3WTIA

Crystal structure of lymnaea stagnalis acetylcholine-binding protein q55r mutant complexed with clothianidin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
ADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 46
structure length 207
sequence length 207
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtiA00
3SIOA 2Y7YA 3ZKRA 5HEHA 5AINA 2BR8A 4UM1A 3JAEA 4D01A 3EHZA 2XYTA 3TLUA 2WN9A 4ZJSA 5AFLA 2XNVA 4UM3P 4ZK4A 2BYRA 2BYQA 3WTIA 4BQTA 4X5TA 1UV6A 2Y54A 2Y57A 2XZ5A 3GUAA 4XK9A 4HFHA 2XQ6A 5L4HA 3TLVA 4B5DA 3JAFA 4UM3S 2PGZA 2XYSA 3U8KA 4UY2A 4LMLA 4AFTA 2X00D 3UU4A 5HCJA 4EZ1A 3C79A 3JADA 5HEGA 3UU5A 3PEOA 3UU3A 4ZJTA 5HCMA 3RQWA 3TLTA 2XQ3A 5CO5A 3ZDHA 5L47A 5HEOA 4ZK1A 4BFQA 4QAAA 3EAMA 4HFIA 3RI5A 4COFA 3WTMA 5BW2A 4ILCA 2BG9A 2BR7A 1I9BA 2BG9C 4ZZBA 2XQ8A 4IL9A 2ZJVA 4QH4A 2VL0A 3UQ4A 4ILBA 2ZJUA 2YOEA 3SQ6A 4TNVA 5AFMA 4HFCA 4IL4A 5LXBA 1UW6A 5J5GA 1UX2A 5FJVA 2WNCA 2UZ6A 2WZYA 2YMDA 4WV9A 2XQ5A 4DBMA 4F8HA 3RIAA 3WIPA 2Y56A 2BJ0A 3IGQA 5CFBA 5KE4A 4TWFA 2BG9E 3TLSA 3LSVA 4LMKA 2BYNA 2YMEA 4A98A 4NZBA 3RIFA 5AFKA 4HFDA 3U8JA 3RQUA 2C9TA 3WTLA 2XNTA 2PH9A 4LMJA 5BP0A 2XQ7A 3ZDGA 3WTHA 4UXUA 5AFNA 4ZRUA 2QC1B 2XNUA 2X00A 3U8NA 2WNJA 2XQ9A 2XZ6A 4Z90A 2BYSA 4IREA 3SH1A 2Y58A 3UU8A 5LG3A 4ZR6A 4NPPA 4TWDA 4HQPA 5AFJA 4QACA 2BG9B 5HEJA 5KZUA 3P50A 5JMEA 3P4WA 4AFHA 4QH1A 2BYPA 3WTKA 4TWHA 5L4EA 4ALXA 3RHWA 2XQAA 3C84A 3TLWA 2W8FA 5AFMB 4AFGA 4ZZCA 4HFBA 4QABA 3WTOA 4Z91A 2YN6A 3EI0A 3WTNA 5IUXA 2XQ4A 5SYOA 4QH5A 2YKSA 3U8LA 3UUBA 5BRXA 3UQ7A 4ILAA 3SQ9A 2WNLA 4HFEA 3PMZA 4UM3A 3U8MA 5J5IA 4A97A 5J5FA 4PIRA 5J0ZA 3T4MA 5TVCA 5J5HA 5HEUA 4XHEA 2W8GA 4TNWA 4FRRA 3WTJA 5AFHA 3UU6A
chains in the Genus database with same CATH superfamily
3SIOA 2Y7YA 3ZKRA 5HEHA 5AINA 2BR8A 4UM1A 3JAEA 4D01A 3EHZA 2XYTA 3TLUA 2WN9A 4ZJSA 5AFLA 2XNVA 4UM3P 4ZK4A 2BYRA 2BYQA 3WTIA 4BQTA 4X5TA 1UV6A 2Y54A 2Y57A 2XZ5A 3GUAA 4XK9A 4HFHA 2XQ6A 5L4HA 3TLVA 4B5DA 3JAFA 4UM3S 2PGZA 2XYSA 3U8KA 4UY2A 4LMLA 4AFTA 2X00D 3UU4A 5HCJA 4EZ1A 3C79A 3JADA 5HEGA 3UU5A 3PEOA 3UU3A 4ZJTA 5HCMA 3RQWA 3TLTA 2XQ3A 5CO5A 3ZDHA 5L47A 5HEOA 4ZK1A 4BFQA 4QAAA 3EAMA 