4HQPA

Alpha7 nicotinic receptor chimera and its complex with alpha bungarotoxin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
202
structure length
202
Chain Sequence
QRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Alpha7 nicotinic receptor chimera
publication title Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors
rcsb
source organism Homo sapiens, lymnaea stagnalis
total genus 41
structure length 202
sequence length 202
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hqpA00
4LMKA 3RQUA 5IUXA 3U8JA 5HEGA 3WTNA 4ZZBA 4ZZCA 5L4EA 5J5GA 2YMDA 5LXBA 5AINA 3PMZA 2XNUA 4TWDA 2C9TA 4HFIA 4IL9A 3UU6A 4QAAA 2X00A 2XQAA 3C79A 2VL0A 2BYNA 4UXUA 2YMEA 4NZBA 5FJVA 4ALXA 3ZKRA 5KE4A 5BP0A 3SH1A 5L47A 5CO5A 4HFHA 2BYQA 2Y58A 4QACA 2WNJA 4TNVA 5BRXA 2XQ3A 4IL4A 2BG9C 4IREA 2QC1B 5KZUA 5LG3A 2BYPA 5HEOA 5CFBA 2BG9B 2W8FA 3TLTA 3U8KA 4F8HA 5J5IA 3P4WA 5HEUA 4TWHA 3U8NA 1UV6A 2Y7YA 4QH5A 2XQ8A 4A98A 3SQ6A 4ZJTA 4EZ1A 4UM3P 2WNLA 3WTKA 2XQ7A 3RIFA 4ILBA 2BR7A 2BYRA 4ZJSA 3WTJA 4BFQA 4QH1A 3JAFA 3UU3A 5AFHA 2XNVA 3C84A 3RIAA 4TNWA 2XQ5A 4UM3A 3U8LA 3UU4A 4D01A 3EI0A 4AFTA 2PH9A 4ZRUA 4UM1A 2BYSA 2XYSA 5BW2A 2BG9A 2Y56A 3RQWA 3SQ9A 3U8MA 4ILCA 2PGZA 4ZK4A 3UUBA 4QABA 2XZ5A 5AFMA 4ZR6A 4BQTA 4UM3S 2XYTA 4HFCA 3EHZA 2Y57A 3WTMA 3WTLA 2BJ0A 4X5TA 5SYOA 2Y54A 5AFMB 3GUAA 5TVCA 5J0ZA 2XQ6A 5AFJA 3JAEA 3TLUA 4B5DA 1UX2A 2ZJVA 3ZDHA 5HEJA 4HFDA 2XZ6A 3RHWA 3TLSA 3TLVA 4LMLA 2YOEA 4FRRA 3UU5A 5AFNA 2ZJUA 3JADA 3UQ4A 3UU8A 5HCJA 4HFBA 5JMEA 4HQPA 4LMJA 4ZK1A 3EAMA 3ZDGA 2UZ6A 4Z90A 4QH4A 5J5HA 3PEOA 3SIOA 4HFEA 2YN6A 4NPPA 3T4MA 3TLWA 4XHEA 2YKSA 5HCMA 4A97A 4TWFA 2WNCA 2X00D 3LSVA 3P50A 4AFGA 5J5FA 2BR8A 2WN9A 2WZYA 3WTIA 5AFKA 3IGQA 2W8GA 4ILAA 3WTHA 5HEHA 3RI5A 4DBMA 1UW6A 4XK9A 1I9BA 4Z91A 2XQ4A 5AFLA 2BG9E 4AFHA 4COFA 5L4HA 2XQ9A 3UQ7A 2XNTA 3WIPA 4UY2A 4PIRA 4WV9A 3WTOA
chains in the Genus database with same CATH superfamily
