3WTHA

Crystal structure of lymnaea stagnalis acetylcholine-binding protein q55r mutant complexed with imidacloprid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 50
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wthA00
3EHZA 4HFHA 3RQUA 2XYTA 4Z91A 5HCMA 2XZ6A 2X00A 2BYNA 4BFQA 2C9TA 2WN9A 2BYPA 5LXBA 2Y7YA 4TWDA 2YMEA 4HFIA 2XQ6A 2BYSA 3UUBA 4B5DA 2PGZA 2BG9B 3IGQA 5AFMA 3RI5A 3U8KA 4A97A 5IUXA 2XNUA 5TVCA 4LMKA 3WTIA 5JMEA 3EAMA 5HCJA 4QH4A 4HFCA 3U8LA 4IL9A 4A98A 5J5HA 2XQ5A 4ILAA 2X00D 2XQAA 3UU4A 4AFTA 2ZJUA 3ZDGA 2Y56A 4HQPA 2BG9E 3WTJA 4TNWA 4D01A 2W8GA 4TNVA 4COFA 2YMDA 5SYOA 3C84A 5HEJA 4LMLA 2YN6A 2BR8A 5AFJA 3RIFA 4ZRUA 4LMJA 5LG3A 4ALXA 3P50A 4BQTA 4AFHA 2PH9A 3TLVA 3UU3A 2XZ5A 3GUAA 4UM3A 2XQ4A 3WIPA 4F8HA 4UM1A 2WNCA 4UXUA 4X5TA 5HEUA 5BRXA 2XQ7A 3UU5A 3PEOA 5J5FA 2XNTA 2YKSA 2WNLA 3SIOA 3UU6A 1UX2A 2WZYA 5AFLA 4HFEA 4QABA 2XQ8A 3LSVA 4TWFA 2YOEA 3JAFA 4ZR6A 2BYRA 5HEOA 3SQ6A 5L4EA 3JAEA 2W8FA 5CFBA 4UY2A 3PMZA 2Y54A 5J5IA 3U8MA 5AFHA 3WTLA 1UW6A 3JADA 3SQ9A 3TLTA 3UQ4A 2XYSA 4TWHA 4ZK1A 4AFGA 3WTHA 3UU8A 3EI0A 4EZ1A 4ILCA 2Y57A 2QC1B 5AFNA 3SH1A 5CO5A 5J0ZA 3WTOA 4ZZCA 3C79A 2BG9A 3RIAA 3RQWA 5HEGA 2VL0A 2BG9C 4IL4A 5AFKA 5KE4A 1UV6A 3U8NA 2BYQA 4ILBA 4Z90A 3WTNA 4UM3S 2XQ3A 4QH1A 5HEHA 5AFMB 3RHWA 3ZKRA 4HFDA 4NPPA 4QACA 3WTMA 5L47A 2UZ6A 2ZJVA 3P4WA 3TLWA 3UQ7A 5BP0A 3ZDHA 4PIRA 3T4MA 2XQ9A 2XNVA 3U8JA 4QH5A 4QAAA 2BR7A 4UM3P 5KZUA 4NZBA 4ZK4A 4IREA 2WNJA 4HFBA 3WTKA 4DBMA 5J5GA 4ZJSA 5BW2A 4XHEA 4FRRA 1I9BA 2BJ0A 3TLUA 5AINA 5FJVA 5L4HA 4XK9A 3TLSA 4ZJTA 4WV9A 4ZZBA 2Y58A
chains in the Genus database with same CATH superfamily
3EHZA 4HFHA 3RQUA 2XYTA 4Z91A 5HCMA 2XZ6A 2X00A 2BYNA 4BFQA 2C9TA 2WN9A 2BYPA 5LXBA 2Y7YA 4TWDA 2YMEA 4HFIA 2XQ6A 2BYSA 3UUBA 4B5DA 2PGZA 2BG9B 3IGQA 5AFMA 3RI5A 3U8KA 4A97A 5IUXA 2XNUA 5TVCA 4LMKA 3WTIA 5JMEA 3EAMA 5HCJA 4QH4A 4HFCA 3U8LA 4IL9A 4A98A 5J5HA 2XQ5A 4ILAA 2X00D 2XQAA 3UU4A 4AFTA 2ZJUA 3ZDGA 2Y56A 4HQPA 2BG9E 3WTJA 4TNWA 4D01A 2W8GA 4TNVA 4COFA 2YMDA 5SYOA 3C84A 5HEJA 4LMLA 2YN6A 2BR8A 5AFJA 3RIFA 4ZRUA 4LMJA 5LG3A 4ALXA 3P50A 4BQTA 4AFHA 2PH9A 3TLVA 