4HQPA

Alpha7 nicotinic receptor chimera and its complex with alpha bungarotoxin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
202
structure length
202
Chain Sequence
QRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha7 nicotinic receptor chimera
publication title Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors
rcsb
source organism Homo sapiens, lymnaea stagnalis
molecule tags Protein binding
total genus 41
structure length 202
sequence length 202
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hqpA00
3WTKA 4HFDA 4UM3A 3JADA 2BYQA 3TLVA 5TVCA 2XQ4A 3SQ9A 2XQ6A 4PIRA 4AFHA 5J5IA 2XYTA 5HEUA 3UU6A 4D01A 5AFNA 3LSVA 5L47A 4UXUA 4BQTA 2YOEA 2X00D 4QH1A 2ZJUA 3SQ6A 4UM3S 2WZYA 2XYSA 3TLUA 3UU4A 4LMJA 3IGQA 4HFCA 5HEOA 2BG9A 3EAMA 4TWDA 5FJVA 2WN9A 3SIOA 3T4MA 4ILCA 5L4EA 3RIFA 2BG9C 2C9TA 4TNWA 3TLSA 4IL9A 4NPPA 2PH9A 2BG9E 5BP0A 5AFJA 3RQWA 5J5HA 3ZDGA 4X5TA 4ILBA 4TWFA 1UX2A 2XQ3A 5BW2A 2VL0A 5HCJA 2Y58A 4IREA 4DBMA 5BRXA 4HFIA 2ZJVA 2XQ9A 3P50A 4TNVA 4QAAA 3GUAA 4EZ1A 3SH1A 4WV9A 3U8NA 4UM1A 5HEJA 5KE4A 4XHEA 3WTIA 4AFTA 2X00A 4ZZCA 3WTOA 4UY2A 2XQ8A 2BJ0A 4NZBA 2Y56A 2XNTA 3TLWA 2YMDA 3UU8A 3UUBA 4QH5A 3RI5A 4BFQA 4QACA 3U8LA 5AFKA 3WTMA 3WTJA 2XQ7A 2XQAA 2XQ5A 2WNJA 3PEOA 3C84A 2PGZA 3UQ4A 5AFMA 2WNCA 3PMZA 2BYPA 4HQPA 3U8JA 4A98A 5SYOA 5AINA 2YKSA 2QC1B 4ZK1A 1UW6A 2BR8A 3WTLA 4QH4A 4HFHA 4ZZBA 2BYSA 3RHWA 2UZ6A 2XZ5A 5LG3A 2Y57A 4F8HA 2BG9B 4IL4A 2XNUA 3TLTA 4FRRA 3EHZA 3ZDHA 5KZUA 2Y7YA 4LMKA 4HFBA 5J0ZA 3U8KA 4B5DA 2XNVA 3JAFA 4TWHA 4ALXA 5HEHA 3UU3A 5AFHA 3UU5A 5J5FA 3C79A 2BYNA 5CO5A 3WIPA 5IUXA 4QABA 5AFLA 4ZK4A 2W8GA 3P4WA 2YMEA 2WNLA 4HFEA 4Z90A 4ZJSA 3RQUA 3WTNA 4ZJTA 3JAEA 5J5GA 4A97A 2Y54A 4LMLA 4Z91A 5JMEA 5AFMB 2W8FA 4ZRUA 1UV6A 5HCMA 3WTHA 2BYRA 4COFA 5L4HA 3EI0A 2YN6A 4UM3P 5HEGA 4AFGA 2BR7A 1I9BA 4ZR6A 3ZKRA 5LXBA 3RIAA 3UQ7A 4ILAA 3U8MA 5CFBA 2XZ6A 4XK9A
chains in the Genus database with same CATH superfamily
