1UV6A

X-ray structure of acetylcholine binding protein (achbp) in complex with carbamylcholine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoprotein
molecule keywords ACETYLCHOLINE-BINDING PROTEIN
publication title Nicotine and Carbamylcholine Binding to Nicotinic Acetylcholine Receptors as Studied in Achbp Crystal Structures
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1uv6A00
5LG3A 2W8FA 2XQ5A 4LMLA 3UU6A 3EHZA 3WIPA 2Y56A 4TWDA 3TLSA 4HFDA 3WTMA 5AFJA 5HEOA 2BYPA 5J0ZA 4BQTA 2Y58A 4ILBA 5L4EA 5J5IA 2XQAA 3SH1A 3SIOA 5HCJA 2XQ4A 5HEUA 5HCMA 4HFIA 3UUBA 4HFBA 5L47A 3SQ9A 2XNUA 4ALXA 2WN9A 3WTIA 5AFLA 3RIAA 2XQ3A 4QH1A 3GUAA 4ZZBA 4UXUA 2X00D 5HEGA 4B5DA 4UM3S 2XQ9A 2XYTA 4LMJA 4ZRUA 3RHWA 2X00A 4TNVA 4UM1A 4Z91A 5BP0A 3P50A 3JAFA 5BRXA 4UM3A 3TLWA 3IGQA 3WTOA 4IL4A 3PMZA 5CO5A 3WTLA 5AFHA 2BYRA 2C9TA 5AFNA 5KZUA 3ZDHA 2YKSA 4HFCA 2BG9B 2YMEA 4HFEA 5HEJA 4IREA 2WNLA 5AINA 3TLUA 4F8HA 4LMKA 1I9BA 5BW2A 2BYNA 2YMDA 4PIRA 5TVCA 2ZJUA 3WTHA 4QH5A 3UU4A 2XNVA 4X5TA 3UU3A 2BG9A 3PEOA 3UU5A 1UW6A 2VL0A 2XNTA 3SQ6A 5IUXA 3UQ7A 4QABA 5LXBA 2BJ0A 1UX2A 2YN6A 3JAEA 3LSVA 3WTJA 4ILAA 4HFHA 4Z90A 5J5FA 4AFGA 5CFBA 4XK9A 5AFMB 2YOEA 4XHEA 2Y57A 2BG9E 3U8JA 2ZJVA 4EZ1A 4TWFA 4COFA 3RIFA 3ZKRA 2BG9C 2BYSA 3WTNA 2PH9A 3WTKA 2WNJA 3EAMA 3UU8A 2WNCA 3U8MA 3TLTA 4BFQA 4ZK4A 3P4WA 3TLVA 4IL9A 3UQ4A 3C79A 4D01A 3U8KA 3T4MA 4NPPA 5AFMA 4ILCA 2XQ6A 5JMEA 4NZBA 2XZ5A 4A98A 4DBMA 3C84A 4HQPA 3EI0A 5FJVA 4UY2A 4TNWA 2XQ8A 5J5GA 4WV9A 4AFHA 3U8LA 2QC1B 4ZZCA 4UM3P 2PGZA 5AFKA 4ZK1A 4A97A 2WZYA 5KE4A 2Y7YA 3RQWA 4TWHA 2UZ6A 3RI5A 2BR7A 2XZ6A 5SYOA 5J5HA 4ZR6A 3RQUA 5HEHA 2Y54A 3ZDGA 2BR8A 4FRRA 4AFTA 4QH4A 2W8GA 4QACA 4ZJTA 4QAAA 5L4HA 2BYQA 3JADA 2XQ7A 1UV6A 2XYSA 3U8NA 4ZJSA
chains in the Genus database with same CATH superfamily
5LG3A 2W8FA 2XQ5A 4LMLA 3UU6A 3EHZA 3WIPA 2Y56A 4TWDA 3TLSA 4HFDA 3WTMA 5AFJA 5HEOA 2BYPA 5J0ZA 4BQTA 2Y58A 4ILBA 5L4EA 5J5IA 2XQAA 3SH1A 3SIOA 5HCJA 2XQ4A 5HEUA 5HCMA 4HFIA 3UUBA 4HFBA 5L47A 3SQ9A 2XNUA 4ALXA 2WN9A 3WTIA 5AFLA 3RIAA 2XQ3A 4QH1A 3GUAA 4ZZBA 4UXUA 2X00D 5HEGA 4B5DA 4UM3S 2XQ9A 2XYTA 4LMJA 4ZRUA 3RHWA 2X00A 4TNVA 4UM1A 4Z91A 5BP0A 3P50A 3JAFA 5BRXA 4UM3A 3TLWA 