2PGZA

Crystal structure of cocaine bound to an ach-binding protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
211
Chain Sequence
DDDDKLHSQANLMRLKSDLFNRSYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Choline-binding protein
molecule keywords Soluble acetylcholine receptor
publication title Galanthamine and non-competitive inhibitor binding to ACh-binding protein: evidence for a binding site on non-alpha-subunit interfaces of heteromeric neuronal nicotinic receptors.
pubmed doi rcsb
source organism Aplysia californica
total genus 59
structure length 211
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2pgzA00
2W8FA 3C79A 5HEOA 2PH9A 4QACA 3WTIA 3JAEA 5HCMA 4AFGA 5LG3A 4NPPA 3PEOA 3WTMA 4ZJTA 2WNLA 2YOEA 2YN6A 5HEUA 3SH1A 4XK9A 4UM3A 2BR7A 2BG9C 2W8GA 4ZZBA 5CFBA 2XNVA 2XZ5A 2PGZA 3EHZA 4QH1A 5FJVA 5J5GA 5LXBA 3UU6A 2BYNA 2WNCA 5AFJA 3EI0A 4HFDA 3UU4A 2BG9B 2XNUA 3SQ9A 3WTJA 5SYOA 3EAMA 4QH4A 5AFNA 2XQ5A 4TWDA 4HFIA 3PMZA 3JADA 3U8MA 3UU8A 3C84A 3P50A 3WTNA 5BW2A 5L4EA 4IL4A 3UU3A 4ZJSA 4AFTA 3U8NA 2VL0A 3IGQA 3RIFA 4FRRA 3U8JA 2BJ0A 4ALXA 4PIRA 2Y56A 2YMDA 3RQUA 3WTKA 4ZR6A 4IL9A 2X00D 4DBMA 3UUBA 4A98A 4AFHA 2XQ9A 3TLTA 2BG9A 2Y7YA 3WIPA 4ZRUA 4ILBA 5J5HA 2WZYA 3ZKRA 4HFHA 3U8KA 4D01A 3WTOA 4ZZCA 2ZJUA 5AFMB 3TLUA 4IREA 4UM3P 4ZK4A 5BRXA 4TNWA 2WNJA 2BYPA 5BP0A 3ZDGA 1UX2A 2YMEA 5KZUA 3JAFA 4ILCA 3UQ4A 4UM1A 4BQTA 2BYSA 3U8LA 4TNVA 4QABA 3UU5A 2C9TA 4F8HA 4WV9A 2UZ6A 2YKSA 3TLVA 5AFMA 3UQ7A 2XZ6A 2XQ7A 2XYTA 4HFEA 3WTHA 5HCJA 5J5FA 4LMKA 2XNTA 2XQ3A 2Y54A 3SQ6A 3GUAA 3ZDHA 2ZJVA 4X5TA 5KE4A 3WTLA 2Y57A 4TWFA 2BYQA 3SIOA 4XHEA 2BR8A 4HFCA 4LMJA 5JMEA 5L4HA 2XQ4A 2BYRA 1I9BA 3TLSA 4A97A 4B5DA 3RI5A 3RHWA 5AINA 1UW6A 4NZBA 1UV6A 4BFQA 3T4MA 2WN9A 4LMLA 5TVCA 3TLWA 5AFLA 5HEGA 4COFA 5AFHA 5J5IA 4ZK1A 5AFKA 4HQPA 4UM3S 4Z90A 2QC1B 4HFBA 5HEJA 5J0ZA 2Y58A 3LSVA 2XQ6A 4QAAA 2BG9E 4TWHA 4UXUA 4QH5A 3RQWA 5IUXA 4Z91A 4ILAA 5CO5A 5L47A 2XQAA 4UY2A 3P4WA 2X00A 5HEHA 2XYSA 4EZ1A 2XQ8A 3RIAA
chains in the Genus database with same CATH superfamily
