2PGZA

Crystal structure of cocaine bound to an ach-binding protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
211
Chain Sequence
b'DDDDKLHSQANLMRLKSDLFNRSYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Galanthamine and non-competitive inhibitor binding to ACh-binding protein: evidence for a binding site on non-alpha-subunit interfaces of heteromeric neuronal nicotinic receptors.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Choline-binding protein
total genus 59
structure length 211
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2pgzA00
2BYNA 4EZ1A 4ZZBA 2YN6A 3P4WA 5LG3A 3UU4A 3UUBA 4TWHA 5TVCA 3P50A 4HFBA 4ILAA 5AFNA 2XNVA 3TLWA 2WN9A 4X5TA 4IL4A 5J5GA 5FJVA 3ZKRA 2WNLA 4XK9A 5HEOA 4LMLA 2XQAA 4UM3S 5CFBA 3JAFA 2UZ6A 2XYTA 2XQ8A 2BR7A 3EAMA 3WTNA 3C79A 5J0ZA 5AFMA 3TLSA 4UY2A 3LSVA 3WTKA 4ZJTA 2Y57A 2XYSA 4NPPA 5AFJA 3WTHA 2XQ5A 5HEJA 4ZK1A 5J5FA 5AFLA 5AFKA 5HCJA 4FRRA 3TLTA 2Y54A 4ILBA 3RQWA 3RIAA 2YMEA 2C9TA 3SQ6A 2XZ6A 4AFTA 4UM1A 4PIRA 5BW2A 5J5IA 5AFHA 4D01A 4QH1A 4COFA 2XNUA 2W8GA 2XQ6A 4TNWA 3U8KA 5BRXA 4NZBA 5HEUA 4XHEA 3U8JA 4QAAA 4ZR6A 5HEHA 3SH1A 2BG9E 2XQ7A 2XQ3A 4AFGA 4Z90A 5BP0A 3TLVA 3RQUA 4B5DA 3EI0A 5L4HA 4ILCA 4LMKA 4ZRUA 3WTOA 2YOEA 3EHZA 2PGZA 4ZJSA 5CO5A 2BYRA 4IREA 4QACA 3ZDGA 4F8HA 5HCMA 1I9BA 4HQPA 2WZYA 2ZJUA 4ALXA 2YMDA 3RI5A 4BFQA 3WTLA 2ZJVA 3JAEA 3UU5A 3UU3A 5JMEA 2Y58A 2WNJA 5L4EA 4ZZCA 2BG9A 2X00A 5KE4A 1UX2A 2YKSA 5KZUA 2BYQA 4ZK4A 5AINA 3JADA 2BR8A 5HEGA 4UM3P 3SQ9A 4UXUA 4A97A 4QABA 4TNVA 4IL9A 2Y7YA 3SIOA 2Y56A 4AFHA 5J5HA 3TLUA 2W8FA 5SYOA 4BQTA 2XQ9A 5AFMB 4QH4A 2XQ4A 4UM3A 3WTIA 1UV6A 1UW6A 5IUXA 4DBMA 4TWFA 2WNCA 2QC1B 5L47A 5LXBA 3RIFA 3UQ4A 4WV9A 3C84A 4HFHA 3PEOA 4TWDA 3UU8A 3ZDHA 3GUAA 3T4MA 2BG9C 4HFCA 4Z91A 3U8MA 2BG9B 2BJ0A 2BYSA 2VL0A 4A98A 3U8LA 3PMZA 4QH5A 2XNTA 3UU6A 3WIPA 3U8NA 2XZ5A 2PH9A 3RHWA 4HFDA 4HFEA 3IGQA 3WTMA 3UQ7A 2X00D 4LMJA 3WTJA 4HFIA 2BYPA
chains in the Genus database with same CATH superfamily
