5AFKA

Alpha7-achbp in complex with lobeline and fragment 2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
205
structure length
205
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afkA00
2XNVA 4UM3S 3UU5A 2ZJUA 3WTMA 2C9TA 3EI0A 3TLVA 2YKSA 2PH9A 2XQ7A 4X5TA 3TLTA 1UX2A 3SIOA 5HEJA 5LXBA 5BP0A 3RI5A 3U8JA 4ZZCA 2X00D 4ZK4A 3SH1A 2XQ6A 4XHEA 4ZRUA 3RHWA 4UY2A 5L4EA 5J5FA 4AFGA 1UW6A 2BG9A 3GUAA 4ILBA 2XYTA 3U8NA 3C84A 5HEGA 4UXUA 4QABA 4TWDA 4IL4A 5AINA 4HFDA 2ZJVA 2BJ0A 2XNTA 2XQ5A 3SQ6A 5TVCA 3T4MA 4NPPA 3RIFA 5SYOA 4ILCA 4BQTA 5HCJA 2W8GA 5AFMB 2XQ4A 2Y56A 2WNCA 2X00A 3SQ9A 4AFTA 4QH1A 3RQWA 4UM3P 3ZDHA 3RIAA 4TNWA 3P50A 4WV9A 2YN6A 5AFHA 4HFBA 5CFBA 4ALXA 3EAMA 3WTLA 4AFHA 3LSVA 4QACA 2BYQA 4IL9A 4F8HA 5J5HA 3TLWA 2XQAA 3TLUA 3UQ4A 2XZ6A 2Y58A 5AFKA 4EZ1A 5FJVA 3JAFA 4HFIA 5AFNA 4LMLA 4IREA 3EHZA 2BYSA 4LMJA 4XK9A 5L4HA 2BG9C 2WZYA 5AFJA 3ZDGA 3WTHA 5IUXA 2XQ9A 2YOEA 4NZBA 1UV6A 3C79A 2WNJA 3WIPA 3UU3A 4PIRA 4FRRA 5CO5A 3TLSA 2XZ5A 3U8MA 4TNVA 4Z91A 4ZJSA 3P4WA 4TWFA 4UM1A 5J5GA 5JMEA 3WTNA 4LMKA 3WTKA 2BR7A 2VL0A 5AFMA 4B5DA 5L47A 2BG9E 4D01A 5J5IA 3JAEA 3RQUA 2BYPA 4QH5A 5J0ZA 3U8LA 2BYRA 4HFHA 5HEUA 2W8FA 4A97A 5AFLA 1I9BA 3IGQA 3WTJA 4DBMA 2BG9B 3ZKRA 2Y7YA 4QAAA 2Y57A 3UU6A 2WNLA 2WN9A 4ZZBA 3WTIA 2YMDA 2XQ8A 4TWHA 4A98A 2UZ6A 5BW2A 3UQ7A 3U8KA 4ZK1A 2YMEA 3UUBA 5KE4A 5BRXA 3WTOA 3UU4A 2BYNA 2BR8A 3PMZA 4ZJTA 4HFCA 5HEHA 2XQ3A 5HCMA 5LG3A 4HQPA 2XYSA 4HFEA 4Z90A 2XNUA 2QC1B 3JADA 4ZR6A 3UU8A 4QH4A 5KZUA 4ILAA 4UM3A 4COFA 5HEOA 3PEOA 2PGZA 4BFQA 2Y54A
chains in the Genus database with same CATH superfamily
2XNVA 4UM3S 3UU5A 2ZJUA 3WTMA 2C9TA 3EI0A 3TLVA 2YKSA 2PH9A 2XQ7A 4X5TA 3TLTA 1UX2A 3SIOA 5HEJA 5LXBA 5BP0A 3RI5A 3U8JA 4ZZCA 2X00D 4ZK4A 3SH1A 2XQ6A 4XHEA 4ZRUA 3RHWA 4UY2A 5L4EA 5J5FA 4AFGA 1UW6A 2BG9A 3GUAA 4ILBA 2XYTA 3U8NA 3C84A 5HEGA 4UXUA 4QABA 4TWDA 4IL4A 5AINA 4HFDA 2ZJVA 2BJ0A 2XNTA 2XQ5A 3SQ6A 5TVCA 3T4MA 4NPPA 3RIFA 5SYOA 4ILCA 4BQTA 5HCJA 2W8GA 5AFMB 2XQ4A 2Y56A 2WNCA 2X00A 3SQ9A 4AFTA 4QH1A 3RQWA 4UM3P 3ZDHA 3RIAA 4TNWA 3P50A 4WV9A 2YN6A 5AFHA 4HFBA 5CFBA 4ALXA 3EAMA 3WTLA 4AFHA 