3WTKA 4HFDA 4UM3A 3JADA 2BYQA 3TLVA 5TVCA 2XQ4A 3SQ9A 2XQ6A 4PIRA 4AFHA 5J5IA 2XYTA 5HEUA 3UU6A 4D01A 5AFNA 3LSVA 5L47A 4UXUA 4BQTA 2YOEA 2X00D 4QH1A 2ZJUA 3SQ6A 4UM3S 2WZYA 2XYSA 3TLUA 3UU4A 4LMJA 3IGQA 4HFCA 5HEOA 2BG9A 3EAMA 4TWDA 5FJVA 2WN9A 3SIOA 3T4MA 4ILCA 5L4EA 3RIFA 2BG9C 2C9TA 4TNWA 3TLSA 4IL9A 4NPPA 2PH9A 2BG9E 5BP0A 5AFJA 3RQWA 5J5HA 3ZDGA 4X5TA 4ILBA 4TWFA 1UX2A 2XQ3A 5BW2A 2VL0A 5HCJA 2Y58A 4IREA 4DBMA 5BRXA 4HFIA 2ZJVA 2XQ9A 3P50A 4TNVA 4QAAA 3GUAA 4EZ1A 3SH1A 4WV9A 3U8NA 4UM1A 5HEJA 5KE4A 4XHEA 3WTIA 4AFTA 2X00A 4ZZCA 3WTOA 4UY2A 2XQ8A 2BJ0A 4NZBA 2Y56A 2XNTA 3TLWA 2YMDA 3UU8A 3UUBA 4QH5A 3RI5A 4BFQA 4QACA 3U8LA 5AFKA 3WTMA 3WTJA 2XQ7A 2XQAA 2XQ5A 2WNJA 3PEOA 3C84A 2PGZA 3UQ4A 5AFMA 2WNCA 3PMZA 2BYPA 4HQPA 3U8JA 4A98A 5SYOA 5AINA 2YKSA 2QC1B 4ZK1A 1UW6A 2BR8A 3WTLA 4QH4A 4HFHA 4ZZBA 2BYSA 3RHWA 2UZ6A 2XZ5A 5LG3A 2Y57A 4F8HA 2BG9B 4IL4A 2XNUA 3TLTA 4FRRA 3EHZA 3ZDHA 5KZUA 2Y7YA 4LMKA 4HFBA 5J0ZA 3U8KA 4B5DA 2XNVA 3JAFA 4TWHA 4ALXA 5HEHA 3UU3A 5AFHA 3UU5A 5J5FA 3C79A 2BYNA 5CO5A 3WIPA 5IUXA 4QABA 5AFLA 4ZK4A 2W8GA 3P4WA 2YMEA 2WNLA 4HFEA 4Z90A 4ZJSA 3RQUA 3WTNA 4ZJTA 3JAEA 5J5GA 4A97A 2Y54A 4LMLA 4Z91A 5JMEA 5AFMB 2W8FA 4ZRUA 1UV6A 5HCMA 3WTHA 2BYRA 4COFA 5L4HA 3EI0A 2YN6A 4UM3P 5HEGA 4AFGA 2BR7A 1I9BA 4ZR6A 3ZKRA 5LXBA 3RIAA 3UQ7A 4ILAA 3U8MA 5CFBA 2XZ6A 4XK9A
chains in the Genus database with same CATH topology
3WTKA 4HFDA 4UM3A 3JADA 2BYQA 3TLVA 5TVCA 2XQ4A 3SQ9A 2XQ6A 4PIRA 4AFHA 5J5IA 2XYTA 5HEUA 3UU6A 4D01A 5AFNA 3LSVA 5L47A 4UXUA 4BQTA 2YOEA 2X00D 4QH1A 2ZJUA 3SQ6A 4UM3S 2WZYA 2XYSA 3TLUA 3UU4A 4LMJA 3IGQA 4HFCA 5HEOA 2BG9A 3EAMA 4TWDA 5FJVA 2WN9A 3SIOA 3T4MA 4ILCA 5L4EA 3RIFA 2BG9C 2C9TA 4TNWA 3TLSA 4IL9A 4NPPA 2PH9A 2BG9E 5BP0A 5AFJA 3RQWA 5J5HA 3ZDGA 4X5TA 4ILBA 4TWFA 1UX2A 2XQ3A 5BW2A 2VL0A 5HCJA 2Y58A 4IREA 4DBMA 5BRXA 4HFIA 2ZJVA 2XQ9A 3P50A 4TNVA 4QAAA 3GUAA 4EZ1A 3SH1A 4WV9A 3U8NA 4UM1A 5HEJA 5KE4A 4XHEA 3WTIA 4AFTA 2X00A 4ZZCA 3WTOA 4UY2A 2XQ8A 2BJ0A 4NZBA 2Y56A 2XNTA 3TLWA 2YMDA 3UU8A 3UUBA 4QH5A 3RI5A 4BFQA 4QACA 3U8LA 5AFKA 3WTMA 3WTJA 2XQ7A 2XQAA 2XQ5A 2WNJA 3PEOA 3C84A 2PGZA 3UQ4A 5AFMA 2WNCA 3PMZA 2BYPA 4HQPA 3U8JA 4A98A 5SYOA 5AINA 2YKSA 2QC1B 4ZK1A 1UW6A 2BR8A 3WTLA 4QH4A 4HFHA 4ZZBA 2BYSA 3RHWA 2UZ6A 2XZ5A 5LG3A 2Y57A 4F8HA 2BG9B 4IL4A 2XNUA 3TLTA 4FRRA 3EHZA 3ZDHA 5KZUA 2Y7YA 4LMKA 4HFBA 5J0ZA 3U8KA 4B5DA 2XNVA 3JAFA 4TWHA 4ALXA 5HEHA 3UU3A 5AFHA 3UU5A 5J5FA 3C79A 