4HFIA 3RI5A 4COFA 3WTMA 5BW2A 4ILCA 2BG9A 2BR7A 1I9BA 2BG9C 4ZZBA 2XQ8A 4IL9A 2ZJVA 4QH4A 2VL0A 3UQ4A 4ILBA 2ZJUA 2YOEA 3SQ6A 4TNVA 5AFMA 4HFCA 4IL4A 5LXBA 1UW6A 5J5GA 1UX2A 5FJVA 2WNCA 2UZ6A 2WZYA 2YMDA 4WV9A 2XQ5A 4DBMA 4F8HA 3RIAA 3WIPA 2Y56A 2BJ0A 3IGQA 5CFBA 5KE4A 4TWFA 2BG9E 3TLSA 3LSVA 4LMKA 2BYNA 2YMEA 4A98A 4NZBA 3RIFA 5AFKA 4HFDA 3U8JA 3RQUA 2C9TA 3WTLA 2XNTA 2PH9A 4LMJA 5BP0A 2XQ7A 3ZDGA 3WTHA 4UXUA 5AFNA 4ZRUA 2QC1B 2XNUA 2X00A 3U8NA 2WNJA 2XQ9A 2XZ6A 4Z90A 2BYSA 4IREA 3SH1A 2Y58A 3UU8A 5LG3A 4ZR6A 4NPPA 4TWDA 4HQPA 5AFJA 4QACA 2BG9B 5HEJA 5KZUA 3P50A 5JMEA 3P4WA 4AFHA 4QH1A 2BYPA 3WTKA 4TWHA 5L4EA 4ALXA 3RHWA 2XQAA 3C84A 3TLWA 2W8FA 5AFMB 4AFGA 4ZZCA 4HFBA 4QABA 3WTOA 4Z91A 2YN6A 3EI0A 3WTNA 5IUXA 2XQ4A 5SYOA 4QH5A 2YKSA 3U8LA 3UUBA 5BRXA 3UQ7A 4ILAA 3SQ9A 2WNLA 4HFEA 3PMZA 4UM3A 3U8MA 5J5IA 4A97A 5J5FA 4PIRA 5J0ZA 3T4MA 5TVCA 5J5HA 5HEUA 4XHEA 2W8GA 4TNWA 4FRRA 3WTJA 5AFHA 3UU6A
chains in the Genus database with same CATH topology
3SIOA 2Y7YA 3ZKRA 5HEHA 5AINA 2BR8A 4UM1A 3JAEA 4D01A 3EHZA 2XYTA 3TLUA 2WN9A 4ZJSA 5AFLA 2XNVA 4UM3P 4ZK4A 2BYRA 2BYQA 3WTIA 4BQTA 4X5TA 1UV6A 2Y54A 2Y57A 2XZ5A 3GUAA 4XK9A 4HFHA 2XQ6A 5L4HA 3TLVA 4B5DA 3JAFA 4UM3S 2PGZA 2XYSA 3U8KA 4UY2A 4LMLA 4AFTA 2X00D 3UU4A 5HCJA 4EZ1A 3C79A 3JADA 5HEGA 3UU5A 3PEOA 3UU3A 4ZJTA 5HCMA 3RQWA 3TLTA 2XQ3A 5CO5A 3ZDHA 5L47A 5HEOA 4ZK1A 4BFQA 4QAAA 3EAMA 4HFIA 3RI5A 4COFA 3WTMA 5BW2A 4ILCA 2BG9A 2BR7A 1I9BA 2BG9C 4ZZBA 2XQ8A 4IL9A 2ZJVA 4QH4A 2VL0A 3UQ4A 4ILBA 2ZJUA 2YOEA 3SQ6A 4TNVA 5AFMA 4HFCA 4IL4A 5LXBA 1UW6A 5J5GA 1UX2A 5FJVA 2WNCA 2UZ6A 2WZYA 2YMDA 4WV9A 2XQ5A 4DBMA 4F8HA 3RIAA 3WIPA 2Y56A 2BJ0A 3IGQA 5CFBA 5KE4A 4TWFA 2BG9E 3TLSA 3LSVA 4LMKA 2BYNA 2YMEA 4A98A 4NZBA 3RIFA 5AFKA 4HFDA 3U8JA 3RQUA 2C9TA 3WTLA 2XNTA 2PH9A 4LMJA 5BP0A 2XQ7A 3ZDGA 3WTHA 4UXUA 5AFNA 4ZRUA 2QC1B 2XNUA 2X00A 3U8NA 2WNJA 2XQ9A 2XZ6A 4Z90A 2BYSA 4IREA 3SH1A 2Y58A 3UU8A 5LG3A 4ZR6A 4NPPA 4TWDA 4HQPA 5AFJA 4QACA 2BG9B 5HEJA 5KZUA 3P50A 5JMEA 3P4WA 4AFHA 4QH1A 2BYPA 3WTKA 4TWHA 5L4EA 4ALXA 3RHWA 2XQAA 3C84A 3TLWA 2W8FA 5AFMB 4AFGA 4ZZCA 4HFBA 4QABA 3WTOA 4Z91A 2YN6A 3EI0A 3WTNA 5IUXA 2XQ4A 