2BYNA 4EZ1A 4ZZBA 2YN6A 3P4WA 5LG3A 3UU4A 3UUBA 4TWHA 5TVCA 3P50A 4HFBA 4ILAA 5AFNA 2XNVA 3TLWA 2WN9A 4X5TA 4IL4A 5J5GA 5FJVA 3ZKRA 2WNLA 4XK9A 5HEOA 4LMLA 2XQAA 4UM3S 5CFBA 3JAFA 2UZ6A 2XYTA 2XQ8A 2BR7A 3EAMA 3WTNA 3C79A 5J0ZA 5AFMA 3TLSA 4UY2A 3LSVA 3WTKA 4ZJTA 2Y57A 2XYSA 4NPPA 5AFJA 3WTHA 2XQ5A 5HEJA 4ZK1A 5J5FA 5AFLA 5AFKA 5HCJA 4FRRA 3TLTA 2Y54A 4ILBA 3RQWA 3RIAA 2YMEA 2C9TA 3SQ6A 2XZ6A 4AFTA 4UM1A 4PIRA 5BW2A 5J5IA 5AFHA 4D01A 4QH1A 4COFA 2XNUA 2W8GA 2XQ6A 4TNWA 3U8KA 5BRXA 4NZBA 5HEUA 4XHEA 3U8JA 4QAAA 4ZR6A 5HEHA 3SH1A 2BG9E 2XQ7A 2XQ3A 4AFGA 4Z90A 5BP0A 3TLVA 3RQUA 4B5DA 3EI0A 5L4HA 4ILCA 4LMKA 4ZRUA 3WTOA 2YOEA 3EHZA 2PGZA 4ZJSA 5CO5A 2BYRA 4IREA 4QACA 3ZDGA 4F8HA 5HCMA 1I9BA 4HQPA 2WZYA 2ZJUA 4ALXA 2YMDA 3RI5A 4BFQA 3WTLA 2ZJVA 3JAEA 3UU5A 3UU3A 5JMEA 2Y58A 2WNJA 5L4EA 4ZZCA 2BG9A 2X00A 5KE4A 1UX2A 2YKSA 5KZUA 2BYQA 4ZK4A 5AINA 3JADA 2BR8A 5HEGA 4UM3P 3SQ9A 4UXUA 4A97A 4QABA 4TNVA 4IL9A 2Y7YA 3SIOA 2Y56A 4AFHA 5J5HA 3TLUA 2W8FA 5SYOA 4BQTA 2XQ9A 5AFMB 4QH4A 2XQ4A 4UM3A 3WTIA 1UV6A 1UW6A 5IUXA 4DBMA 4TWFA 2WNCA 2QC1B 5L47A 5LXBA 3RIFA 3UQ4A 4WV9A 3C84A 4HFHA 3PEOA 4TWDA 3UU8A 3ZDHA 3GUAA 3T4MA 2BG9C 4HFCA 4Z91A 3U8MA 2BG9B 2BJ0A 2BYSA 2VL0A 4A98A 3U8LA 3PMZA 4QH5A 2XNTA 3UU6A 3WIPA 3U8NA 2XZ5A 2PH9A 3RHWA 4HFDA 4HFEA 3IGQA 3WTMA 3UQ7A 2X00D 4LMJA 3WTJA 4HFIA 2BYPA
chains in the Genus database with same CATH topology
2BYNA 4EZ1A 4ZZBA 2YN6A 3P4WA 5LG3A 3UU4A 3UUBA 4TWHA 5TVCA 3P50A 4HFBA 4ILAA 5AFNA 2XNVA 3TLWA 2WN9A 4X5TA 4IL4A 5J5GA 5FJVA 3ZKRA 2WNLA 4XK9A 5HEOA 4LMLA 2XQAA 4UM3S 5CFBA 3JAFA 2UZ6A 2XYTA 2XQ8A 2BR7A 3EAMA 3WTNA 3C79A 5J0ZA 5AFMA 3TLSA 4UY2A 3LSVA 3WTKA 4ZJTA 2Y57A 2XYSA 4NPPA 5AFJA 3WTHA 2XQ5A 5HEJA 4ZK1A 5J5FA 5AFLA 5AFKA 5HCJA 4FRRA 3TLTA 2Y54A 4ILBA 3RQWA 3RIAA 2YMEA 2C9TA 3SQ6A 2XZ6A 4AFTA 4UM1A 4PIRA 5BW2A 5J5IA 5AFHA 4D01A 4QH1A 4COFA 2XNUA 2W8GA 2XQ6A 4TNWA 3U8KA 5BRXA 4NZBA 5HEUA 4XHEA 3U8JA 4QAAA 4ZR6A 5HEHA 3SH1A 2BG9E 2XQ7A 2XQ3A 4AFGA 4Z90A 5BP0A 3TLVA 3RQUA 4B5DA 3EI0A 5L4HA 4ILCA 4LMKA 4ZRUA 3WTOA 2YOEA 3EHZA 2PGZA 4ZJSA 5CO5A 2BYRA 4IREA 4QACA 3ZDGA 4F8HA 5HCMA 1I9BA 4HQPA 2WZYA 2ZJUA 4ALXA 2YMDA 3RI5A 4BFQA 3WTLA 2ZJVA 3JAEA 3UU5A 3UU3A 5JMEA 2Y58A 2WNJA 5L4EA 4ZZCA 2BG9A 2X00A 5KE4A 1UX2A 2YKSA 5KZUA 2BYQA 4ZK4A 5AINA 3JADA 2BR8A 5HEGA 4UM3P 3SQ9A 4UXUA 4A97A 4QABA 4TNVA 4IL9A 2Y7YA 3SIOA 2Y56A 4AFHA 5J5HA 3TLUA 2W8FA 5SYOA 4BQTA 2XQ9A 