4LMKA 3RQUA 5IUXA 3U8JA 5HEGA 3WTNA 4ZZBA 4ZZCA 5L4EA 5J5GA 2YMDA 5LXBA 5AINA 3PMZA 2XNUA 4TWDA 2C9TA 4HFIA 4IL9A 3UU6A 4QAAA 2X00A 2XQAA 3C79A 2VL0A 2BYNA 4UXUA 2YMEA 4NZBA 5FJVA 4ALXA 3ZKRA 5KE4A 5BP0A 3SH1A 5L47A 5CO5A 4HFHA 2BYQA 2Y58A 4QACA 2WNJA 4TNVA 5BRXA 2XQ3A 4IL4A 2BG9C 4IREA 2QC1B 5KZUA 5LG3A 2BYPA 5HEOA 5CFBA 2BG9B 2W8FA 3TLTA 3U8KA 4F8HA 5J5IA 3P4WA 5HEUA 4TWHA 3U8NA 1UV6A 2Y7YA 4QH5A 2XQ8A 4A98A 3SQ6A 4ZJTA 4EZ1A 4UM3P 2WNLA 3WTKA 2XQ7A 3RIFA 4ILBA 2BR7A 2BYRA 4ZJSA 3WTJA 4BFQA 4QH1A 3JAFA 3UU3A 5AFHA 2XNVA 3C84A 3RIAA 4TNWA 2XQ5A 4UM3A 3U8LA 3UU4A 4D01A 3EI0A 4AFTA 2PH9A 4ZRUA 4UM1A 2BYSA 2XYSA 5BW2A 2BG9A 2Y56A 3RQWA 3SQ9A 3U8MA 4ILCA 2PGZA 4ZK4A 3UUBA 4QABA 2XZ5A 5AFMA 4ZR6A 4BQTA 4UM3S 2XYTA 4HFCA 3EHZA 2Y57A 3WTMA 3WTLA 2BJ0A 4X5TA 5SYOA 2Y54A 5AFMB 3GUAA 5TVCA 5J0ZA 2XQ6A 5AFJA 3JAEA 3TLUA 4B5DA 1UX2A 2ZJVA 3ZDHA 5HEJA 4HFDA 2XZ6A 3RHWA 3TLSA 3TLVA 4LMLA 2YOEA 4FRRA 3UU5A 5AFNA 2ZJUA 3JADA 3UQ4A 3UU8A 5HCJA 4HFBA 5JMEA 4HQPA 4LMJA 4ZK1A 3EAMA 3ZDGA 2UZ6A 4Z90A 4QH4A 5J5HA 3PEOA 3SIOA 4HFEA 2YN6A 4NPPA 3T4MA 3TLWA 4XHEA 2YKSA 5HCMA 4A97A 4TWFA 2WNCA 2X00D 3LSVA 3P50A 4AFGA 5J5FA 2BR8A 2WN9A 2WZYA 3WTIA 5AFKA 3IGQA 2W8GA 4ILAA 3WTHA 5HEHA 3RI5A 4DBMA 1UW6A 4XK9A 1I9BA 4Z91A 2XQ4A 5AFLA 2BG9E 4AFHA 4COFA 5L4HA 2XQ9A 3UQ7A 2XNTA 3WIPA 4UY2A 4PIRA 4WV9A 3WTOA
chains in the Genus database with same CATH topology
4LMKA 3RQUA 5IUXA 3U8JA 5HEGA 3WTNA 4ZZBA 4ZZCA 5L4EA 5J5GA 2YMDA 5LXBA 5AINA 3PMZA 2XNUA 4TWDA 2C9TA 4HFIA 4IL9A 3UU6A 4QAAA 2X00A 2XQAA 3C79A 2VL0A 2BYNA 4UXUA 2YMEA 4NZBA 5FJVA 4ALXA 3ZKRA 5KE4A 5BP0A 3SH1A 5L47A 5CO5A 4HFHA 2BYQA 2Y58A 4QACA 2WNJA 4TNVA 5BRXA 2XQ3A 4IL4A 2BG9C 4IREA 2QC1B 5KZUA 5LG3A 2BYPA 5HEOA 5CFBA 2BG9B 2W8FA 3TLTA 3U8KA 4F8HA 5J5IA 3P4WA 5HEUA 4TWHA 3U8NA 1UV6A 2Y7YA 4QH5A 2XQ8A 4A98A 3SQ6A 4ZJTA 4EZ1A 4UM3P 2WNLA 3WTKA 2XQ7A 3RIFA 4ILBA 2BR7A 2BYRA 4ZJSA 3WTJA 4BFQA 4QH1A 3JAFA 3UU3A 5AFHA 2XNVA 3C84A 3RIAA 4TNWA 2XQ5A 4UM3A 3U8LA 3UU4A 4D01A 3EI0A 4AFTA 2PH9A 4ZRUA 4UM1A 2BYSA 2XYSA 5BW2A 2BG9A 2Y56A 3RQWA 3SQ9A 3U8MA 4ILCA 2PGZA 4ZK4A 3UUBA 4QABA 2XZ5A 5AFMA 4ZR6A 4BQTA 4UM3S 2XYTA 4HFCA 3EHZA 2Y57A 3WTMA 3WTLA 2BJ0A 4X5TA 5SYOA 2Y54A 5AFMB 3GUAA 5TVCA 5J0ZA 2XQ6A 5AFJA 3JAEA 3TLUA 4B5DA 1UX2A 2ZJVA 3ZDHA 5HEJA 4HFDA 2XZ6A 3RHWA 3TLSA 3TLVA 4LMLA 2YOEA 4FRRA 3UU5A 5AFNA 2ZJUA 3JADA 3UQ4A 3UU8A 5HCJA 4HFBA 5JMEA 4HQPA 4LMJA 4ZK1A 3EAMA 3ZDGA 2UZ6A 4Z90A 4QH4A 5J5HA 