3UU3A 2XZ5A 3GUAA 4UM3A 2XQ4A 3WIPA 4F8HA 4UM1A 2WNCA 4UXUA 4X5TA 5HEUA 5BRXA 2XQ7A 3UU5A 3PEOA 5J5FA 2XNTA 2YKSA 2WNLA 3SIOA 3UU6A 1UX2A 2WZYA 5AFLA 4HFEA 4QABA 2XQ8A 3LSVA 4TWFA 2YOEA 3JAFA 4ZR6A 2BYRA 5HEOA 3SQ6A 5L4EA 3JAEA 2W8FA 5CFBA 4UY2A 3PMZA 2Y54A 5J5IA 3U8MA 5AFHA 3WTLA 1UW6A 3JADA 3SQ9A 3TLTA 3UQ4A 2XYSA 4TWHA 4ZK1A 4AFGA 3WTHA 3UU8A 3EI0A 4EZ1A 4ILCA 2Y57A 2QC1B 5AFNA 3SH1A 5CO5A 5J0ZA 3WTOA 4ZZCA 3C79A 2BG9A 3RIAA 3RQWA 5HEGA 2VL0A 2BG9C 4IL4A 5AFKA 5KE4A 1UV6A 3U8NA 2BYQA 4ILBA 4Z90A 3WTNA 4UM3S 2XQ3A 4QH1A 5HEHA 5AFMB 3RHWA 3ZKRA 4HFDA 4NPPA 4QACA 3WTMA 5L47A 2UZ6A 2ZJVA 3P4WA 3TLWA 3UQ7A 5BP0A 3ZDHA 4PIRA 3T4MA 2XQ9A 2XNVA 3U8JA 4QH5A 4QAAA 2BR7A 4UM3P 5KZUA 4NZBA 4ZK4A 4IREA 2WNJA 4HFBA 3WTKA 4DBMA 5J5GA 4ZJSA 5BW2A 4XHEA 4FRRA 1I9BA 2BJ0A 3TLUA 5AINA 5FJVA 5L4HA 4XK9A 3TLSA 4ZJTA 4WV9A 4ZZBA 2Y58A
chains in the Genus database with same CATH topology
3EHZA 4HFHA 3RQUA 2XYTA 4Z91A 5HCMA 2XZ6A 2X00A 2BYNA 4BFQA 2C9TA 2WN9A 2BYPA 5LXBA 2Y7YA 4TWDA 2YMEA 4HFIA 2XQ6A 2BYSA 3UUBA 4B5DA 2PGZA 2BG9B 3IGQA 5AFMA 3RI5A 3U8KA 4A97A 5IUXA 2XNUA 5TVCA 4LMKA 3WTIA 5JMEA 3EAMA 5HCJA 4QH4A 4HFCA 3U8LA 4IL9A 4A98A 5J5HA 2XQ5A 4ILAA 2X00D 2XQAA 3UU4A 4AFTA 2ZJUA 3ZDGA 2Y56A 4HQPA 2BG9E 3WTJA 4TNWA 4D01A 2W8GA 4TNVA 4COFA 2YMDA 5SYOA 3C84A 5HEJA 4LMLA 2YN6A 2BR8A 5AFJA 3RIFA 4ZRUA 4LMJA 5LG3A 4ALXA 3P50A 4BQTA 4AFHA 2PH9A 3TLVA 3UU3A 2XZ5A 3GUAA 4UM3A 2XQ4A 3WIPA 4F8HA 4UM1A 2WNCA 4UXUA 4X5TA 5HEUA 5BRXA 2XQ7A 3UU5A 3PEOA 5J5FA 2XNTA 2YKSA 2WNLA 3SIOA 3UU6A 1UX2A 2WZYA 5AFLA 4HFEA 4QABA 2XQ8A 3LSVA 4TWFA 2YOEA 3JAFA 4ZR6A 2BYRA 5HEOA 3SQ6A 5L4EA 3JAEA 2W8FA 5CFBA 4UY2A 3PMZA 2Y54A 5J5IA 3U8MA 5AFHA 3WTLA 1UW6A 3JADA 3SQ9A 3TLTA 3UQ4A 2XYSA 4TWHA 4ZK1A 4AFGA 3WTHA 3UU8A 3EI0A 4EZ1A 4ILCA 2Y57A 2QC1B 5AFNA 3SH1A 5CO5A 5J0ZA 3WTOA 4ZZCA 3C79A 2BG9A 3RIAA 3RQWA 5HEGA 2VL0A 2BG9C 4IL4A 5AFKA 5KE4A 1UV6A 3U8NA 2BYQA 4ILBA 4Z90A 3WTNA 4UM3S 2XQ3A 4QH1A 5HEHA 5AFMB 3RHWA 3ZKRA 4HFDA 4NPPA 4QACA 3WTMA 5L47A 2UZ6A 2ZJVA 3P4WA 3TLWA 3UQ7A 5BP0A 3ZDHA 4PIRA 3T4MA 2XQ9A 2XNVA 3U8JA 4QH5A 4QAAA 2BR7A 4UM3P 5KZUA 4NZBA 4ZK4A 4IREA 2WNJA 