5AFMB 4QH4A 2XQ4A 4UM3A 3WTIA 1UV6A 1UW6A 5IUXA 4DBMA 4TWFA 2WNCA 2QC1B 5L47A 5LXBA 3RIFA 3UQ4A 4WV9A 3C84A 4HFHA 3PEOA 4TWDA 3UU8A 3ZDHA 3GUAA 3T4MA 2BG9C 4HFCA 4Z91A 3U8MA 2BG9B 2BJ0A 2BYSA 2VL0A 4A98A 3U8LA 3PMZA 4QH5A 2XNTA 3UU6A 3WIPA 3U8NA 2XZ5A 2PH9A 3RHWA 4HFDA 4HFEA 3IGQA 3WTMA 3UQ7A 2X00D 4LMJA 3WTJA 4HFIA 2BYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYN A;  4EZ1 A;  4ZZB A;  2YN6 A;  3P4W A;  5LG3 A;  3UU4 A;  3UUB A;  4TWH A;  5TVC A;  3P50 A;  4HFB A;  4ILA A;  5AFN A;  2XNV A;  3TLW A;  2WN9 A;  4X5T A;  4IL4 A;  5J5G A;  5FJV A;  3ZKR A;  2WNL A;  4XK9 A;  5HEO A;  4LML A;  2XQA A;  4UM3 S;  5CFB A;  3JAF A;  2UZ6 A;  2XYT A;  2XQ8 A;  2BR7 A;  3EAM A;  3WTN A;  3C79 A;  5J0Z A;  5AFM A;  3TLS A;  4UY2 A;  3LSV A;  3WTK A;  4ZJT A;  2Y57 A;  2XYS A;  4NPP A;  5AFJ A;  3WTH A;  2XQ5 A;  5HEJ A;  4ZK1 A;  5J5F A;  5AFL A;  5AFK A;  5HCJ A;  4FRR A;  3TLT A;  2Y54 A;  4ILB A;  3RQW A;  3RIA A;  2YME A;  2C9T A;  3SQ6 A;  2XZ6 A;  4AFT A;  4UM1 A;  4PIR A;  5BW2 A;  5J5I A;  5AFH A;  4D01 A;  4QH1 A;  4COF A;  2XNU A;  2W8G A;  2XQ6 A;  4TNW A;  3U8K A;  5BRX A;  4NZB A;  5HEU A;  4XHE A;  3U8J A;  4QAA A;  4ZR6 A;  5HEH A;  3SH1 A;  2BG9 E;  2XQ7 A;  2XQ3 A;  4AFG A;  4Z90 A;  5BP0 A;  3TLV A;  3RQU A;  4B5D A;  3EI0 A;  5L4H A;  4ILC A;  4LMK A;  4ZRU A;  3WTO A;  2YOE A;  3EHZ A;  2PGZ A;  4ZJS A;  5CO5 A;  2BYR A;  4IRE A;  4QAC A;  3ZDG A;  4F8H A;  5HCM A;  1I9B A;  4HQP A;  2WZY A;  2ZJU A;  4ALX A;  2YMD A;  3RI5 A;  4BFQ A;  3WTL A;  2ZJV A;  3JAE A;  3UU5 A;  3UU3 A;  5JME A;  2Y58 A;  2WNJ A;  5L4E A;  4ZZC A;  2BG9 A;  2X00 A;  5KE4 A;  1UX2 A;  2YKS A;  5KZU A;  2BYQ A;  4ZK4 A;  5AIN A;  3JAD A;  2BR8 A;  5HEG A;  4UM3 P;  3SQ9 A;  4UXU A;  4A97 A;  4QAB A;  4TNV A;  4IL9 A;  2Y7Y A;  3SIO A;  2Y56 A;  4AFH A;  5J5H A;  3TLU A;  2W8F A;  5SYO A;  4BQT A;  2XQ9 A;  5AFM B;  4QH4 A;  2XQ4 A;  4UM3 A;  3WTI A;  1UV6 A;  1UW6 A;  5IUX A;  4DBM A;  4TWF A;  2WNC A;  2QC1 B;  5L47 A;  5LXB A;  3RIF A;  3UQ4 A;  4WV9 A;  3C84 A;  4HFH A;  3PEO A;  4TWD A;  3UU8 A;  3ZDH A;  3GUA A;  3T4M A;  2BG9 C;  4HFC A;  4Z91 A;  3U8M A;  2BG9 B;  2BJ0 A;  2BYS A;  2VL0 A;  4A98 A;  3U8L A;  3PMZ A;  4QH5 A;  2XNT A;  3UU6 A;  3WIP A;  3U8N A;  2XZ5 A;  2PH9 A;  3RHW A;  4HFD A;  4HFE A;  3IGQ A;  3WTM A;  3UQ7 A;  2X00 D;  4LMJ A;  3WTJ A;  4HFI A;  2BYP A; 