3LSVA 4QACA 2BYQA 4IL9A 4F8HA 5J5HA 3TLWA 2XQAA 3TLUA 3UQ4A 2XZ6A 2Y58A 5AFKA 4EZ1A 5FJVA 3JAFA 4HFIA 5AFNA 4LMLA 4IREA 3EHZA 2BYSA 4LMJA 4XK9A 5L4HA 2BG9C 2WZYA 5AFJA 3ZDGA 3WTHA 5IUXA 2XQ9A 2YOEA 4NZBA 1UV6A 3C79A 2WNJA 3WIPA 3UU3A 4PIRA 4FRRA 5CO5A 3TLSA 2XZ5A 3U8MA 4TNVA 4Z91A 4ZJSA 3P4WA 4TWFA 4UM1A 5J5GA 5JMEA 3WTNA 4LMKA 3WTKA 2BR7A 2VL0A 5AFMA 4B5DA 5L47A 2BG9E 4D01A 5J5IA 3JAEA 3RQUA 2BYPA 4QH5A 5J0ZA 3U8LA 2BYRA 4HFHA 5HEUA 2W8FA 4A97A 5AFLA 1I9BA 3IGQA 3WTJA 4DBMA 2BG9B 3ZKRA 2Y7YA 4QAAA 2Y57A 3UU6A 2WNLA 2WN9A 4ZZBA 3WTIA 2YMDA 2XQ8A 4TWHA 4A98A 2UZ6A 5BW2A 3UQ7A 3U8KA 4ZK1A 2YMEA 3UUBA 5KE4A 5BRXA 3WTOA 3UU4A 2BYNA 2BR8A 3PMZA 4ZJTA 4HFCA 5HEHA 2XQ3A 5HCMA 5LG3A 4HQPA 2XYSA 4HFEA 4Z90A 2XNUA 2QC1B 3JADA 4ZR6A 3UU8A 4QH4A 5KZUA 4ILAA 4UM3A 4COFA 5HEOA 3PEOA 2PGZA 4BFQA 2Y54A
chains in the Genus database with same CATH topology
2XNVA 4UM3S 3UU5A 2ZJUA 3WTMA 2C9TA 3EI0A 3TLVA 2YKSA 2PH9A 2XQ7A 4X5TA 3TLTA 1UX2A 3SIOA 5HEJA 5LXBA 5BP0A 3RI5A 3U8JA 4ZZCA 2X00D 4ZK4A 3SH1A 2XQ6A 4XHEA 4ZRUA 3RHWA 4UY2A 5L4EA 5J5FA 4AFGA 1UW6A 2BG9A 3GUAA 4ILBA 2XYTA 3U8NA 3C84A 5HEGA 4UXUA 4QABA 4TWDA 4IL4A 5AINA 4HFDA 2ZJVA 2BJ0A 2XNTA 2XQ5A 3SQ6A 5TVCA 3T4MA 4NPPA 3RIFA 5SYOA 4ILCA 4BQTA 5HCJA 2W8GA 5AFMB 2XQ4A 2Y56A 2WNCA 2X00A 3SQ9A 4AFTA 4QH1A 3RQWA 4UM3P 3ZDHA 3RIAA 4TNWA 3P50A 4WV9A 2YN6A 5AFHA 4HFBA 5CFBA 4ALXA 3EAMA 3WTLA 4AFHA 3LSVA 4QACA 2BYQA 4IL9A 4F8HA 5J5HA 3TLWA 2XQAA 3TLUA 3UQ4A 2XZ6A 2Y58A 5AFKA 4EZ1A 5FJVA 3JAFA 4HFIA 5AFNA 4LMLA 4IREA 3EHZA 2BYSA 4LMJA 4XK9A 5L4HA 2BG9C 2WZYA 5AFJA 3ZDGA 3WTHA 5IUXA 2XQ9A 2YOEA 4NZBA 1UV6A 3C79A 2WNJA 3WIPA 3UU3A 4PIRA 4FRRA 5CO5A 3TLSA 2XZ5A 3U8MA 4TNVA 4Z91A 4ZJSA 3P4WA 4TWFA 4UM1A 5J5GA 5JMEA 3WTNA 4LMKA 3WTKA 2BR7A 2VL0A 5AFMA 4B5DA 5L47A 2BG9E 4D01A 5J5IA 3JAEA 3RQUA 2BYPA 4QH5A 5J0ZA 3U8LA 2BYRA 4HFHA 5HEUA 2W8FA 4A97A 5AFLA 1I9BA 3IGQA 3WTJA 4DBMA 2BG9B 3ZKRA 2Y7YA 4QAAA 2Y57A 3UU6A 2WNLA 2WN9A 4ZZBA 3WTIA 2YMDA 2XQ8A 4TWHA 4A98A 2UZ6A 5BW2A 3UQ7A 3U8KA 4ZK1A 2YMEA 3UUBA 5KE4A 5BRXA 3WTOA 3UU4A 2BYNA 2BR8A 3PMZA 4ZJTA 4HFCA 5HEHA 2XQ3A 5HCMA 5LG3A 4HQPA 2XYSA 