4HFBA 3WTKA 4DBMA 5J5GA 4ZJSA 5BW2A 4XHEA 4FRRA 1I9BA 2BJ0A 3TLUA 5AINA 5FJVA 5L4HA 4XK9A 3TLSA 4ZJTA 4WV9A 4ZZBA 2Y58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHZ A;  4HFH A;  3RQU A;  2XYT A;  4Z91 A;  5HCM A;  2XZ6 A;  2X00 A;  2BYN A;  4BFQ A;  2C9T A;  2WN9 A;  2BYP A;  5LXB A;  2Y7Y A;  4TWD A;  2YME A;  4HFI A;  2XQ6 A;  2BYS A;  3UUB A;  4B5D A;  2PGZ A;  2BG9 B;  3IGQ A;  5AFM A;  3RI5 A;  3U8K A;  4A97 A;  5IUX A;  2XNU A;  5TVC A;  4LMK A;  3WTI A;  5JME A;  3EAM A;  5HCJ A;  4QH4 A;  4HFC A;  3U8L A;  4IL9 A;  4A98 A;  5J5H A;  2XQ5 A;  4ILA A;  2X00 D;  2XQA A;  3UU4 A;  4AFT A;  2ZJU A;  3ZDG A;  2Y56 A;  4HQP A;  2BG9 E;  3WTJ A;  4TNW A;  4D01 A;  2W8G A;  4TNV A;  4COF A;  2YMD A;  5SYO A;  3C84 A;  5HEJ A;  4LML A;  2YN6 A;  2BR8 A;  5AFJ A;  3RIF A;  4ZRU A;  4LMJ A;  5LG3 A;  4ALX A;  3P50 A;  4BQT A;  4AFH A;  2PH9 A;  3TLV A;  3UU3 A;  2XZ5 A;  3GUA A;  4UM3 A;  2XQ4 A;  3WIP A;  4F8H A;  4UM1 A;  2WNC A;  4UXU A;  4X5T A;  5HEU A;  5BRX A;  2XQ7 A;  3UU5 A;  3PEO A;  5J5F A;  2XNT A;  2YKS A;  2WNL A;  3SIO A;  3UU6 A;  1UX2 A;  2WZY A;  5AFL A;  4HFE A;  4QAB A;  2XQ8 A;  3LSV A;  4TWF A;  2YOE A;  3JAF A;  4ZR6 A;  2BYR A;  5HEO A;  3SQ6 A;  5L4E A;  3JAE A;  2W8F A;  5CFB A;  4UY2 A;  3PMZ A;  2Y54 A;  5J5I A;  3U8M A;  5AFH A;  3WTL A;  1UW6 A;  3JAD A;  3SQ9 A;  3TLT A;  3UQ4 A;  2XYS A;  4TWH A;  4ZK1 A;  4AFG A;  3WTH A;  3UU8 A;  3EI0 A;  4EZ1 A;  4ILC A;  2Y57 A;  2QC1 B;  5AFN A;  3SH1 A;  5CO5 A;  5J0Z A;  3WTO A;  4ZZC A;  3C79 A;  2BG9 A;  3RIA A;  3RQW A;  5HEG A;  2VL0 A;  2BG9 C;  4IL4 A;  5AFK A;  5KE4 A;  1UV6 A;  3U8N A;  2BYQ A;  4ILB A;  4Z90 A;  3WTN A;  4UM3 S;  2XQ3 A;  4QH1 A;  5HEH A;  5AFM B;  3RHW A;  3ZKR A;  4HFD A;  4NPP A;  4QAC A;  3WTM A;  5L47 A;  2UZ6 A;  2ZJV A;  3P4W A;  3TLW A;  3UQ7 A;  5BP0 A;  3ZDH A;  4PIR A;  3T4M A;  2XQ9 A;  2XNV A;  3U8J A;  4QH5 A;  4QAA A;  2BR7 A;  4UM3 P;  5KZU A;  4NZB A;  4ZK4 A;  4IRE A;  2WNJ A;  4HFB A;  3WTK A;  4DBM A;  5J5G A;  4ZJS A;  5BW2 A;  4XHE A;  4FRR A;  1I9B A;  2BJ0 A;  3TLU A;  5AIN A;  5FJV A;  5L4H A;  4XK9 A;  3TLS A;  4ZJT A;  4WV9 A;  4ZZB A;  2Y58 A; 