#chains in the Genus database with same CATH topology
 2BYN A;  4EZ1 A;  4ZZB A;  2YN6 A;  3P4W A;  5LG3 A;  3UU4 A;  3UUB A;  4TWH A;  5TVC A;  3P50 A;  4HFB A;  4ILA A;  5AFN A;  2XNV A;  3TLW A;  2WN9 A;  4X5T A;  4IL4 A;  5J5G A;  5FJV A;  3ZKR A;  2WNL A;  4XK9 A;  5HEO A;  4LML A;  2XQA A;  4UM3 S;  5CFB A;  3JAF A;  2UZ6 A;  2XYT A;  2XQ8 A;  2BR7 A;  3EAM A;  3WTN A;  3C79 A;  5J0Z A;  5AFM A;  3TLS A;  4UY2 A;  3LSV A;  3WTK A;  4ZJT A;  2Y57 A;  2XYS A;  4NPP A;  5AFJ A;  3WTH A;  2XQ5 A;  5HEJ A;  4ZK1 A;  5J5F A;  5AFL A;  5AFK A;  5HCJ A;  4FRR A;  3TLT A;  2Y54 A;  4ILB A;  3RQW A;  3RIA A;  2YME A;  2C9T A;  3SQ6 A;  2XZ6 A;  4AFT A;  4UM1 A;  4PIR A;  5BW2 A;  5J5I A;  5AFH A;  4D01 A;  4QH1 A;  4COF A;  2XNU A;  2W8G A;  2XQ6 A;  4TNW A;  3U8K A;  5BRX A;  4NZB A;  5HEU A;  4XHE A;  3U8J A;  4QAA A;  4ZR6 A;  5HEH A;  3SH1 A;  2BG9 E;  2XQ7 A;  2XQ3 A;  4AFG A;  4Z90 A;  5BP0 A;  3TLV A;  3RQU A;  4B5D A;  3EI0 A;  5L4H A;  4ILC A;  4LMK A;  4ZRU A;  3WTO A;  2YOE A;  3EHZ A;  2PGZ A;  4ZJS A;  5CO5 A;  2BYR A;  4IRE A;  4QAC A;  3ZDG A;  4F8H A;  5HCM A;  1I9B A;  4HQP A;  2WZY A;  2ZJU A;  4ALX A;  2YMD A;  3RI5 A;  4BFQ A;  3WTL A;  2ZJV A;  3JAE A;  3UU5 A;  3UU3 A;  5JME A;  2Y58 A;  2WNJ A;  5L4E A;  4ZZC A;  2BG9 A;  2X00 A;  5KE4 A;  1UX2 A;  2YKS A;  5KZU A;  2BYQ A;  4ZK4 A;  5AIN A;  3JAD A;  2BR8 A;  5HEG A;  4UM3 P;  3SQ9 A;  4UXU A;  4A97 A;  4QAB A;  4TNV A;  4IL9 A;  2Y7Y A;  3SIO A;  2Y56 A;  4AFH A;  5J5H A;  3TLU A;  2W8F A;  5SYO A;  4BQT A;  2XQ9 A;  5AFM B;  4QH4 A;  2XQ4 A;  4UM3 A;  3WTI A;  1UV6 A;  1UW6 A;  5IUX A;  4DBM A;  4TWF A;  2WNC A;  2QC1 B;  5L47 A;  5LXB A;  3RIF A;  3UQ4 A;  4WV9 A;  3C84 A;  4HFH A;  3PEO A;  4TWD A;  3UU8 A;  3ZDH A;  3GUA A;  3T4M A;  2BG9 C;  4HFC A;  4Z91 A;  3U8M A;  2BG9 B;  2BJ0 A;  2BYS A;  2VL0 A;  4A98 A;  3U8L A;  3PMZ A;  4QH5 A;  2XNT A;  3UU6 A;  3WIP A;  3U8N A;  2XZ5 A;  2PH9 A;  3RHW A;  4HFD A;  4HFE A;  3IGQ A;  3WTM A;  3UQ7 A;  2X00 D;  4LMJ A;  3WTJ A;  4HFI A;  2BYP A; 