4HFEA 4Z90A 2XNUA 2QC1B 3JADA 4ZR6A 3UU8A 4QH4A 5KZUA 4ILAA 4UM3A 4COFA 5HEOA 3PEOA 2PGZA 4BFQA 2Y54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNV A;  4UM3 S;  3UU5 A;  2ZJU A;  3WTM A;  2C9T A;  3EI0 A;  3TLV A;  2YKS A;  2PH9 A;  2XQ7 A;  4X5T A;  3TLT A;  1UX2 A;  3SIO A;  5HEJ A;  5LXB A;  5BP0 A;  3RI5 A;  3U8J A;  4ZZC A;  2X00 D;  4ZK4 A;  3SH1 A;  2XQ6 A;  4XHE A;  4ZRU A;  3RHW A;  4UY2 A;  5L4E A;  5J5F A;  4AFG A;  1UW6 A;  2BG9 A;  3GUA A;  4ILB A;  2XYT A;  3U8N A;  3C84 A;  5HEG A;  4UXU A;  4QAB A;  4TWD A;  4IL4 A;  5AIN A;  4HFD A;  2ZJV A;  2BJ0 A;  2XNT A;  2XQ5 A;  3SQ6 A;  5TVC A;  3T4M A;  4NPP A;  3RIF A;  5SYO A;  4ILC A;  4BQT A;  5HCJ A;  2W8G A;  5AFM B;  2XQ4 A;  2Y56 A;  2WNC A;  2X00 A;  3SQ9 A;  4AFT A;  4QH1 A;  3RQW A;  4UM3 P;  3ZDH A;  3RIA A;  4TNW A;  3P50 A;  4WV9 A;  2YN6 A;  5AFH A;  4HFB A;  5CFB A;  4ALX A;  3EAM A;  3WTL A;  4AFH A;  3LSV A;  4QAC A;  2BYQ A;  4IL9 A;  4F8H A;  5J5H A;  3TLW A;  2XQA A;  3TLU A;  3UQ4 A;  2XZ6 A;  2Y58 A;  5AFK A;  4EZ1 A;  5FJV A;  3JAF A;  4HFI A;  5AFN A;  4LML A;  4IRE A;  3EHZ A;  2BYS A;  4LMJ A;  4XK9 A;  5L4H A;  2BG9 C;  2WZY A;  5AFJ A;  3ZDG A;  3WTH A;  5IUX A;  2XQ9 A;  2YOE A;  4NZB A;  1UV6 A;  3C79 A;  2WNJ A;  3WIP A;  3UU3 A;  4PIR A;  4FRR A;  5CO5 A;  3TLS A;  2XZ5 A;  3U8M A;  4TNV A;  4Z91 A;  4ZJS A;  3P4W A;  4TWF A;  4UM1 A;  5J5G A;  5JME A;  3WTN A;  4LMK A;  3WTK A;  2BR7 A;  2VL0 A;  5AFM A;  4B5D A;  5L47 A;  2BG9 E;  4D01 A;  5J5I A;  3JAE A;  3RQU A;  2BYP A;  4QH5 A;  5J0Z A;  3U8L A;  2BYR A;  4HFH A;  5HEU A;  2W8F A;  4A97 A;  5AFL A;  1I9B A;  3IGQ A;  3WTJ A;  4DBM A;  2BG9 B;  3ZKR A;  2Y7Y A;  4QAA A;  2Y57 A;  3UU6 A;  2WNL A;  2WN9 A;  4ZZB A;  3WTI A;  2YMD A;  2XQ8 A;  4TWH A;  4A98 A;  2UZ6 A;  5BW2 A;  3UQ7 A;  3U8K A;  4ZK1 A;  2YME A;  3UUB A;  5KE4 A;  5BRX A;  3WTO A;  3UU4 A;  2BYN A;  2BR8 A;  3PMZ A;  4ZJT A;  4HFC A;  5HEH A;  2XQ3 A;  5HCM A;  5LG3 A;  4HQP A;  2XYS A;  4HFE A;  4Z90 A;  2XNU A;  2QC1 B;  3JAD A;  4ZR6 A;  3UU8 A;  4QH4 A;  5KZU A;  4ILA A;  4UM3 A;  4COF A;  5HEO A;  3PEO A;  2PGZ A;  4BFQ A;  2Y54 A; 