2W8FA 3C79A 5HEOA 2PH9A 4QACA 3WTIA 3JAEA 5HCMA 4AFGA 5LG3A 4NPPA 3PEOA 3WTMA 4ZJTA 2WNLA 2YOEA 2YN6A 5HEUA 3SH1A 4XK9A 4UM3A 2BR7A 2BG9C 2W8GA 4ZZBA 5CFBA 2XNVA 2XZ5A 2PGZA 3EHZA 4QH1A 5FJVA 5J5GA 5LXBA 3UU6A 2BYNA 2WNCA 5AFJA 3EI0A 4HFDA 3UU4A 2BG9B 2XNUA 3SQ9A 3WTJA 5SYOA 3EAMA 4QH4A 5AFNA 2XQ5A 4TWDA 4HFIA 3PMZA 3JADA 3U8MA 3UU8A 3C84A 3P50A 3WTNA 5BW2A 5L4EA 4IL4A 3UU3A 4ZJSA 4AFTA 3U8NA 2VL0A 3IGQA 3RIFA 4FRRA 3U8JA 2BJ0A 4ALXA 4PIRA 2Y56A 2YMDA 3RQUA 3WTKA 4ZR6A 4IL9A 2X00D 4DBMA 3UUBA 4A98A 4AFHA 2XQ9A 3TLTA 2BG9A 2Y7YA 3WIPA 4ZRUA 4ILBA 5J5HA 2WZYA 3ZKRA 4HFHA 3U8KA 4D01A 3WTOA 4ZZCA 2ZJUA 5AFMB 3TLUA 4IREA 4UM3P 4ZK4A 5BRXA 4TNWA 2WNJA 2BYPA 5BP0A 3ZDGA 1UX2A 2YMEA 5KZUA 3JAFA 4ILCA 3UQ4A 4UM1A 4BQTA 2BYSA 3U8LA 4TNVA 4QABA 3UU5A 2C9TA 4F8HA 4WV9A 2UZ6A 2YKSA 3TLVA 5AFMA 3UQ7A 2XZ6A 2XQ7A 2XYTA 4HFEA 3WTHA 5HCJA 5J5FA 4LMKA 2XNTA 2XQ3A 2Y54A 3SQ6A 3GUAA 3ZDHA 2ZJVA 4X5TA 5KE4A 3WTLA 2Y57A 4TWFA 2BYQA 3SIOA 4XHEA 2BR8A 4HFCA 4LMJA 5JMEA 5L4HA 2XQ4A 2BYRA 1I9BA 3TLSA 4A97A 4B5DA 3RI5A 3RHWA 5AINA 1UW6A 4NZBA 1UV6A 4BFQA 3T4MA 2WN9A 4LMLA 5TVCA 3TLWA 5AFLA 5HEGA 4COFA 5AFHA 5J5IA 4ZK1A 5AFKA 4HQPA 4UM3S 4Z90A 2QC1B 4HFBA 5HEJA 5J0ZA 2Y58A 3LSVA 2XQ6A 4QAAA 2BG9E 4TWHA 4UXUA 4QH5A 3RQWA 5IUXA 4Z91A 4ILAA 5CO5A 5L47A 2XQAA 4UY2A 3P4WA 2X00A 5HEHA 2XYSA 4EZ1A 2XQ8A 3RIAA
chains in the Genus database with same CATH topology
2W8FA 3C79A 5HEOA 2PH9A 4QACA 3WTIA 3JAEA 5HCMA 4AFGA 5LG3A 4NPPA 3PEOA 3WTMA 4ZJTA 2WNLA 2YOEA 2YN6A 5HEUA 3SH1A 4XK9A 4UM3A 2BR7A 2BG9C 2W8GA 4ZZBA 5CFBA 2XNVA 2XZ5A 2PGZA 3EHZA 4QH1A 5FJVA 5J5GA 5LXBA 3UU6A 2BYNA 2WNCA 5AFJA 3EI0A 4HFDA 3UU4A 2BG9B 2XNUA 3SQ9A 3WTJA 5SYOA 3EAMA 4QH4A 5AFNA 2XQ5A 4TWDA 4HFIA 3PMZA 3JADA 3U8MA 3UU8A 3C84A 3P50A 3WTNA 5BW2A 5L4EA 4IL4A 3UU3A 4ZJSA 4AFTA 3U8NA 2VL0A 3IGQA 3RIFA 4FRRA 3U8JA 2BJ0A 4ALXA 4PIRA 2Y56A 2YMDA 3RQUA 3WTKA 4ZR6A 4IL9A 2X00D 4DBMA 3UUBA 4A98A 4AFHA 2XQ9A 3TLTA 2BG9A 2Y7YA 3WIPA 4ZRUA 4ILBA 5J5HA 2WZYA 3ZKRA 4HFHA 3U8KA 4D01A 3WTOA 4ZZCA 2ZJUA 5AFMB 3TLUA 4IREA 4UM3P 4ZK4A 5BRXA 4TNWA 2WNJA 2BYPA 5BP0A 3ZDGA 1UX2A 2YMEA 5KZUA 3JAFA 4ILCA 3UQ4A 4UM1A 4BQTA 2BYSA 3U8LA 4TNVA 4QABA 3UU5A 2C9TA 4F8HA 4WV9A 2UZ6A 2YKSA 3TLVA 5AFMA 3UQ7A 2XZ6A 2XQ7A 2XYTA 4HFEA 3WTHA 5HCJA 5J5FA 4LMKA 2XNTA 2XQ3A 2Y54A 3SQ6A 3GUAA 3ZDHA 2ZJVA 4X5TA 5KE4A 3WTLA 2Y57A 4TWFA 2BYQA 3SIOA 4XHEA 