3PEOA 3SIOA 4HFEA 2YN6A 4NPPA 3T4MA 3TLWA 4XHEA 2YKSA 5HCMA 4A97A 4TWFA 2WNCA 2X00D 3LSVA 3P50A 4AFGA 5J5FA 2BR8A 2WN9A 2WZYA 3WTIA 5AFKA 3IGQA 2W8GA 4ILAA 3WTHA 5HEHA 3RI5A 4DBMA 1UW6A 4XK9A 1I9BA 4Z91A 2XQ4A 5AFLA 2BG9E 4AFHA 4COFA 5L4HA 2XQ9A 3UQ7A 2XNTA 3WIPA 4UY2A 4PIRA 4WV9A 3WTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMK A;  3RQU A;  5IUX A;  3U8J A;  5HEG A;  3WTN A;  4ZZB A;  4ZZC A;  5L4E A;  5J5G A;  2YMD A;  5LXB A;  5AIN A;  3PMZ A;  2XNU A;  4TWD A;  2C9T A;  4HFI A;  4IL9 A;  3UU6 A;  4QAA A;  2X00 A;  2XQA A;  3C79 A;  2VL0 A;  2BYN A;  4UXU A;  2YME A;  4NZB A;  5FJV A;  4ALX A;  3ZKR A;  5KE4 A;  5BP0 A;  3SH1 A;  5L47 A;  5CO5 A;  4HFH A;  2BYQ A;  2Y58 A;  4QAC A;  2WNJ A;  4TNV A;  5BRX A;  2XQ3 A;  4IL4 A;  2BG9 C;  4IRE A;  2QC1 B;  5KZU A;  5LG3 A;  2BYP A;  5HEO A;  5CFB A;  2BG9 B;  2W8F A;  3TLT A;  3U8K A;  4F8H A;  5J5I A;  3P4W A;  5HEU A;  4TWH A;  3U8N A;  1UV6 A;  2Y7Y A;  4QH5 A;  2XQ8 A;  4A98 A;  3SQ6 A;  4ZJT A;  4EZ1 A;  4UM3 P;  2WNL A;  3WTK A;  2XQ7 A;  3RIF A;  4ILB A;  2BR7 A;  2BYR A;  4ZJS A;  3WTJ A;  4BFQ A;  4QH1 A;  3JAF A;  3UU3 A;  5AFH A;  2XNV A;  3C84 A;  3RIA A;  4TNW A;  2XQ5 A;  4UM3 A;  3U8L A;  3UU4 A;  4D01 A;  3EI0 A;  4AFT A;  2PH9 A;  4ZRU A;  4UM1 A;  2BYS A;  2XYS A;  5BW2 A;  2BG9 A;  2Y56 A;  3RQW A;  3SQ9 A;  3U8M A;  4ILC A;  2PGZ A;  4ZK4 A;  3UUB A;  4QAB A;  2XZ5 A;  5AFM A;  4ZR6 A;  4BQT A;  4UM3 S;  2XYT A;  4HFC A;  3EHZ A;  2Y57 A;  3WTM A;  3WTL A;  2BJ0 A;  4X5T A;  5SYO A;  2Y54 A;  5AFM B;  3GUA A;  5TVC A;  5J0Z A;  2XQ6 A;  5AFJ A;  3JAE A;  3TLU A;  4B5D A;  1UX2 A;  2ZJV A;  3ZDH A;  5HEJ A;  4HFD A;  2XZ6 A;  3RHW A;  3TLS A;  3TLV A;  4LML A;  2YOE A;  4FRR A;  3UU5 A;  5AFN A;  2ZJU A;  3JAD A;  3UQ4 A;  3UU8 A;  5HCJ A;  4HFB A;  5JME A;  4HQP A;  4LMJ A;  4ZK1 A;  3EAM A;  3ZDG A;  2UZ6 A;  4Z90 A;  4QH4 A;  5J5H A;  3PEO A;  3SIO A;  4HFE A;  2YN6 A;  4NPP A;  3T4M A;  3TLW A;  4XHE A;  2YKS A;  5HCM A;  4A97 A;  4TWF A;  2WNC A;  2X00 D;  3LSV A;  3P50 A;  4AFG A;  5J5F A;  2BR8 A;  2WN9 A;  2WZY A;  3WTI A;  5AFK A;  3IGQ A;  2W8G A;  4ILA A;  3WTH A;  5HEH A;  3RI5 A;  4DBM A;  1UW6 A;  4XK9 A;  1I9B A;  4Z91 A;  2XQ4 A;  5AFL A;  2BG9 E;  4AFH A;  4COF A;  5L4H A;  2XQ9 A;  3UQ7 A;  2XNT A;  3WIP A;  4UY2 A;  4PIR A;  4WV9 A;  3WTO A; 