#chains in the Genus database with same CATH topology
 2XNV A;  4UM3 S;  3UU5 A;  2ZJU A;  3WTM A;  2C9T A;  3EI0 A;  3TLV A;  2YKS A;  2PH9 A;  2XQ7 A;  4X5T A;  3TLT A;  1UX2 A;  3SIO A;  5HEJ A;  5LXB A;  5BP0 A;  3RI5 A;  3U8J A;  4ZZC A;  2X00 D;  4ZK4 A;  3SH1 A;  2XQ6 A;  4XHE A;  4ZRU A;  3RHW A;  4UY2 A;  5L4E A;  5J5F A;  4AFG A;  1UW6 A;  2BG9 A;  3GUA A;  4ILB A;  2XYT A;  3U8N A;  3C84 A;  5HEG A;  4UXU A;  4QAB A;  4TWD A;  4IL4 A;  5AIN A;  4HFD A;  2ZJV A;  2BJ0 A;  2XNT A;  2XQ5 A;  3SQ6 A;  5TVC A;  3T4M A;  4NPP A;  3RIF A;  5SYO A;  4ILC A;  4BQT A;  5HCJ A;  2W8G A;  5AFM B;  2XQ4 A;  2Y56 A;  2WNC A;  2X00 A;  3SQ9 A;  4AFT A;  4QH1 A;  3RQW A;  4UM3 P;  3ZDH A;  3RIA A;  4TNW A;  3P50 A;  4WV9 A;  2YN6 A;  5AFH A;  4HFB A;  5CFB A;  4ALX A;  3EAM A;  3WTL A;  4AFH A;  3LSV A;  4QAC A;  2BYQ A;  4IL9 A;  4F8H A;  5J5H A;  3TLW A;  2XQA A;  3TLU A;  3UQ4 A;  2XZ6 A;  2Y58 A;  5AFK A;  4EZ1 A;  5FJV A;  3JAF A;  4HFI A;  5AFN A;  4LML A;  4IRE A;  3EHZ A;  2BYS A;  4LMJ A;  4XK9 A;  5L4H A;  2BG9 C;  2WZY A;  5AFJ A;  3ZDG A;  3WTH A;  5IUX A;  2XQ9 A;  2YOE A;  4NZB A;  1UV6 A;  3C79 A;  2WNJ A;  3WIP A;  3UU3 A;  4PIR A;  4FRR A;  5CO5 A;  3TLS A;  2XZ5 A;  3U8M A;  4TNV A;  4Z91 A;  4ZJS A;  3P4W A;  4TWF A;  4UM1 A;  5J5G A;  5JME A;  3WTN A;  4LMK A;  3WTK A;  2BR7 A;  2VL0 A;  5AFM A;  4B5D A;  5L47 A;  2BG9 E;  4D01 A;  5J5I A;  3JAE A;  3RQU A;  2BYP A;  4QH5 A;  5J0Z A;  3U8L A;  2BYR A;  4HFH A;  5HEU A;  2W8F A;  4A97 A;  5AFL A;  1I9B A;  3IGQ A;  3WTJ A;  4DBM A;  2BG9 B;  3ZKR A;  2Y7Y A;  4QAA A;  2Y57 A;  3UU6 A;  2WNL A;  2WN9 A;  4ZZB A;  3WTI A;  2YMD A;  2XQ8 A;  4TWH A;  4A98 A;  2UZ6 A;  5BW2 A;  3UQ7 A;  3U8K A;  4ZK1 A;  2YME A;  3UUB A;  5KE4 A;  5BRX A;  3WTO A;  3UU4 A;  2BYN A;  2BR8 A;  3PMZ A;  4ZJT A;  4HFC A;  5HEH A;  2XQ3 A;  5HCM A;  5LG3 A;  4HQP A;  2XYS A;  4HFE A;  4Z90 A;  2XNU A;  2QC1 B;  3JAD A;  4ZR6 A;  3UU8 A;  4QH4 A;  5KZU A;  4ILA A;  4UM3 A;  4COF A;  5HEO A;  3PEO A;  2PGZ A;  4BFQ A;  2Y54 A; 