2BYNA 5CO5A 3WIPA 5IUXA 4QABA 5AFLA 4ZK4A 2W8GA 3P4WA 2YMEA 2WNLA 4HFEA 4Z90A 4ZJSA 3RQUA 3WTNA 4ZJTA 3JAEA 5J5GA 4A97A 2Y54A 4LMLA 4Z91A 5JMEA 5AFMB 2W8FA 4ZRUA 1UV6A 5HCMA 3WTHA 2BYRA 4COFA 5L4HA 3EI0A 2YN6A 4UM3P 5HEGA 4AFGA 2BR7A 1I9BA 4ZR6A 3ZKRA 5LXBA 3RIAA 3UQ7A 4ILAA 3U8MA 5CFBA 2XZ6A 4XK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTK A;  4HFD A;  4UM3 A;  3JAD A;  2BYQ A;  3TLV A;  5TVC A;  2XQ4 A;  3SQ9 A;  2XQ6 A;  4PIR A;  4AFH A;  5J5I A;  2XYT A;  5HEU A;  3UU6 A;  4D01 A;  5AFN A;  3LSV A;  5L47 A;  4UXU A;  4BQT A;  2YOE A;  2X00 D;  4QH1 A;  2ZJU A;  3SQ6 A;  4UM3 S;  2WZY A;  2XYS A;  3TLU A;  3UU4 A;  4LMJ A;  3IGQ A;  4HFC A;  5HEO A;  2BG9 A;  3EAM A;  4TWD A;  5FJV A;  2WN9 A;  3SIO A;  3T4M A;  4ILC A;  5L4E A;  3RIF A;  2BG9 C;  2C9T A;  4TNW A;  3TLS A;  4IL9 A;  4NPP A;  2PH9 A;  2BG9 E;  5BP0 A;  5AFJ A;  3RQW A;  5J5H A;  3ZDG A;  4X5T A;  4ILB A;  4TWF A;  1UX2 A;  2XQ3 A;  5BW2 A;  2VL0 A;  5HCJ A;  2Y58 A;  4IRE A;  4DBM A;  5BRX A;  4HFI A;  2ZJV A;  2XQ9 A;  3P50 A;  4TNV A;  4QAA A;  3GUA A;  4EZ1 A;  3SH1 A;  4WV9 A;  3U8N A;  4UM1 A;  5HEJ A;  5KE4 A;  4XHE A;  3WTI A;  4AFT A;  2X00 A;  4ZZC A;  3WTO A;  4UY2 A;  2XQ8 A;  2BJ0 A;  4NZB A;  2Y56 A;  2XNT A;  3TLW A;  2YMD A;  3UU8 A;  3UUB A;  4QH5 A;  3RI5 A;  4BFQ A;  4QAC A;  3U8L A;  5AFK A;  3WTM A;  3WTJ A;  2XQ7 A;  2XQA A;  2XQ5 A;  2WNJ A;  3PEO A;  3C84 A;  2PGZ A;  3UQ4 A;  5AFM A;  2WNC A;  3PMZ A;  2BYP A;  4HQP A;  3U8J A;  4A98 A;  5SYO A;  5AIN A;  2YKS A;  2QC1 B;  4ZK1 A;  1UW6 A;  2BR8 A;  3WTL A;  4QH4 A;  4HFH A;  4ZZB A;  2BYS A;  3RHW A;  2UZ6 A;  2XZ5 A;  5LG3 A;  2Y57 A;  4F8H A;  2BG9 B;  4IL4 A;  2XNU A;  3TLT A;  4FRR A;  3EHZ A;  3ZDH A;  5KZU A;  2Y7Y A;  4LMK A;  4HFB A;  5J0Z A;  3U8K A;  4B5D A;  2XNV A;  3JAF A;  4TWH A;  4ALX A;  5HEH A;  3UU3 A;  5AFH A;  3UU5 A;  5J5F A;  3C79 A;  2BYN A;  5CO5 A;  3WIP A;  5IUX A;  4QAB A;  5AFL A;  4ZK4 A;  2W8G A;  3P4W A;  2YME A;  2WNL A;  4HFE A;  4Z90 A;  4ZJS A;  3RQU A;  3WTN A;  4ZJT A;  3JAE A;  5J5G A;  4A97 A;  2Y54 A;  4LML A;  4Z91 A;  5JME A;  5AFM B;  2W8F A;  4ZRU A;  1UV6 A;  5HCM A;  3WTH A;  2BYR A;  4COF A;  5L4H A;  3EI0 A;  2YN6 A;  4UM3 P;  5HEG A;  4AFG A;  2BR7 A;  1I9B A;  4ZR6 A;  3ZKR A;  5LXB A;  3RIA A;  3UQ7 A;  4ILA A;  3U8M A;  5CFB A;  2XZ6 A;  4XK9 A; 