5SYOA 4QH5A 2YKSA 3U8LA 3UUBA 5BRXA 3UQ7A 4ILAA 3SQ9A 2WNLA 4HFEA 3PMZA 4UM3A 3U8MA 5J5IA 4A97A 5J5FA 4PIRA 5J0ZA 3T4MA 5TVCA 5J5HA 5HEUA 4XHEA 2W8GA 4TNWA 4FRRA 3WTJA 5AFHA 3UU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIO A;  2Y7Y A;  3ZKR A;  5HEH A;  5AIN A;  2BR8 A;  4UM1 A;  3JAE A;  4D01 A;  3EHZ A;  2XYT A;  3TLU A;  2WN9 A;  4ZJS A;  5AFL A;  2XNV A;  4UM3 P;  4ZK4 A;  2BYR A;  2BYQ A;  3WTI A;  4BQT A;  4X5T A;  1UV6 A;  2Y54 A;  2Y57 A;  2XZ5 A;  3GUA A;  4XK9 A;  4HFH A;  2XQ6 A;  5L4H A;  3TLV A;  4B5D A;  3JAF A;  4UM3 S;  2PGZ A;  2XYS A;  3U8K A;  4UY2 A;  4LML A;  4AFT A;  2X00 D;  3UU4 A;  5HCJ A;  4EZ1 A;  3C79 A;  3JAD A;  5HEG A;  3UU5 A;  3PEO A;  3UU3 A;  4ZJT A;  5HCM A;  3RQW A;  3TLT A;  2XQ3 A;  5CO5 A;  3ZDH A;  5L47 A;  5HEO A;  4ZK1 A;  4BFQ A;  4QAA A;  3EAM A;  4HFI A;  3RI5 A;  4COF A;  3WTM A;  5BW2 A;  4ILC A;  2BG9 A;  2BR7 A;  1I9B A;  2BG9 C;  4ZZB A;  2XQ8 A;  4IL9 A;  2ZJV A;  4QH4 A;  2VL0 A;  3UQ4 A;  4ILB A;  2ZJU A;  2YOE A;  3SQ6 A;  4TNV A;  5AFM A;  4HFC A;  4IL4 A;  5LXB A;  1UW6 A;  5J5G A;  1UX2 A;  5FJV A;  2WNC A;  2UZ6 A;  2WZY A;  2YMD A;  4WV9 A;  2XQ5 A;  4DBM A;  4F8H A;  3RIA A;  3WIP A;  2Y56 A;  2BJ0 A;  3IGQ A;  5CFB A;  5KE4 A;  4TWF A;  2BG9 E;  3TLS A;  3LSV A;  4LMK A;  2BYN A;  2YME A;  4A98 A;  4NZB A;  3RIF A;  5AFK A;  4HFD A;  3U8J A;  3RQU A;  2C9T A;  3WTL A;  2XNT A;  2PH9 A;  4LMJ A;  5BP0 A;  2XQ7 A;  3ZDG A;  3WTH A;  4UXU A;  5AFN A;  4ZRU A;  2QC1 B;  2XNU A;  2X00 A;  3U8N A;  2WNJ A;  2XQ9 A;  2XZ6 A;  4Z90 A;  2BYS A;  4IRE A;  3SH1 A;  2Y58 A;  3UU8 A;  5LG3 A;  4ZR6 A;  4NPP A;  4TWD A;  4HQP A;  5AFJ A;  4QAC A;  2BG9 B;  5HEJ A;  5KZU A;  3P50 A;  5JME A;  3P4W A;  4AFH A;  4QH1 A;  2BYP A;  3WTK A;  4TWH A;  5L4E A;  4ALX A;  3RHW A;  2XQA A;  3C84 A;  3TLW A;  2W8F A;  5AFM B;  4AFG A;  4ZZC A;  4HFB A;  4QAB A;  3WTO A;  4Z91 A;  2YN6 A;  3EI0 A;  3WTN A;  5IUX A;  2XQ4 A;  5SYO A;  4QH5 A;  2YKS A;  3U8L A;  3UUB A;  5BRX A;  3UQ7 A;  4ILA A;  3SQ9 A;  2WNL A;  4HFE A;  3PMZ A;  4UM3 A;  3U8M A;  5J5I A;  4A97 A;  5J5F A;  4PIR A;  5J0Z A;  3T4M A;  5TVC A;  5J5H A;  5HEU A;  4XHE A;  2W8G A;  4TNW A;  4FRR A;  3WTJ A;  5AFH A;  3UU6 A; 