#chains in the Genus database with same CATH homology
 2XNV A;  4UM3 S;  3UU5 A;  2ZJU A;  3WTM A;  2C9T A;  3EI0 A;  3TLV A;  2YKS A;  2PH9 A;  2XQ7 A;  4X5T A;  3TLT A;  1UX2 A;  3SIO A;  5HEJ A;  5LXB A;  5BP0 A;  3RI5 A;  3U8J A;  4ZZC A;  2X00 D;  4ZK4 A;  3SH1 A;  2XQ6 A;  4XHE A;  4ZRU A;  3RHW A;  4UY2 A;  5L4E A;  5J5F A;  4AFG A;  1UW6 A;  2BG9 A;  3GUA A;  4ILB A;  2XYT A;  3U8N A;  3C84 A;  5HEG A;  4UXU A;  4QAB A;  4TWD A;  4IL4 A;  5AIN A;  4HFD A;  2ZJV A;  2BJ0 A;  2XNT A;  2XQ5 A;  3SQ6 A;  5TVC A;  3T4M A;  4NPP A;  3RIF A;  5SYO A;  4ILC A;  4BQT A;  5HCJ A;  2W8G A;  5AFM B;  2XQ4 A;  2Y56 A;  2WNC A;  2X00 A;  3SQ9 A;  4AFT A;  4QH1 A;  3RQW A;  4UM3 P;  3ZDH A;  3RIA A;  4TNW A;  3P50 A;  4WV9 A;  2YN6 A;  5AFH A;  4HFB A;  5CFB A;  4ALX A;  3EAM A;  3WTL A;  4AFH A;  3LSV A;  4QAC A;  2BYQ A;  4IL9 A;  4F8H A;  5J5H A;  3TLW A;  2XQA A;  3TLU A;  3UQ4 A;  2XZ6 A;  2Y58 A;  5AFK A;  4EZ1 A;  5FJV A;  3JAF A;  4HFI A;  5AFN A;  4LML A;  4IRE A;  3EHZ A;  2BYS A;  4LMJ A;  4XK9 A;  5L4H A;  2BG9 C;  2WZY A;  5AFJ A;  3ZDG A;  3WTH A;  5IUX A;  2XQ9 A;  2YOE A;  4NZB A;  1UV6 A;  3C79 A;  2WNJ A;  3WIP A;  3UU3 A;  4PIR A;  4FRR A;  5CO5 A;  3TLS A;  2XZ5 A;  3U8M A;  4TNV A;  4Z91 A;  4ZJS A;  3P4W A;  4TWF A;  4UM1 A;  5J5G A;  5JME A;  3WTN A;  4LMK A;  3WTK A;  2BR7 A;  2VL0 A;  5AFM A;  4B5D A;  5L47 A;  2BG9 E;  4D01 A;  5J5I A;  3JAE A;  3RQU A;  2BYP A;  4QH5 A;  5J0Z A;  3U8L A;  2BYR A;  4HFH A;  5HEU A;  2W8F A;  4A97 A;  5AFL A;  1I9B A;  3IGQ A;  3WTJ A;  4DBM A;  2BG9 B;  3ZKR A;  2Y7Y A;  4QAA A;  2Y57 A;  3UU6 A;  2WNL A;  2WN9 A;  4ZZB A;  3WTI A;  2YMD A;  2XQ8 A;  4TWH A;  4A98 A;  2UZ6 A;  5BW2 A;  3UQ7 A;  3U8K A;  4ZK1 A;  2YME A;  3UUB A;  5KE4 A;  5BRX A;  3WTO A;  3UU4 A;  2BYN A;  2BR8 A;  3PMZ A;  4ZJT A;  4HFC A;  5HEH A;  2XQ3 A;  5HCM A;  5LG3 A;  4HQP A;  2XYS A;  4HFE A;  4Z90 A;  2XNU A;  2QC1 B;  3JAD A;  4ZR6 A;  3UU8 A;  4QH4 A;  5KZU A;  4ILA A;  4UM3 A;  4COF A;  5HEO A;  3PEO A;  2PGZ A;  4BFQ A;  2Y54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...