#chains in the Genus database with same CATH topology
 3WTK A;  4HFD A;  4UM3 A;  3JAD A;  2BYQ A;  3TLV A;  5TVC A;  2XQ4 A;  3SQ9 A;  2XQ6 A;  4PIR A;  4AFH A;  5J5I A;  2XYT A;  5HEU A;  3UU6 A;  4D01 A;  5AFN A;  3LSV A;  5L47 A;  4UXU A;  4BQT A;  2YOE A;  2X00 D;  4QH1 A;  2ZJU A;  3SQ6 A;  4UM3 S;  2WZY A;  2XYS A;  3TLU A;  3UU4 A;  4LMJ A;  3IGQ A;  4HFC A;  5HEO A;  2BG9 A;  3EAM A;  4TWD A;  5FJV A;  2WN9 A;  3SIO A;  3T4M A;  4ILC A;  5L4E A;  3RIF A;  2BG9 C;  2C9T A;  4TNW A;  3TLS A;  4IL9 A;  4NPP A;  2PH9 A;  2BG9 E;  5BP0 A;  5AFJ A;  3RQW A;  5J5H A;  3ZDG A;  4X5T A;  4ILB A;  4TWF A;  1UX2 A;  2XQ3 A;  5BW2 A;  2VL0 A;  5HCJ A;  2Y58 A;  4IRE A;  4DBM A;  5BRX A;  4HFI A;  2ZJV A;  2XQ9 A;  3P50 A;  4TNV A;  4QAA A;  3GUA A;  4EZ1 A;  3SH1 A;  4WV9 A;  3U8N A;  4UM1 A;  5HEJ A;  5KE4 A;  4XHE A;  3WTI A;  4AFT A;  2X00 A;  4ZZC A;  3WTO A;  4UY2 A;  2XQ8 A;  2BJ0 A;  4NZB A;  2Y56 A;  2XNT A;  3TLW A;  2YMD A;  3UU8 A;  3UUB A;  4QH5 A;  3RI5 A;  4BFQ A;  4QAC A;  3U8L A;  5AFK A;  3WTM A;  3WTJ A;  2XQ7 A;  2XQA A;  2XQ5 A;  2WNJ A;  3PEO A;  3C84 A;  2PGZ A;  3UQ4 A;  5AFM A;  2WNC A;  3PMZ A;  2BYP A;  4HQP A;  3U8J A;  4A98 A;  5SYO A;  5AIN A;  2YKS A;  2QC1 B;  4ZK1 A;  1UW6 A;  2BR8 A;  3WTL A;  4QH4 A;  4HFH A;  4ZZB A;  2BYS A;  3RHW A;  2UZ6 A;  2XZ5 A;  5LG3 A;  2Y57 A;  4F8H A;  2BG9 B;  4IL4 A;  2XNU A;  3TLT A;  4FRR A;  3EHZ A;  3ZDH A;  5KZU A;  2Y7Y A;  4LMK A;  4HFB A;  5J0Z A;  3U8K A;  4B5D A;  2XNV A;  3JAF A;  4TWH A;  4ALX A;  5HEH A;  3UU3 A;  5AFH A;  3UU5 A;  5J5F A;  3C79 A;  2BYN A;  5CO5 A;  3WIP A;  5IUX A;  4QAB A;  5AFL A;  4ZK4 A;  2W8G A;  3P4W A;  2YME A;  2WNL A;  4HFE A;  4Z90 A;  4ZJS A;  3RQU A;  3WTN A;  4ZJT A;  3JAE A;  5J5G A;  4A97 A;  2Y54 A;  4LML A;  4Z91 A;  5JME A;  5AFM B;  2W8F A;  4ZRU A;  1UV6 A;  5HCM A;  3WTH A;  2BYR A;  4COF A;  5L4H A;  3EI0 A;  2YN6 A;  4UM3 P;  5HEG A;  4AFG A;  2BR7 A;  1I9B A;  4ZR6 A;  3ZKR A;  5LXB A;  3RIA A;  3UQ7 A;  4ILA A;  3U8M A;  5CFB A;  2XZ6 A;  4XK9 A; 
