSA 5AFMB 5LXBA 5J5IA 3TLVA 5L4HA 4ALXA 4QH5A 3U8MA 2Y54A 4COFA 3U8JA 2XQ5A 3C84A 2XYSA 2BYQA 5AINA 3PMZA 5LG3A 3TLWA 5AFMA 5J5HA 2XNTA 3GUAA 4HFDA 4D01A 5CO5A 3UUBA 5L47A 4HFEA 4TWFA 4WV9A 3IGQA 2BYSA 4ILCA 2XQ9A 4IREA 3ZDGA 4B5DA 4LMLA 2W8GA 2XZ5A 4IL4A 4UM3A 5AFJA 2PH9A 3JAEA 5JMEA 2BR8A 5J0ZA
chains in the Genus database with same CATH superfamily
5TVCA 3RQUA 3TLTA 3RI5A 2YMDA 2XNUA 2XQ4A 3WTKA 2XQ7A 2YKSA 4QABA 4TNVA 2X00D 4HFIA 4UM3P 5HEOA 5IUXA 5AFKA 1UX2A 4UXUA 3ZKRA 2BYPA 2XNVA 3U8NA 3WTNA 5J5GA 2PGZA 4FRRA 3RIAA 2WNCA 2Y7YA 5J5FA 3WTHA 3JAFA 3UU4A 5HEUA 5HEHA 4ZK4A 2ZJUA 4IL9A 3RQWA 5AFNA 4AFTA 2Y57A 4NZBA 2XQ6A 2XZ6A 3U8LA 3EAMA 3TLUA 3UQ7A 2BG9C 4BQTA 3RHWA 2Y56A 3P50A 2BG9E 4HFHA 3WTJA 3RIFA 3SIOA 2Y58A 2WNJA 4QH4A 3EHZA 4Z91A 2XQAA 3WTOA 4QH1A 2VL0A 4BFQA 5HEGA 3PEOA 3P4WA 3WTMA 3WTLA 2XQ8A 4TWDA 4HQPA 5HCMA 4A98A 4ILAA 3WTIA 5CFBA 2X00A 4EZ1A 4TWHA 3LSVA 2XYTA 3U8KA 5AFHA 5HCJA 3ZDHA 5BP0A 4AFHA 3SQ6A 2BYNA 3WIPA 2XQ3A 5AFLA 4LMKA 4QACA 2ZJVA 4ILBA 4XK9A 2BJ0A 4XHEA 4A97A 2WN9A 2WZYA 4ZR6A 4DBMA 1I9BA 3EI0A 4PIRA 2YN6A 5FJVA 4Z90A 2WNLA 5BW2A 4TNWA 3UU5A 3T4MA 2BYRA 3UQ4A 3UU6A 4HFCA 4UM1A 4LMJA 4ZRUA 5KE4A 1UW6A 5HEJA 4QAAA 3UU3A 1UV6A 3JADA 4UY2A 3UU8A 4ZZCA 2BG9B 5BRXA 4AFGA 2BR7A 2YMEA 3SQ9A 2YOEA 4HFBA 2C9TA 5L4EA 2W8FA 3TLSA 4ZK1A 2QC1B 3SH1A 4ZZBA 3C79A 4F8HA 5KZUA 2UZ6A 5SYOA 4UM3S 4NPPA 2BG9A 4ZJTA 4X5TA 4ZJSA 5AFMB 5LXBA 5J5IA 3TLVA 5L4HA 4ALXA 4QH5A 3U8MA 2Y54A 4COFA 3U8JA 2XQ5A 3C84A 2XYSA 2BYQA 5AINA 3PMZA 5LG3A 3TLWA 5AFMA 5J5HA 2XNTA 3GUAA 4HFDA 4D01A 5CO5A 3UUBA 5L47A 4HFEA 4TWFA 4WV9A 3IGQA 2BYSA 4ILCA 2XQ9A 4IREA 3ZDGA 4B5DA 4LMLA 2W8GA 2XZ5A 4IL4A 4UM3A 5AFJA 2PH9A 3JAEA 5JMEA 2BR8A 5J0ZA
chains in the Genus database with same CATH topology