2BR8A 4HFCA 4LMJA 5JMEA 5L4HA 2XQ4A 2BYRA 1I9BA 3TLSA 4A97A 4B5DA 3RI5A 3RHWA 5AINA 1UW6A 4NZBA 1UV6A 4BFQA 3T4MA 2WN9A 4LMLA 5TVCA 3TLWA 5AFLA 5HEGA 4COFA 5AFHA 5J5IA 4ZK1A 5AFKA 4HQPA 4UM3S 4Z90A 2QC1B 4HFBA 5HEJA 5J0ZA 2Y58A 3LSVA 2XQ6A 4QAAA 2BG9E 4TWHA 4UXUA 4QH5A 3RQWA 5IUXA 4Z91A 4ILAA 5CO5A 5L47A 2XQAA 4UY2A 3P4WA 2X00A 5HEHA 2XYSA 4EZ1A 2XQ8A 3RIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8F A;  3C79 A;  5HEO A;  2PH9 A;  4QAC A;  3WTI A;  3JAE A;  5HCM A;  4AFG A;  5LG3 A;  4NPP A;  3PEO A;  3WTM A;  4ZJT A;  2WNL A;  2YOE A;  2YN6 A;  5HEU A;  3SH1 A;  4XK9 A;  4UM3 A;  2BR7 A;  2BG9 C;  2W8G A;  4ZZB A;  5CFB A;  2XNV A;  2XZ5 A;  2PGZ A;  3EHZ A;  4QH1 A;  5FJV A;  5J5G A;  5LXB A;  3UU6 A;  2BYN A;  2WNC A;  5AFJ A;  3EI0 A;  4HFD A;  3UU4 A;  2BG9 B;  2XNU A;  3SQ9 A;  3WTJ A;  5SYO A;  3EAM A;  4QH4 A;  5AFN A;  2XQ5 A;  4TWD A;  4HFI A;  3PMZ A;  3JAD A;  3U8M A;  3UU8 A;  3C84 A;  3P50 A;  3WTN A;  5BW2 A;  5L4E A;  4IL4 A;  3UU3 A;  4ZJS A;  4AFT A;  3U8N A;  2VL0 A;  3IGQ A;  3RIF A;  4FRR A;  3U8J A;  2BJ0 A;  4ALX A;  4PIR A;  2Y56 A;  2YMD A;  3RQU A;  3WTK A;  4ZR6 A;  4IL9 A;  2X00 D;  4DBM A;  3UUB A;  4A98 A;  4AFH A;  2XQ9 A;  3TLT A;  2BG9 A;  2Y7Y A;  3WIP A;  4ZRU A;  4ILB A;  5J5H A;  2WZY A;  3ZKR A;  4HFH A;  3U8K A;  4D01 A;  3WTO A;  4ZZC A;  2ZJU A;  5AFM B;  3TLU A;  4IRE A;  4UM3 P;  4ZK4 A;  5BRX A;  4TNW A;  2WNJ A;  2BYP A;  5BP0 A;  3ZDG A;  1UX2 A;  2YME A;  5KZU A;  3JAF A;  4ILC A;  3UQ4 A;  4UM1 A;  4BQT A;  2BYS A;  3U8L A;  4TNV A;  4QAB A;  3UU5 A;  2C9T A;  4F8H A;  4WV9 A;  2UZ6 A;  2YKS A;  3TLV A;  5AFM A;  3UQ7 A;  2XZ6 A;  2XQ7 A;  2XYT A;  4HFE A;  3WTH A;  5HCJ A;  5J5F A;  4LMK A;  2XNT A;  2XQ3 A;  2Y54 A;  3SQ6 A;  3GUA A;  3ZDH A;  2ZJV A;  4X5T A;  5KE4 A;  3WTL A;  2Y57 A;  4TWF A;  2BYQ A;  3SIO A;  4XHE A;  2BR8 A;  4HFC A;  4LMJ A;  5JME A;  5L4H A;  2XQ4 A;  2BYR A;  1I9B A;  3TLS A;  4A97 A;  4B5D A;  3RI5 A;  3RHW A;  5AIN A;  1UW6 A;  4NZB A;  1UV6 A;  4BFQ A;  3T4M A;  2WN9 A;  4LML A;  5TVC A;  3TLW A;  5AFL A;  5HEG A;  4COF A;  5AFH A;  5J5I A;  4ZK1 A;  5AFK A;  4HQP A;  4UM3 S;  4Z90 A;  2QC1 B;  4HFB A;  5HEJ A;  5J0Z A;  2Y58 A;  3LSV A;  2XQ6 A;  4QAA A;  2BG9 E;  4TWH A;  4UXU A;  4QH5 A;  3RQW A;  5IUX A;  4Z91 A;  4ILA A;  5CO5 A;  5L47 A;  2XQA A;  4UY2 A;  3P4W A;  2X00 A;  5HEH A;  2XYS A;  4EZ1 A;  2XQ8 A;  3RIA A; 