3IGQA 3WTOA 4IL4A 3PMZA 5CO5A 3WTLA 5AFHA 2BYRA 2C9TA 5AFNA 5KZUA 3ZDHA 2YKSA 4HFCA 2BG9B 2YMEA 4HFEA 5HEJA 4IREA 2WNLA 5AINA 3TLUA 4F8HA 4LMKA 1I9BA 5BW2A 2BYNA 2YMDA 4PIRA 5TVCA 2ZJUA 3WTHA 4QH5A 3UU4A 2XNVA 4X5TA 3UU3A 2BG9A 3PEOA 3UU5A 1UW6A 2VL0A 2XNTA 3SQ6A 5IUXA 3UQ7A 4QABA 5LXBA 2BJ0A 1UX2A 2YN6A 3JAEA 3LSVA 3WTJA 4ILAA 4HFHA 4Z90A 5J5FA 4AFGA 5CFBA 4XK9A 5AFMB 2YOEA 4XHEA 2Y57A 2BG9E 3U8JA 2ZJVA 4EZ1A 4TWFA 4COFA 3RIFA 3ZKRA 2BG9C 2BYSA 3WTNA 2PH9A 3WTKA 2WNJA 3EAMA 3UU8A 2WNCA 3U8MA 3TLTA 4BFQA 4ZK4A 3P4WA 3TLVA 4IL9A 3UQ4A 3C79A 4D01A 3U8KA 3T4MA 4NPPA 5AFMA 4ILCA 2XQ6A 5JMEA 4NZBA 2XZ5A 4A98A 4DBMA 3C84A 4HQPA 3EI0A 5FJVA 4UY2A 4TNWA 2XQ8A 5J5GA 4WV9A 4AFHA 3U8LA 2QC1B 4ZZCA 4UM3P 2PGZA 5AFKA 4ZK1A 4A97A 2WZYA 5KE4A 2Y7YA 3RQWA 4TWHA 2UZ6A 3RI5A 2BR7A 2XZ6A 5SYOA 5J5HA 4ZR6A 3RQUA 5HEHA 2Y54A 3ZDGA 2BR8A 4FRRA 4AFTA 4QH4A 2W8GA 4QACA 4ZJTA 4QAAA 5L4HA 2BYQA 3JADA 2XQ7A 1UV6A 2XYSA 3U8NA 4ZJSA
chains in the Genus database with same CATH topology
5LG3A 2W8FA 2XQ5A 4LMLA 3UU6A 3EHZA 3WIPA 2Y56A 4TWDA 3TLSA 4HFDA 3WTMA 5AFJA 5HEOA 2BYPA 5J0ZA 4BQTA 2Y58A 4ILBA 5L4EA 5J5IA 2XQAA 3SH1A 3SIOA 5HCJA 2XQ4A 5HEUA 5HCMA 4HFIA 3UUBA 4HFBA 5L47A 3SQ9A 2XNUA 4ALXA 2WN9A 3WTIA 5AFLA 3RIAA 2XQ3A 4QH1A 3GUAA 4ZZBA 4UXUA 2X00D 5HEGA 4B5DA 4UM3S 2XQ9A 2XYTA 4LMJA 4ZRUA 3RHWA 2X00A 4TNVA 4UM1A 4Z91A 5BP0A 3P50A 3JAFA 5BRXA 4UM3A 3TLWA 3IGQA 3WTOA 4IL4A 3PMZA 5CO5A 3WTLA 5AFHA 2BYRA 2C9TA 5AFNA 5KZUA 3ZDHA 2YKSA 4HFCA 2BG9B 2YMEA 4HFEA 5HEJA 4IREA 2WNLA 5AINA 3TLUA 4F8HA 4LMKA 1I9BA 5BW2A 2BYNA 2YMDA 4PIRA 5TVCA 2ZJUA 3WTHA 4QH5A 3UU4A 2XNVA 4X5TA 3UU3A 2BG9A 3PEOA 3UU5A 1UW6A 2VL0A 2XNTA 3SQ6A 5IUXA 3UQ7A 4QABA 5LXBA 2BJ0A 1UX2A 2YN6A 3JAEA 3LSVA 3WTJA 4ILAA 4HFHA 4Z90A 5J5FA 4AFGA 5CFBA 4XK9A 5AFMB 2YOEA 4XHEA 2Y57A 2BG9E 3U8JA 2ZJVA 4EZ1A 4TWFA 4COFA 3RIFA 3ZKRA 2BG9C 2BYSA 3WTNA 2PH9A 3WTKA 2WNJA 3EAMA 3UU8A 2WNCA 3U8MA 3TLTA 4BFQA 4ZK4A 3P4WA 3TLVA 4IL9A 3UQ4A 3C79A 4D01A 3U8KA 3T4MA 4NPPA 5AFMA 4ILCA 2XQ6A 5JMEA 4NZBA 2XZ5A 4A98A 4DBMA 3C84A 4HQPA 3EI0A 5FJVA 4UY2A 4TNWA 2XQ8A 5J5GA 4WV9A 4AFHA 3U8LA 2QC1B 4ZZCA 4UM3P 2PGZA 5AFKA 4ZK1A 4A97A 2WZYA 5KE4A 2Y7YA 3RQWA 4TWHA 2UZ6A 3RI5A 2BR7A 2XZ6A 