#chains in the Genus database with same CATH homology
 3WTK A;  4HFD A;  4UM3 A;  3JAD A;  2BYQ A;  3TLV A;  5TVC A;  2XQ4 A;  3SQ9 A;  2XQ6 A;  4PIR A;  4AFH A;  5J5I A;  2XYT A;  5HEU A;  3UU6 A;  4D01 A;  5AFN A;  3LSV A;  5L47 A;  4UXU A;  4BQT A;  2YOE A;  2X00 D;  4QH1 A;  2ZJU A;  3SQ6 A;  4UM3 S;  2WZY A;  2XYS A;  3TLU A;  3UU4 A;  4LMJ A;  3IGQ A;  4HFC A;  5HEO A;  2BG9 A;  3EAM A;  4TWD A;  5FJV A;  2WN9 A;  3SIO A;  3T4M A;  4ILC A;  5L4E A;  3RIF A;  2BG9 C;  2C9T A;  4TNW A;  3TLS A;  4IL9 A;  4NPP A;  2PH9 A;  2BG9 E;  5BP0 A;  5AFJ A;  3RQW A;  5J5H A;  3ZDG A;  4X5T A;  4ILB A;  4TWF A;  1UX2 A;  2XQ3 A;  5BW2 A;  2VL0 A;  5HCJ A;  2Y58 A;  4IRE A;  4DBM A;  5BRX A;  4HFI A;  2ZJV A;  2XQ9 A;  3P50 A;  4TNV A;  4QAA A;  3GUA A;  4EZ1 A;  3SH1 A;  4WV9 A;  3U8N A;  4UM1 A;  5HEJ A;  5KE4 A;  4XHE A;  3WTI A;  4AFT A;  2X00 A;  4ZZC A;  3WTO A;  4UY2 A;  2XQ8 A;  2BJ0 A;  4NZB A;  2Y56 A;  2XNT A;  3TLW A;  2YMD A;  3UU8 A;  3UUB A;  4QH5 A;  3RI5 A;  4BFQ A;  4QAC A;  3U8L A;  5AFK A;  3WTM A;  3WTJ A;  2XQ7 A;  2XQA A;  2XQ5 A;  2WNJ A;  3PEO A;  3C84 A;  2PGZ A;  3UQ4 A;  5AFM A;  2WNC A;  3PMZ A;  2BYP A;  4HQP A;  3U8J A;  4A98 A;  5SYO A;  5AIN A;  2YKS A;  2QC1 B;  4ZK1 A;  1UW6 A;  2BR8 A;  3WTL A;  4QH4 A;  4HFH A;  4ZZB A;  2BYS A;  3RHW A;  2UZ6 A;  2XZ5 A;  5LG3 A;  2Y57 A;  4F8H A;  2BG9 B;  4IL4 A;  2XNU A;  3TLT A;  4FRR A;  3EHZ A;  3ZDH A;  5KZU A;  2Y7Y A;  4LMK A;  4HFB A;  5J0Z A;  3U8K A;  4B5D A;  2XNV A;  3JAF A;  4TWH A;  4ALX A;  5HEH A;  3UU3 A;  5AFH A;  3UU5 A;  5J5F A;  3C79 A;  2BYN A;  5CO5 A;  3WIP A;  5IUX A;  4QAB A;  5AFL A;  4ZK4 A;  2W8G A;  3P4W A;  2YME A;  2WNL A;  4HFE A;  4Z90 A;  4ZJS A;  3RQU A;  3WTN A;  4ZJT A;  3JAE A;  5J5G A;  4A97 A;  2Y54 A;  4LML A;  4Z91 A;  5JME A;  5AFM B;  2W8F A;  4ZRU A;  1UV6 A;  5HCM A;  3WTH A;  2BYR A;  4COF A;  5L4H A;  3EI0 A;  2YN6 A;  4UM3 P;  5HEG A;  4AFG A;  2BR7 A;  1I9B A;  4ZR6 A;  3ZKR A;  5LXB A;  3RIA A;  3UQ7 A;  4ILA A;  3U8M A;  5CFB A;  2XZ6 A;  4XK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...