#chains in the Genus database with same CATH topology
 2W8F A;  3C79 A;  5HEO A;  2PH9 A;  4QAC A;  3WTI A;  3JAE A;  5HCM A;  4AFG A;  5LG3 A;  4NPP A;  3PEO A;  3WTM A;  4ZJT A;  2WNL A;  2YOE A;  2YN6 A;  5HEU A;  3SH1 A;  4XK9 A;  4UM3 A;  2BR7 A;  2BG9 C;  2W8G A;  4ZZB A;  5CFB A;  2XNV A;  2XZ5 A;  2PGZ A;  3EHZ A;  4QH1 A;  5FJV A;  5J5G A;  5LXB A;  3UU6 A;  2BYN A;  2WNC A;  5AFJ A;  3EI0 A;  4HFD A;  3UU4 A;  2BG9 B;  2XNU A;  3SQ9 A;  3WTJ A;  5SYO A;  3EAM A;  4QH4 A;  5AFN A;  2XQ5 A;  4TWD A;  4HFI A;  3PMZ A;  3JAD A;  3U8M A;  3UU8 A;  3C84 A;  3P50 A;  3WTN A;  5BW2 A;  5L4E A;  4IL4 A;  3UU3 A;  4ZJS A;  4AFT A;  3U8N A;  2VL0 A;  3IGQ A;  3RIF A;  4FRR A;  3U8J A;  2BJ0 A;  4ALX A;  4PIR A;  2Y56 A;  2YMD A;  3RQU A;  3WTK A;  4ZR6 A;  4IL9 A;  2X00 D;  4DBM A;  3UUB A;  4A98 A;  4AFH A;  2XQ9 A;  3TLT A;  2BG9 A;  2Y7Y A;  3WIP A;  4ZRU A;  4ILB A;  5J5H A;  2WZY A;  3ZKR A;  4HFH A;  3U8K A;  4D01 A;  3WTO A;  4ZZC A;  2ZJU A;  5AFM B;  3TLU A;  4IRE A;  4UM3 P;  4ZK4 A;  5BRX A;  4TNW A;  2WNJ A;  2BYP A;  5BP0 A;  3ZDG A;  1UX2 A;  2YME A;  5KZU A;  3JAF A;  4ILC A;  3UQ4 A;  4UM1 A;  4BQT A;  2BYS A;  3U8L A;  4TNV A;  4QAB A;  3UU5 A;  2C9T A;  4F8H A;  4WV9 A;  2UZ6 A;  2YKS A;  3TLV A;  5AFM A;  3UQ7 A;  2XZ6 A;  2XQ7 A;  2XYT A;  4HFE A;  3WTH A;  5HCJ A;  5J5F A;  4LMK A;  2XNT A;  2XQ3 A;  2Y54 A;  3SQ6 A;  3GUA A;  3ZDH A;  2ZJV A;  4X5T A;  5KE4 A;  3WTL A;  2Y57 A;  4TWF A;  2BYQ A;  3SIO A;  4XHE A;  2BR8 A;  4HFC A;  4LMJ A;  5JME A;  5L4H A;  2XQ4 A;  2BYR A;  1I9B A;  3TLS A;  4A97 A;  4B5D A;  3RI5 A;  3RHW A;  5AIN A;  1UW6 A;  4NZB A;  1UV6 A;  4BFQ A;  3T4M A;  2WN9 A;  4LML A;  5TVC A;  3TLW A;  5AFL A;  5HEG A;  4COF A;  5AFH A;  5J5I A;  4ZK1 A;  5AFK A;  4HQP A;  4UM3 S;  4Z90 A;  2QC1 B;  4HFB A;  5HEJ A;  5J0Z A;  2Y58 A;  3LSV A;  2XQ6 A;  4QAA A;  2BG9 E;  4TWH A;  4UXU A;  4QH5 A;  3RQW A;  5IUX A;  4Z91 A;  4ILA A;  5CO5 A;  5L47 A;  2XQA A;  4UY2 A;  3P4W A;  2X00 A;  5HEH A;  2XYS A;  4EZ1 A;  2XQ8 A;  3RIA A; 