#chains in the Genus database with same CATH topology
 4LMK A;  3RQU A;  5IUX A;  3U8J A;  5HEG A;  3WTN A;  4ZZB A;  4ZZC A;  5L4E A;  5J5G A;  2YMD A;  5LXB A;  5AIN A;  3PMZ A;  2XNU A;  4TWD A;  2C9T A;  4HFI A;  4IL9 A;  3UU6 A;  4QAA A;  2X00 A;  2XQA A;  3C79 A;  2VL0 A;  2BYN A;  4UXU A;  2YME A;  4NZB A;  5FJV A;  4ALX A;  3ZKR A;  5KE4 A;  5BP0 A;  3SH1 A;  5L47 A;  5CO5 A;  4HFH A;  2BYQ A;  2Y58 A;  4QAC A;  2WNJ A;  4TNV A;  5BRX A;  2XQ3 A;  4IL4 A;  2BG9 C;  4IRE A;  2QC1 B;  5KZU A;  5LG3 A;  2BYP A;  5HEO A;  5CFB A;  2BG9 B;  2W8F A;  3TLT A;  3U8K A;  4F8H A;  5J5I A;  3P4W A;  5HEU A;  4TWH A;  3U8N A;  1UV6 A;  2Y7Y A;  4QH5 A;  2XQ8 A;  4A98 A;  3SQ6 A;  4ZJT A;  4EZ1 A;  4UM3 P;  2WNL A;  3WTK A;  2XQ7 A;  3RIF A;  4ILB A;  2BR7 A;  2BYR A;  4ZJS A;  3WTJ A;  4BFQ A;  4QH1 A;  3JAF A;  3UU3 A;  5AFH A;  2XNV A;  3C84 A;  3RIA A;  4TNW A;  2XQ5 A;  4UM3 A;  3U8L A;  3UU4 A;  4D01 A;  3EI0 A;  4AFT A;  2PH9 A;  4ZRU A;  4UM1 A;  2BYS A;  2XYS A;  5BW2 A;  2BG9 A;  2Y56 A;  3RQW A;  3SQ9 A;  3U8M A;  4ILC A;  2PGZ A;  4ZK4 A;  3UUB A;  4QAB A;  2XZ5 A;  5AFM A;  4ZR6 A;  4BQT A;  4UM3 S;  2XYT A;  4HFC A;  3EHZ A;  2Y57 A;  3WTM A;  3WTL A;  2BJ0 A;  4X5T A;  5SYO A;  2Y54 A;  5AFM B;  3GUA A;  5TVC A;  5J0Z A;  2XQ6 A;  5AFJ A;  3JAE A;  3TLU A;  4B5D A;  1UX2 A;  2ZJV A;  3ZDH A;  5HEJ A;  4HFD A;  2XZ6 A;  3RHW A;  3TLS A;  3TLV A;  4LML A;  2YOE A;  4FRR A;  3UU5 A;  5AFN A;  2ZJU A;  3JAD A;  3UQ4 A;  3UU8 A;  5HCJ A;  4HFB A;  5JME A;  4HQP A;  4LMJ A;  4ZK1 A;  3EAM A;  3ZDG A;  2UZ6 A;  4Z90 A;  4QH4 A;  5J5H A;  3PEO A;  3SIO A;  4HFE A;  2YN6 A;  4NPP A;  3T4M A;  3TLW A;  4XHE A;  2YKS A;  5HCM A;  4A97 A;  4TWF A;  2WNC A;  2X00 D;  3LSV A;  3P50 A;  4AFG A;  5J5F A;  2BR8 A;  2WN9 A;  2WZY A;  3WTI A;  5AFK A;  3IGQ A;  2W8G A;  4ILA A;  3WTH A;  5HEH A;  3RI5 A;  4DBM A;  1UW6 A;  4XK9 A;  1I9B A;  4Z91 A;  2XQ4 A;  5AFL A;  2BG9 E;  4AFH A;  4COF A;  5L4H A;  2XQ9 A;  3UQ7 A;  2XNT A;  3WIP A;  4UY2 A;  4PIR A;  4WV9 A;  3WTO A; 