#chains in the Genus database with same CATH topology
 3SIO A;  2Y7Y A;  3ZKR A;  5HEH A;  5AIN A;  2BR8 A;  4UM1 A;  3JAE A;  4D01 A;  3EHZ A;  2XYT A;  3TLU A;  2WN9 A;  4ZJS A;  5AFL A;  2XNV A;  4UM3 P;  4ZK4 A;  2BYR A;  2BYQ A;  3WTI A;  4BQT A;  4X5T A;  1UV6 A;  2Y54 A;  2Y57 A;  2XZ5 A;  3GUA A;  4XK9 A;  4HFH A;  2XQ6 A;  5L4H A;  3TLV A;  4B5D A;  3JAF A;  4UM3 S;  2PGZ A;  2XYS A;  3U8K A;  4UY2 A;  4LML A;  4AFT A;  2X00 D;  3UU4 A;  5HCJ A;  4EZ1 A;  3C79 A;  3JAD A;  5HEG A;  3UU5 A;  3PEO A;  3UU3 A;  4ZJT A;  5HCM A;  3RQW A;  3TLT A;  2XQ3 A;  5CO5 A;  3ZDH A;  5L47 A;  5HEO A;  4ZK1 A;  4BFQ A;  4QAA A;  3EAM A;  4HFI A;  3RI5 A;  4COF A;  3WTM A;  5BW2 A;  4ILC A;  2BG9 A;  2BR7 A;  1I9B A;  2BG9 C;  4ZZB A;  2XQ8 A;  4IL9 A;  2ZJV A;  4QH4 A;  2VL0 A;  3UQ4 A;  4ILB A;  2ZJU A;  2YOE A;  3SQ6 A;  4TNV A;  5AFM A;  4HFC A;  4IL4 A;  5LXB A;  1UW6 A;  5J5G A;  1UX2 A;  5FJV A;  2WNC A;  2UZ6 A;  2WZY A;  2YMD A;  4WV9 A;  2XQ5 A;  4DBM A;  4F8H A;  3RIA A;  3WIP A;  2Y56 A;  2BJ0 A;  3IGQ A;  5CFB A;  5KE4 A;  4TWF A;  2BG9 E;  3TLS A;  3LSV A;  4LMK A;  2BYN A;  2YME A;  4A98 A;  4NZB A;  3RIF A;  5AFK A;  4HFD A;  3U8J A;  3RQU A;  2C9T A;  3WTL A;  2XNT A;  2PH9 A;  4LMJ A;  5BP0 A;  2XQ7 A;  3ZDG A;  3WTH A;  4UXU A;  5AFN A;  4ZRU A;  2QC1 B;  2XNU A;  2X00 A;  3U8N A;  2WNJ A;  2XQ9 A;  2XZ6 A;  4Z90 A;  2BYS A;  4IRE A;  3SH1 A;  2Y58 A;  3UU8 A;  5LG3 A;  4ZR6 A;  4NPP A;  4TWD A;  4HQP A;  5AFJ A;  4QAC A;  2BG9 B;  5HEJ A;  5KZU A;  3P50 A;  5JME A;  3P4W A;  4AFH A;  4QH1 A;  2BYP A;  3WTK A;  4TWH A;  5L4E A;  4ALX A;  3RHW A;  2XQA A;  3C84 A;  3TLW A;  2W8F A;  5AFM B;  4AFG A;  4ZZC A;  4HFB A;  4QAB A;  3WTO A;  4Z91 A;  2YN6 A;  3EI0 A;  3WTN A;  5IUX A;  2XQ4 A;  5SYO A;  4QH5 A;  2YKS A;  3U8L A;  3UUB A;  5BRX A;  3UQ7 A;  4ILA A;  3SQ9 A;  2WNL A;  4HFE A;  3PMZ A;  4UM3 A;  3U8M A;  5J5I A;  4A97 A;  5J5F A;  4PIR A;  5J0Z A;  3T4M A;  5TVC A;  5J5H A;  5HEU A;  4XHE A;  2W8G A;  4TNW A;  4FRR A;  3WTJ A;  5AFH A;  3UU6 A; 