#chains in the Genus database with same CATH homology
 2BYN A;  4EZ1 A;  4ZZB A;  2YN6 A;  3P4W A;  5LG3 A;  3UU4 A;  3UUB A;  4TWH A;  5TVC A;  3P50 A;  4HFB A;  4ILA A;  5AFN A;  2XNV A;  3TLW A;  2WN9 A;  4X5T A;  4IL4 A;  5J5G A;  5FJV A;  3ZKR A;  2WNL A;  4XK9 A;  5HEO A;  4LML A;  2XQA A;  4UM3 S;  5CFB A;  3JAF A;  2UZ6 A;  2XYT A;  2XQ8 A;  2BR7 A;  3EAM A;  3WTN A;  3C79 A;  5J0Z A;  5AFM A;  3TLS A;  4UY2 A;  3LSV A;  3WTK A;  4ZJT A;  2Y57 A;  2XYS A;  4NPP A;  5AFJ A;  3WTH A;  2XQ5 A;  5HEJ A;  4ZK1 A;  5J5F A;  5AFL A;  5AFK A;  5HCJ A;  4FRR A;  3TLT A;  2Y54 A;  4ILB A;  3RQW A;  3RIA A;  2YME A;  2C9T A;  3SQ6 A;  2XZ6 A;  4AFT A;  4UM1 A;  4PIR A;  5BW2 A;  5J5I A;  5AFH A;  4D01 A;  4QH1 A;  4COF A;  2XNU A;  2W8G A;  2XQ6 A;  4TNW A;  3U8K A;  5BRX A;  4NZB A;  5HEU A;  4XHE A;  3U8J A;  4QAA A;  4ZR6 A;  5HEH A;  3SH1 A;  2BG9 E;  2XQ7 A;  2XQ3 A;  4AFG A;  4Z90 A;  5BP0 A;  3TLV A;  3RQU A;  4B5D A;  3EI0 A;  5L4H A;  4ILC A;  4LMK A;  4ZRU A;  3WTO A;  2YOE A;  3EHZ A;  2PGZ A;  4ZJS A;  5CO5 A;  2BYR A;  4IRE A;  4QAC A;  3ZDG A;  4F8H A;  5HCM A;  1I9B A;  4HQP A;  2WZY A;  2ZJU A;  4ALX A;  2YMD A;  3RI5 A;  4BFQ A;  3WTL A;  2ZJV A;  3JAE A;  3UU5 A;  3UU3 A;  5JME A;  2Y58 A;  2WNJ A;  5L4E A;  4ZZC A;  2BG9 A;  2X00 A;  5KE4 A;  1UX2 A;  2YKS A;  5KZU A;  2BYQ A;  4ZK4 A;  5AIN A;  3JAD A;  2BR8 A;  5HEG A;  4UM3 P;  3SQ9 A;  4UXU A;  4A97 A;  4QAB A;  4TNV A;  4IL9 A;  2Y7Y A;  3SIO A;  2Y56 A;  4AFH A;  5J5H A;  3TLU A;  2W8F A;  5SYO A;  4BQT A;  2XQ9 A;  5AFM B;  4QH4 A;  2XQ4 A;  4UM3 A;  3WTI A;  1UV6 A;  1UW6 A;  5IUX A;  4DBM A;  4TWF A;  2WNC A;  2QC1 B;  5L47 A;  5LXB A;  3RIF A;  3UQ4 A;  4WV9 A;  3C84 A;  4HFH A;  3PEO A;  4TWD A;  3UU8 A;  3ZDH A;  3GUA A;  3T4M A;  2BG9 C;  4HFC A;  4Z91 A;  3U8M A;  2BG9 B;  2BJ0 A;  2BYS A;  2VL0 A;  4A98 A;  3U8L A;  3PMZ A;  4QH5 A;  2XNT A;  3UU6 A;  3WIP A;  3U8N A;  2XZ5 A;  2PH9 A;  3RHW A;  4HFD A;  4HFE A;  3IGQ A;  3WTM A;  3UQ7 A;  2X00 D;  4LMJ A;  3WTJ A;  4HFI A;  2BYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...