#chains in the Genus database with same CATH homology
 4LMK A;  3RQU A;  5IUX A;  3U8J A;  5HEG A;  3WTN A;  4ZZB A;  4ZZC A;  5L4E A;  5J5G A;  2YMD A;  5LXB A;  5AIN A;  3PMZ A;  2XNU A;  4TWD A;  2C9T A;  4HFI A;  4IL9 A;  3UU6 A;  4QAA A;  2X00 A;  2XQA A;  3C79 A;  2VL0 A;  2BYN A;  4UXU A;  2YME A;  4NZB A;  5FJV A;  4ALX A;  3ZKR A;  5KE4 A;  5BP0 A;  3SH1 A;  5L47 A;  5CO5 A;  4HFH A;  2BYQ A;  2Y58 A;  4QAC A;  2WNJ A;  4TNV A;  5BRX A;  2XQ3 A;  4IL4 A;  2BG9 C;  4IRE A;  2QC1 B;  5KZU A;  5LG3 A;  2BYP A;  5HEO A;  5CFB A;  2BG9 B;  2W8F A;  3TLT A;  3U8K A;  4F8H A;  5J5I A;  3P4W A;  5HEU A;  4TWH A;  3U8N A;  1UV6 A;  2Y7Y A;  4QH5 A;  2XQ8 A;  4A98 A;  3SQ6 A;  4ZJT A;  4EZ1 A;  4UM3 P;  2WNL A;  3WTK A;  2XQ7 A;  3RIF A;  4ILB A;  2BR7 A;  2BYR A;  4ZJS A;  3WTJ A;  4BFQ A;  4QH1 A;  3JAF A;  3UU3 A;  5AFH A;  2XNV A;  3C84 A;  3RIA A;  4TNW A;  2XQ5 A;  4UM3 A;  3U8L A;  3UU4 A;  4D01 A;  3EI0 A;  4AFT A;  2PH9 A;  4ZRU A;  4UM1 A;  2BYS A;  2XYS A;  5BW2 A;  2BG9 A;  2Y56 A;  3RQW A;  3SQ9 A;  3U8M A;  4ILC A;  2PGZ A;  4ZK4 A;  3UUB A;  4QAB A;  2XZ5 A;  5AFM A;  4ZR6 A;  4BQT A;  4UM3 S;  2XYT A;  4HFC A;  3EHZ A;  2Y57 A;  3WTM A;  3WTL A;  2BJ0 A;  4X5T A;  5SYO A;  2Y54 A;  5AFM B;  3GUA A;  5TVC A;  5J0Z A;  2XQ6 A;  5AFJ A;  3JAE A;  3TLU A;  4B5D A;  1UX2 A;  2ZJV A;  3ZDH A;  5HEJ A;  4HFD A;  2XZ6 A;  3RHW A;  3TLS A;  3TLV A;  4LML A;  2YOE A;  4FRR A;  3UU5 A;  5AFN A;  2ZJU A;  3JAD A;  3UQ4 A;  3UU8 A;  5HCJ A;  4HFB A;  5JME A;  4HQP A;  4LMJ A;  4ZK1 A;  3EAM A;  3ZDG A;  2UZ6 A;  4Z90 A;  4QH4 A;  5J5H A;  3PEO A;  3SIO A;  4HFE A;  2YN6 A;  4NPP A;  3T4M A;  3TLW A;  4XHE A;  2YKS A;  5HCM A;  4A97 A;  4TWF A;  2WNC A;  2X00 D;  3LSV A;  3P50 A;  4AFG A;  5J5F A;  2BR8 A;  2WN9 A;  2WZY A;  3WTI A;  5AFK A;  3IGQ A;  2W8G A;  4ILA A;  3WTH A;  5HEH A;  3RI5 A;  4DBM A;  1UW6 A;  4XK9 A;  1I9B A;  4Z91 A;  2XQ4 A;  5AFL A;  2BG9 E;  4AFH A;  4COF A;  5L4H A;  2XQ9 A;  3UQ7 A;  2XNT A;  3WIP A;  4UY2 A;  4PIR A;  4WV9 A;  3WTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...