5SYOA 5J5HA 4ZR6A 3RQUA 5HEHA 2Y54A 3ZDGA 2BR8A 4FRRA 4AFTA 4QH4A 2W8GA 4QACA 4ZJTA 4QAAA 5L4HA 2BYQA 3JADA 2XQ7A 1UV6A 2XYSA 3U8NA 4ZJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG3 A;  2W8F A;  2XQ5 A;  4LML A;  3UU6 A;  3EHZ A;  3WIP A;  2Y56 A;  4TWD A;  3TLS A;  4HFD A;  3WTM A;  5AFJ A;  5HEO A;  2BYP A;  5J0Z A;  4BQT A;  2Y58 A;  4ILB A;  5L4E A;  5J5I A;  2XQA A;  3SH1 A;  3SIO A;  5HCJ A;  2XQ4 A;  5HEU A;  5HCM A;  4HFI A;  3UUB A;  4HFB A;  5L47 A;  3SQ9 A;  2XNU A;  4ALX A;  2WN9 A;  3WTI A;  5AFL A;  3RIA A;  2XQ3 A;  4QH1 A;  3GUA A;  4ZZB A;  4UXU A;  2X00 D;  5HEG A;  4B5D A;  4UM3 S;  2XQ9 A;  2XYT A;  4LMJ A;  4ZRU A;  3RHW A;  2X00 A;  4TNV A;  4UM1 A;  4Z91 A;  5BP0 A;  3P50 A;  3JAF A;  5BRX A;  4UM3 A;  3TLW A;  3IGQ A;  3WTO A;  4IL4 A;  3PMZ A;  5CO5 A;  3WTL A;  5AFH A;  2BYR A;  2C9T A;  5AFN A;  5KZU A;  3ZDH A;  2YKS A;  4HFC A;  2BG9 B;  2YME A;  4HFE A;  5HEJ A;  4IRE A;  2WNL A;  5AIN A;  3TLU A;  4F8H A;  4LMK A;  1I9B A;  5BW2 A;  2BYN A;  2YMD A;  4PIR A;  5TVC A;  2ZJU A;  3WTH A;  4QH5 A;  3UU4 A;  2XNV A;  4X5T A;  3UU3 A;  2BG9 A;  3PEO A;  3UU5 A;  1UW6 A;  2VL0 A;  2XNT A;  3SQ6 A;  5IUX A;  3UQ7 A;  4QAB A;  5LXB A;  2BJ0 A;  1UX2 A;  2YN6 A;  3JAE A;  3LSV A;  3WTJ A;  4ILA A;  4HFH A;  4Z90 A;  5J5F A;  4AFG A;  5CFB A;  4XK9 A;  5AFM B;  2YOE A;  4XHE A;  2Y57 A;  2BG9 E;  3U8J A;  2ZJV A;  4EZ1 A;  4TWF A;  4COF A;  3RIF A;  3ZKR A;  2BG9 C;  2BYS A;  3WTN A;  2PH9 A;  3WTK A;  2WNJ A;  3EAM A;  3UU8 A;  2WNC A;  3U8M A;  3TLT A;  4BFQ A;  4ZK4 A;  3P4W A;  3TLV A;  4IL9 A;  3UQ4 A;  3C79 A;  4D01 A;  3U8K A;  3T4M A;  4NPP A;  5AFM A;  4ILC A;  2XQ6 A;  5JME A;  4NZB A;  2XZ5 A;  4A98 A;  4DBM A;  3C84 A;  4HQP A;  3EI0 A;  5FJV A;  4UY2 A;  4TNW A;  2XQ8 A;  5J5G A;  4WV9 A;  4AFH A;  3U8L A;  2QC1 B;  4ZZC A;  4UM3 P;  2PGZ A;  5AFK A;  4ZK1 A;  4A97 A;  2WZY A;  5KE4 A;  2Y7Y A;  3RQW A;  4TWH A;  2UZ6 A;  3RI5 A;  2BR7 A;  2XZ6 A;  5SYO A;  5J5H A;  4ZR6 A;  3RQU A;  5HEH A;  2Y54 A;  3ZDG A;  2BR8 A;  4FRR A;  4AFT A;  4QH4 A;  2W8G A;  4QAC A;  4ZJT A;  4QAA A;  5L4H A;  2BYQ A;  3JAD A;  2XQ7 A;  1UV6 A;  2XYS A;  3U8N A;  4ZJS A; 