#chains in the Genus database with same CATH homology
 3SIO A;  2Y7Y A;  3ZKR A;  5HEH A;  5AIN A;  2BR8 A;  4UM1 A;  3JAE A;  4D01 A;  3EHZ A;  2XYT A;  3TLU A;  2WN9 A;  4ZJS A;  5AFL A;  2XNV A;  4UM3 P;  4ZK4 A;  2BYR A;  2BYQ A;  3WTI A;  4BQT A;  4X5T A;  1UV6 A;  2Y54 A;  2Y57 A;  2XZ5 A;  3GUA A;  4XK9 A;  4HFH A;  2XQ6 A;  5L4H A;  3TLV A;  4B5D A;  3JAF A;  4UM3 S;  2PGZ A;  2XYS A;  3U8K A;  4UY2 A;  4LML A;  4AFT A;  2X00 D;  3UU4 A;  5HCJ A;  4EZ1 A;  3C79 A;  3JAD A;  5HEG A;  3UU5 A;  3PEO A;  3UU3 A;  4ZJT A;  5HCM A;  3RQW A;  3TLT A;  2XQ3 A;  5CO5 A;  3ZDH A;  5L47 A;  5HEO A;  4ZK1 A;  4BFQ A;  4QAA A;  3EAM A;  4HFI A;  3RI5 A;  4COF A;  3WTM A;  5BW2 A;  4ILC A;  2BG9 A;  2BR7 A;  1I9B A;  2BG9 C;  4ZZB A;  2XQ8 A;  4IL9 A;  2ZJV A;  4QH4 A;  2VL0 A;  3UQ4 A;  4ILB A;  2ZJU A;  2YOE A;  3SQ6 A;  4TNV A;  5AFM A;  4HFC A;  4IL4 A;  5LXB A;  1UW6 A;  5J5G A;  1UX2 A;  5FJV A;  2WNC A;  2UZ6 A;  2WZY A;  2YMD A;  4WV9 A;  2XQ5 A;  4DBM A;  4F8H A;  3RIA A;  3WIP A;  2Y56 A;  2BJ0 A;  3IGQ A;  5CFB A;  5KE4 A;  4TWF A;  2BG9 E;  3TLS A;  3LSV A;  4LMK A;  2BYN A;  2YME A;  4A98 A;  4NZB A;  3RIF A;  5AFK A;  4HFD A;  3U8J A;  3RQU A;  2C9T A;  3WTL A;  2XNT A;  2PH9 A;  4LMJ A;  5BP0 A;  2XQ7 A;  3ZDG A;  3WTH A;  4UXU A;  5AFN A;  4ZRU A;  2QC1 B;  2XNU A;  2X00 A;  3U8N A;  2WNJ A;  2XQ9 A;  2XZ6 A;  4Z90 A;  2BYS A;  4IRE A;  3SH1 A;  2Y58 A;  3UU8 A;  5LG3 A;  4ZR6 A;  4NPP A;  4TWD A;  4HQP A;  5AFJ A;  4QAC A;  2BG9 B;  5HEJ A;  5KZU A;  3P50 A;  5JME A;  3P4W A;  4AFH A;  4QH1 A;  2BYP A;  3WTK A;  4TWH A;  5L4E A;  4ALX A;  3RHW A;  2XQA A;  3C84 A;  3TLW A;  2W8F A;  5AFM B;  4AFG A;  4ZZC A;  4HFB A;  4QAB A;  3WTO A;  4Z91 A;  2YN6 A;  3EI0 A;  3WTN A;  5IUX A;  2XQ4 A;  5SYO A;  4QH5 A;  2YKS A;  3U8L A;  3UUB A;  5BRX A;  3UQ7 A;  4ILA A;  3SQ9 A;  2WNL A;  4HFE A;  3PMZ A;  4UM3 A;  3U8M A;  5J5I A;  4A97 A;  5J5F A;  4PIR A;  5J0Z A;  3T4M A;  5TVC A;  5J5H A;  5HEU A;  4XHE A;  2W8G A;  4TNW A;  4FRR A;  3WTJ A;  5AFH A;  3UU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...