5TVCA 3RQUA 3TLTA 3RI5A 2YMDA 2XNUA 2XQ4A 3WTKA 2XQ7A 2YKSA 4QABA 4TNVA 2X00D 4HFIA 4UM3P 5HEOA 5IUXA 5AFKA 1UX2A 4UXUA 3ZKRA 2BYPA 2XNVA 3U8NA 3WTNA 5J5GA 2PGZA 4FRRA 3RIAA 2WNCA 2Y7YA 5J5FA 3WTHA 3JAFA 3UU4A 5HEUA 5HEHA 4ZK4A 2ZJUA 4IL9A 3RQWA 5AFNA 4AFTA 2Y57A 4NZBA 2XQ6A 2XZ6A 3U8LA 3EAMA 3TLUA 3UQ7A 2BG9C 4BQTA 3RHWA 2Y56A 3P50A 2BG9E 4HFHA 3WTJA 3RIFA 3SIOA 2Y58A 2WNJA 4QH4A 3EHZA 4Z91A 2XQAA 3WTOA 4QH1A 2VL0A 4BFQA 5HEGA 3PEOA 3P4WA 3WTMA 3WTLA 2XQ8A 4TWDA 4HQPA 5HCMA 4A98A 4ILAA 3WTIA 5CFBA 2X00A 4EZ1A 4TWHA 3LSVA 2XYTA 3U8KA 5AFHA 5HCJA 3ZDHA 5BP0A 4AFHA 3SQ6A 2BYNA 3WIPA 2XQ3A 5AFLA 4LMKA 4QACA 2ZJVA 4ILBA 4XK9A 2BJ0A 4XHEA 4A97A 2WN9A 2WZYA 4ZR6A 4DBMA 1I9BA 3EI0A 4PIRA 2YN6A 5FJVA 4Z90A 2WNLA 5BW2A 4TNWA 3UU5A 3T4MA 2BYRA 3UQ4A 3UU6A 4HFCA 4UM1A 4LMJA 4ZRUA 5KE4A 1UW6A 5HEJA 4QAAA 3UU3A 1UV6A 3JADA 4UY2A 3UU8A 4ZZCA 2BG9B 5BRXA 4AFGA 2BR7A 2YMEA 3SQ9A 2YOEA 4HFBA 2C9TA 5L4EA 2W8FA 3TLSA 4ZK1A 2QC1B 3SH1A 4ZZBA 3C79A 4F8HA 5KZUA 2UZ6A 5SYOA 4UM3S 4NPPA 2BG9A 4ZJTA 4X5TA 4ZJSA 5AFMB 5LXBA 5J5IA 3TLVA 5L4HA 4ALXA 4QH5A 3U8MA 2Y54A 4COFA 3U8JA 2XQ5A 3C84A 2XYSA 2BYQA 5AINA 3PMZA 5LG3A 3TLWA 5AFMA 5J5HA 2XNTA 3GUAA 4HFDA 4D01A 5CO5A 3UUBA 5L47A 4HFEA 4TWFA 4WV9A 3IGQA 2BYSA 4ILCA 2XQ9A 4IREA 3ZDGA 4B5DA 4LMLA 2W8GA 2XZ5A 4IL4A 4UM3A 5AFJA 2PH9A 3JAEA 5JMEA 2BR8A 5J0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TVC A;  3RQU A;  3TLT A;  3RI5 A;  2YMD A;  2XNU A;  2XQ4 A;  3WTK A;  2XQ7 A;  2YKS A;  4QAB A;  4TNV A;  2X00 D;  4HFI A;  4UM3 P;  5HEO A;  5IUX A;  5AFK A;  1UX2 A;  4UXU A;  3ZKR A;  2BYP A;  2XNV A;  3U8N A;  3WTN A;  5J5G A;  2PGZ A;  4FRR A;  3RIA A;  2WNC A;  2Y7Y A;  5J5F A;  3WTH A;  3JAF A;  3UU4 A;  5HEU A;  5HEH A;  4ZK4 A;  2ZJU A;  4IL9 A;  3RQW A;  5AFN A;  4AFT A;  2Y57 A;  4NZB A;  2XQ6 A;  2XZ6 A;  3U8L A;  3EAM A;  3TLU A;  3UQ7 A;  2BG9 C;  4BQT A;  3RHW A;  2Y56 A;  3P50 A;  2BG9 E;  4HFH A;  3WTJ A;  3RIF A;  3SIO A;  2Y58 A;  2WNJ A;  