#chains in the Genus database with same CATH topology
 3EHZ A;  4HFH A;  3RQU A;  2XYT A;  4Z91 A;  5HCM A;  2XZ6 A;  2X00 A;  2BYN A;  4BFQ A;  2C9T A;  2WN9 A;  2BYP A;  5LXB A;  2Y7Y A;  4TWD A;  2YME A;  4HFI A;  2XQ6 A;  2BYS A;  3UUB A;  4B5D A;  2PGZ A;  2BG9 B;  3IGQ A;  5AFM A;  3RI5 A;  3U8K A;  4A97 A;  5IUX A;  2XNU A;  5TVC A;  4LMK A;  3WTI A;  5JME A;  3EAM A;  5HCJ A;  4QH4 A;  4HFC A;  3U8L A;  4IL9 A;  4A98 A;  5J5H A;  2XQ5 A;  4ILA A;  2X00 D;  2XQA A;  3UU4 A;  4AFT A;  2ZJU A;  3ZDG A;  2Y56 A;  4HQP A;  2BG9 E;  3WTJ A;  4TNW A;  4D01 A;  2W8G A;  4TNV A;  4COF A;  2YMD A;  5SYO A;  3C84 A;  5HEJ A;  4LML A;  2YN6 A;  2BR8 A;  5AFJ A;  3RIF A;  4ZRU A;  4LMJ A;  5LG3 A;  4ALX A;  3P50 A;  4BQT A;  4AFH A;  2PH9 A;  3TLV A;  3UU3 A;  2XZ5 A;  3GUA A;  4UM3 A;  2XQ4 A;  3WIP A;  4F8H A;  4UM1 A;  2WNC A;  4UXU A;  4X5T A;  5HEU A;  5BRX A;  2XQ7 A;  3UU5 A;  3PEO A;  5J5F A;  2XNT A;  2YKS A;  2WNL A;  3SIO A;  3UU6 A;  1UX2 A;  2WZY A;  5AFL A;  4HFE A;  4QAB A;  2XQ8 A;  3LSV A;  4TWF A;  2YOE A;  3JAF A;  4ZR6 A;  2BYR A;  5HEO A;  3SQ6 A;  5L4E A;  3JAE A;  2W8F A;  5CFB A;  4UY2 A;  3PMZ A;  2Y54 A;  5J5I A;  3U8M A;  5AFH A;  3WTL A;  1UW6 A;  3JAD A;  3SQ9 A;  3TLT A;  3UQ4 A;  2XYS A;  4TWH A;  4ZK1 A;  4AFG A;  3WTH A;  3UU8 A;  3EI0 A;  4EZ1 A;  4ILC A;  2Y57 A;  2QC1 B;  5AFN A;  3SH1 A;  5CO5 A;  5J0Z A;  3WTO A;  4ZZC A;  3C79 A;  2BG9 A;  3RIA A;  3RQW A;  5HEG A;  2VL0 A;  2BG9 C;  4IL4 A;  5AFK A;  5KE4 A;  1UV6 A;  3U8N A;  2BYQ A;  4ILB A;  4Z90 A;  3WTN A;  4UM3 S;  2XQ3 A;  4QH1 A;  5HEH A;  5AFM B;  3RHW A;  3ZKR A;  4HFD A;  4NPP A;  4QAC A;  3WTM A;  5L47 A;  2UZ6 A;  2ZJV A;  3P4W A;  3TLW A;  3UQ7 A;  5BP0 A;  3ZDH A;  4PIR A;  3T4M A;  2XQ9 A;  2XNV A;  3U8J A;  4QH5 A;  4QAA A;  2BR7 A;  4UM3 P;  5KZU A;  4NZB A;  4ZK4 A;  4IRE A;  2WNJ A;  4HFB A;  3WTK A;  4DBM A;  5J5G A;  4ZJS A;  5BW2 A;  4XHE A;  4FRR A;  1I9B A;  2BJ0 A;  3TLU A;  5AIN A;  5FJV A;  5L4H A;  4XK9 A;  3TLS A;  4ZJT A;  4WV9 A;  4ZZB A;  2Y58 A; 