#chains in the Genus database with same CATH homology
 2W8F A;  3C79 A;  5HEO A;  2PH9 A;  4QAC A;  3WTI A;  3JAE A;  5HCM A;  4AFG A;  5LG3 A;  4NPP A;  3PEO A;  3WTM A;  4ZJT A;  2WNL A;  2YOE A;  2YN6 A;  5HEU A;  3SH1 A;  4XK9 A;  4UM3 A;  2BR7 A;  2BG9 C;  2W8G A;  4ZZB A;  5CFB A;  2XNV A;  2XZ5 A;  2PGZ A;  3EHZ A;  4QH1 A;  5FJV A;  5J5G A;  5LXB A;  3UU6 A;  2BYN A;  2WNC A;  5AFJ A;  3EI0 A;  4HFD A;  3UU4 A;  2BG9 B;  2XNU A;  3SQ9 A;  3WTJ A;  5SYO A;  3EAM A;  4QH4 A;  5AFN A;  2XQ5 A;  4TWD A;  4HFI A;  3PMZ A;  3JAD A;  3U8M A;  3UU8 A;  3C84 A;  3P50 A;  3WTN A;  5BW2 A;  5L4E A;  4IL4 A;  3UU3 A;  4ZJS A;  4AFT A;  3U8N A;  2VL0 A;  3IGQ A;  3RIF A;  4FRR A;  3U8J A;  2BJ0 A;  4ALX A;  4PIR A;  2Y56 A;  2YMD A;  3RQU A;  3WTK A;  4ZR6 A;  4IL9 A;  2X00 D;  4DBM A;  3UUB A;  4A98 A;  4AFH A;  2XQ9 A;  3TLT A;  2BG9 A;  2Y7Y A;  3WIP A;  4ZRU A;  4ILB A;  5J5H A;  2WZY A;  3ZKR A;  4HFH A;  3U8K A;  4D01 A;  3WTO A;  4ZZC A;  2ZJU A;  5AFM B;  3TLU A;  4IRE A;  4UM3 P;  4ZK4 A;  5BRX A;  4TNW A;  2WNJ A;  2BYP A;  5BP0 A;  3ZDG A;  1UX2 A;  2YME A;  5KZU A;  3JAF A;  4ILC A;  3UQ4 A;  4UM1 A;  4BQT A;  2BYS A;  3U8L A;  4TNV A;  4QAB A;  3UU5 A;  2C9T A;  4F8H A;  4WV9 A;  2UZ6 A;  2YKS A;  3TLV A;  5AFM A;  3UQ7 A;  2XZ6 A;  2XQ7 A;  2XYT A;  4HFE A;  3WTH A;  5HCJ A;  5J5F A;  4LMK A;  2XNT A;  2XQ3 A;  2Y54 A;  3SQ6 A;  3GUA A;  3ZDH A;  2ZJV A;  4X5T A;  5KE4 A;  3WTL A;  2Y57 A;  4TWF A;  2BYQ A;  3SIO A;  4XHE A;  2BR8 A;  4HFC A;  4LMJ A;  5JME A;  5L4H A;  2XQ4 A;  2BYR A;  1I9B A;  3TLS A;  4A97 A;  4B5D A;  3RI5 A;  3RHW A;  5AIN A;  1UW6 A;  4NZB A;  1UV6 A;  4BFQ A;  3T4M A;  2WN9 A;  4LML A;  5TVC A;  3TLW A;  5AFL A;  5HEG A;  4COF A;  5AFH A;  5J5I A;  4ZK1 A;  5AFK A;  4HQP A;  4UM3 S;  4Z90 A;  2QC1 B;  4HFB A;  5HEJ A;  5J0Z A;  2Y58 A;  3LSV A;  2XQ6 A;  4QAA A;  2BG9 E;  4TWH A;  4UXU A;  4QH5 A;  3RQW A;  5IUX A;  4Z91 A;  4ILA A;  5CO5 A;  5L47 A;  2XQA A;  4UY2 A;  3P4W A;  2X00 A;  5HEH A;  2XYS A;  4EZ1 A;  2XQ8 A;  3RIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...