4QH4 A;  3EHZ A;  4Z91 A;  2XQA A;  3WTO A;  4QH1 A;  2VL0 A;  4BFQ A;  5HEG A;  3PEO A;  3P4W A;  3WTM A;  3WTL A;  2XQ8 A;  4TWD A;  4HQP A;  5HCM A;  4A98 A;  4ILA A;  3WTI A;  5CFB A;  2X00 A;  4EZ1 A;  4TWH A;  3LSV A;  2XYT A;  3U8K A;  5AFH A;  5HCJ A;  3ZDH A;  5BP0 A;  4AFH A;  3SQ6 A;  2BYN A;  3WIP A;  2XQ3 A;  5AFL A;  4LMK A;  4QAC A;  2ZJV A;  4ILB A;  4XK9 A;  2BJ0 A;  4XHE A;  4A97 A;  2WN9 A;  2WZY A;  4ZR6 A;  4DBM A;  1I9B A;  3EI0 A;  4PIR A;  2YN6 A;  5FJV A;  4Z90 A;  2WNL A;  5BW2 A;  4TNW A;  3UU5 A;  3T4M A;  2BYR A;  3UQ4 A;  3UU6 A;  4HFC A;  4UM1 A;  4LMJ A;  4ZRU A;  5KE4 A;  1UW6 A;  5HEJ A;  4QAA A;  3UU3 A;  1UV6 A;  3JAD A;  4UY2 A;  3UU8 A;  4ZZC A;  2BG9 B;  5BRX A;  4AFG A;  2BR7 A;  2YME A;  3SQ9 A;  2YOE A;  4HFB A;  2C9T A;  5L4E A;  2W8F A;  3TLS A;  4ZK1 A;  2QC1 B;  3SH1 A;  4ZZB A;  3C79 A;  4F8H A;  5KZU A;  2UZ6 A;  5SYO A;  4UM3 S;  4NPP A;  2BG9 A;  4ZJT A;  4X5T A;  4ZJS A;  5AFM B;  5LXB A;  5J5I A;  3TLV A;  5L4H A;  4ALX A;  4QH5 A;  3U8M A;  2Y54 A;  4COF A;  3U8J A;  2XQ5 A;  3C84 A;  2XYS A;  2BYQ A;  5AIN A;  3PMZ A;  5LG3 A;  3TLW A;  5AFM A;  5J5H A;  2XNT A;  3GUA A;  4HFD A;  4D01 A;  5CO5 A;  3UUB A;  5L47 A;  4HFE A;  4TWF A;  4WV9 A;  3IGQ A;  2BYS A;  4ILC A;  2XQ9 A;  4IRE A;  3ZDG A;  4B5D A;  4LML A;  2W8G A;  2XZ5 A;  4IL4 A;  4UM3 A;  5AFJ A;  2PH9 A;  3JAE A;  5JME A;  2BR8 A;  5J0Z A; 
#chains in the Genus database with same CATH topology
 5TVC A;  3RQU A;  3TLT A;  3RI5 A;  2YMD A;  2XNU A;  2XQ4 A;  3WTK A;  2XQ7 A;  2YKS A;  4QAB A;  4TNV A;  2X00 D;  4HFI A;  4UM3 P;  5HEO A;  5IUX A;  5AFK A;  1UX2 A;  4UXU A;  3ZKR A;  2BYP A;  2XNV A;  3U8N A;  3WTN A;  5J5G A;  2PGZ A;  4FRR A;  3RIA A;  2WNC A;  2Y7Y A;  5J5F A;  3WTH A;  3JAF A;  3UU4 A;  5HEU A;  5HEH A;  4ZK4 A;  2ZJU A;  4IL9 A;  3RQW A;  5AFN A;  