#chains in the Genus database with same CATH homology
 3EHZ A;  4HFH A;  3RQU A;  2XYT A;  4Z91 A;  5HCM A;  2XZ6 A;  2X00 A;  2BYN A;  4BFQ A;  2C9T A;  2WN9 A;  2BYP A;  5LXB A;  2Y7Y A;  4TWD A;  2YME A;  4HFI A;  2XQ6 A;  2BYS A;  3UUB A;  4B5D A;  2PGZ A;  2BG9 B;  3IGQ A;  5AFM A;  3RI5 A;  3U8K A;  4A97 A;  5IUX A;  2XNU A;  5TVC A;  4LMK A;  3WTI A;  5JME A;  3EAM A;  5HCJ A;  4QH4 A;  4HFC A;  3U8L A;  4IL9 A;  4A98 A;  5J5H A;  2XQ5 A;  4ILA A;  2X00 D;  2XQA A;  3UU4 A;  4AFT A;  2ZJU A;  3ZDG A;  2Y56 A;  4HQP A;  2BG9 E;  3WTJ A;  4TNW A;  4D01 A;  2W8G A;  4TNV A;  4COF A;  2YMD A;  5SYO A;  3C84 A;  5HEJ A;  4LML A;  2YN6 A;  2BR8 A;  5AFJ A;  3RIF A;  4ZRU A;  4LMJ A;  5LG3 A;  4ALX A;  3P50 A;  4BQT A;  4AFH A;  2PH9 A;  3TLV A;  3UU3 A;  2XZ5 A;  3GUA A;  4UM3 A;  2XQ4 A;  3WIP A;  4F8H A;  4UM1 A;  2WNC A;  4UXU A;  4X5T A;  5HEU A;  5BRX A;  2XQ7 A;  3UU5 A;  3PEO A;  5J5F A;  2XNT A;  2YKS A;  2WNL A;  3SIO A;  3UU6 A;  1UX2 A;  2WZY A;  5AFL A;  4HFE A;  4QAB A;  2XQ8 A;  3LSV A;  4TWF A;  2YOE A;  3JAF A;  4ZR6 A;  2BYR A;  5HEO A;  3SQ6 A;  5L4E A;  3JAE A;  2W8F A;  5CFB A;  4UY2 A;  3PMZ A;  2Y54 A;  5J5I A;  3U8M A;  5AFH A;  3WTL A;  1UW6 A;  3JAD A;  3SQ9 A;  3TLT A;  3UQ4 A;  2XYS A;  4TWH A;  4ZK1 A;  4AFG A;  3WTH A;  3UU8 A;  3EI0 A;  4EZ1 A;  4ILC A;  2Y57 A;  2QC1 B;  5AFN A;  3SH1 A;  5CO5 A;  5J0Z A;  3WTO A;  4ZZC A;  3C79 A;  2BG9 A;  3RIA A;  3RQW A;  5HEG A;  2VL0 A;  2BG9 C;  4IL4 A;  5AFK A;  5KE4 A;  1UV6 A;  3U8N A;  2BYQ A;  4ILB A;  4Z90 A;  3WTN A;  4UM3 S;  2XQ3 A;  4QH1 A;  5HEH A;  5AFM B;  3RHW A;  3ZKR A;  4HFD A;  4NPP A;  4QAC A;  3WTM A;  5L47 A;  2UZ6 A;  2ZJV A;  3P4W A;  3TLW A;  3UQ7 A;  5BP0 A;  3ZDH A;  4PIR A;  3T4M A;  2XQ9 A;  2XNV A;  3U8J A;  4QH5 A;  4QAA A;  2BR7 A;  4UM3 P;  5KZU A;  4NZB A;  4ZK4 A;  4IRE A;  2WNJ A;  4HFB A;  3WTK A;  4DBM A;  5J5G A;  4ZJS A;  5BW2 A;  4XHE A;  4FRR A;  1I9B A;  2BJ0 A;  3TLU A;  5AIN A;  5FJV A;  5L4H A;  4XK9 A;  3TLS A;  4ZJT A;  4WV9 A;  4ZZB A;  2Y58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...