4AFT A;  2Y57 A;  4NZB A;  2XQ6 A;  2XZ6 A;  3U8L A;  3EAM A;  3TLU A;  3UQ7 A;  2BG9 C;  4BQT A;  3RHW A;  2Y56 A;  3P50 A;  2BG9 E;  4HFH A;  3WTJ A;  3RIF A;  3SIO A;  2Y58 A;  2WNJ A;  4QH4 A;  3EHZ A;  4Z91 A;  2XQA A;  3WTO A;  4QH1 A;  2VL0 A;  4BFQ A;  5HEG A;  3PEO A;  3P4W A;  3WTM A;  3WTL A;  2XQ8 A;  4TWD A;  4HQP A;  5HCM A;  4A98 A;  4ILA A;  3WTI A;  5CFB A;  2X00 A;  4EZ1 A;  4TWH A;  3LSV A;  2XYT A;  3U8K A;  5AFH A;  5HCJ A;  3ZDH A;  5BP0 A;  4AFH A;  3SQ6 A;  2BYN A;  3WIP A;  2XQ3 A;  5AFL A;  4LMK A;  4QAC A;  2ZJV A;  4ILB A;  4XK9 A;  2BJ0 A;  4XHE A;  4A97 A;  2WN9 A;  2WZY A;  4ZR6 A;  4DBM A;  1I9B A;  3EI0 A;  4PIR A;  2YN6 A;  5FJV A;  4Z90 A;  2WNL A;  5BW2 A;  4TNW A;  3UU5 A;  3T4M A;  2BYR A;  3UQ4 A;  3UU6 A;  4HFC A;  4UM1 A;  4LMJ A;  4ZRU A;  5KE4 A;  1UW6 A;  5HEJ A;  4QAA A;  3UU3 A;  1UV6 A;  3JAD A;  4UY2 A;  3UU8 A;  4ZZC A;  2BG9 B;  5BRX A;  4AFG A;  2BR7 A;  2YME A;  3SQ9 A;  2YOE A;  4HFB A;  2C9T A;  5L4E A;  2W8F A;  3TLS A;  4ZK1 A;  2QC1 B;  3SH1 A;  4ZZB A;  3C79 A;  4F8H A;  5KZU A;  2UZ6 A;  5SYO A;  4UM3 S;  4NPP A;  2BG9 A;  4ZJT A;  4X5T A;  4ZJS A;  5AFM B;  5LXB A;  5J5I A;  3TLV A;  5L4H A;  4ALX A;  4QH5 A;  3U8M A;  2Y54 A;  4COF A;  3U8J A;  2XQ5 A;  3C84 A;  2XYS A;  2BYQ A;  5AIN A;  3PMZ A;  5LG3 A;  3TLW A;  5AFM A;  5J5H A;  2XNT A;  3GUA A;  4HFD A;  4D01 A;  5CO5 A;  3UUB A;  5L47 A;  4HFE A;  4TWF A;  4WV9 A;  3IGQ A;  2BYS A;  4ILC A;  2XQ9 A;  4IRE A;  3ZDG A;  4B5D A;  4LML A;  2W8G A;  2XZ5 A;  4IL4 A;  4UM3 A;  5AFJ A;  2PH9 A;  3JAE A;  5JME A;  2BR8 A;  5J0Z A; 
#chains in the Genus database with same CATH homology
 5TVC A;  3RQU A;  3TLT A;  3RI5 A;  2YMD A;  2XNU A;  2XQ4 A;  3WTK A;  2XQ7 A;  2YKS A;  4QAB A;  4TNV A;  2X00 D;  4HFI A;  4UM3 P;  5HEO A;  5IUX A;  5AFK A;  1UX2 A;  4UXU A;  3ZKR A;  2BYP A;  2XNV A;  3U8N A;  3WTN A;  5J5G A;  2PGZ A;  4FRR A;  3RIA A;  2WNC A;  2Y7Y A;  5J5F A;  3WTH A;  3JAF A;  3UU4 A;  5HEU A;  5HEH A;  4ZK4 A;  2ZJU A;  4IL9 A;  3RQW A;  5AFN A;  4AFT A;  2Y57 A;  4NZB A;  2XQ6 A;  2XZ6 A;  3U8L A;  3EAM A;  3TLU A;  3UQ7 A;  2BG9 C;  4BQT A;  3RHW A;  2Y56 A;  3P50 A;  2BG9 E;  4HFH A;  3WTJ A;  3RIF A;  3SIO A;  2Y58 A;  2WNJ A;  4QH4 A;  3EHZ A;  4Z91 A;  2XQA A;  3WTO A;  4QH1 A;  2VL0 A;  4BFQ A;  5HEG A;  3PEO A;  3P4W A;  3WTM A;  3WTL A;  2XQ8 A;  4TWD A;  4HQP A;  5HCM A;  4A98 A;  4ILA A;  3WTI A;  5CFB A;  2X00 A;  4EZ1 A;  4TWH A;  3LSV A;  2XYT A;  3U8K A;  5AFH A;  5HCJ A;  3ZDH A;  5BP0 A;  4AFH A;  3SQ6 A;  2BYN A;  3WIP A;  2XQ3 A;  5AFL A;  4LMK A;  4QAC A;  2ZJV A;  4ILB A;  4XK9 A;  2BJ0 A;  4XHE A;  4A97 A;  2WN9 A;  2WZY A;  4ZR6 A;  4DBM A;  1I9B A;  3EI0 A;  4PIR A;  2YN6 A;  5FJV A;  4Z90 A;  2WNL A;  5BW2 A;  4TNW A;  3UU5 A;  3T4M A;  2BYR A;  3UQ4 A;  3UU6 A;  4HFC A;  4UM1 A;  4LMJ A;  4ZRU A;  5KE4 A;  1UW6 A;  5HEJ A;  4QAA A;  3UU3 A;  1UV6 A;  3JAD A;  4UY2 A;  3UU8 A;  4ZZC A;  2BG9 B;  5BRX A;  4AFG A;  2BR7 A;  2YME A;  3SQ9 A;  2YOE A;  4HFB A;  2C9T A;  5L4E A;  2W8F A;  3TLS A;  4ZK1 A;  2QC1 B;  3SH1 A;  4ZZB A;  3C79 A;  4F8H A;  5KZU A;  2UZ6 A;  5SYO A;  4UM3 S;  4NPP A;  2BG9 A;  4ZJT A;  4X5T A;  4ZJS A;  5AFM B;  5LXB A;  5J5I A;  3TLV A;  5L4H A;  4ALX A;  4QH5 A;  3U8M A;  2Y54 A;  4COF A;  3U8J A;  2XQ5 A;  3C84 A;  2XYS A;  2BYQ A;  5AIN A;  3PMZ A;  5LG3 A;  3TLW A;  5AFM A;  5J5H A;  2XNT A;  3GUA A;  4HFD A;  4D01 A;  5CO5 A;  3UUB A;  5L47 A;  4HFE A;  4TWF A;  4WV9 A;  3IGQ A;  2BYS A;  4ILC A;  2XQ9 A;  4IRE A;  3ZDG A;  4B5D A;  4LML A;  2W8G A;  2XZ5 A;  4IL4 A;  4UM3 A;  5AFJ A;  2PH9 A;  3JAE A;  5JME A;  2BR8 A;  5J0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...