#chains in the Genus database with same CATH topology
 5LG3 A;  2W8F A;  2XQ5 A;  4LML A;  3UU6 A;  3EHZ A;  3WIP A;  2Y56 A;  4TWD A;  3TLS A;  4HFD A;  3WTM A;  5AFJ A;  5HEO A;  2BYP A;  5J0Z A;  4BQT A;  2Y58 A;  4ILB A;  5L4E A;  5J5I A;  2XQA A;  3SH1 A;  3SIO A;  5HCJ A;  2XQ4 A;  5HEU A;  5HCM A;  4HFI A;  3UUB A;  4HFB A;  5L47 A;  3SQ9 A;  2XNU A;  4ALX A;  2WN9 A;  3WTI A;  5AFL A;  3RIA A;  2XQ3 A;  4QH1 A;  3GUA A;  4ZZB A;  4UXU A;  2X00 D;  5HEG A;  4B5D A;  4UM3 S;  2XQ9 A;  2XYT A;  4LMJ A;  4ZRU A;  3RHW A;  2X00 A;  4TNV A;  4UM1 A;  4Z91 A;  5BP0 A;  3P50 A;  3JAF A;  5BRX A;  4UM3 A;  3TLW A;  3IGQ A;  3WTO A;  4IL4 A;  3PMZ A;  5CO5 A;  3WTL A;  5AFH A;  2BYR A;  2C9T A;  5AFN A;  5KZU A;  3ZDH A;  2YKS A;  4HFC A;  2BG9 B;  2YME A;  4HFE A;  5HEJ A;  4IRE A;  2WNL A;  5AIN A;  3TLU A;  4F8H A;  4LMK A;  1I9B A;  5BW2 A;  2BYN A;  2YMD A;  4PIR A;  5TVC A;  2ZJU A;  3WTH A;  4QH5 A;  3UU4 A;  2XNV A;  4X5T A;  3UU3 A;  2BG9 A;  3PEO A;  3UU5 A;  1UW6 A;  2VL0 A;  2XNT A;  3SQ6 A;  5IUX A;  3UQ7 A;  4QAB A;  5LXB A;  2BJ0 A;  1UX2 A;  2YN6 A;  3JAE A;  3LSV A;  3WTJ A;  4ILA A;  4HFH A;  4Z90 A;  5J5F A;  4AFG A;  5CFB A;  4XK9 A;  5AFM B;  2YOE A;  4XHE A;  2Y57 A;  2BG9 E;  3U8J A;  2ZJV A;  4EZ1 A;  4TWF A;  4COF A;  3RIF A;  3ZKR A;  2BG9 C;  2BYS A;  3WTN A;  2PH9 A;  3WTK A;  2WNJ A;  3EAM A;  3UU8 A;  2WNC A;  3U8M A;  3TLT A;  4BFQ A;  4ZK4 A;  3P4W A;  3TLV A;  4IL9 A;  3UQ4 A;  3C79 A;  4D01 A;  3U8K A;  3T4M A;  4NPP A;  5AFM A;  4ILC A;  2XQ6 A;  5JME A;  4NZB A;  2XZ5 A;  4A98 A;  4DBM A;  3C84 A;  4HQP A;  3EI0 A;  5FJV A;  4UY2 A;  4TNW A;  2XQ8 A;  5J5G A;  4WV9 A;  4AFH A;  3U8L A;  2QC1 B;  4ZZC A;  4UM3 P;  2PGZ A;  5AFK A;  4ZK1 A;  4A97 A;  2WZY A;  5KE4 A;  2Y7Y A;  3RQW A;  4TWH A;  2UZ6 A;  3RI5 A;  2BR7 A;  2XZ6 A;  5SYO A;  5J5H A;  4ZR6 A;  3RQU A;  5HEH A;  2Y54 A;  3ZDG A;  2BR8 A;  4FRR A;  4AFT A;  4QH4 A;  2W8G A;  4QAC A;  4ZJT A;  4QAA A;  5L4H A;  2BYQ A;  3JAD A;  2XQ7 A;  1UV6 A;  2XYS A;  3U8N A;  4ZJS A; 
#chains in the Genus database with same CATH homology
 5LG3 A;  2W8F A;  2XQ5 A;  4LML A;  3UU6 A;  3EHZ A;  3WIP A;  2Y56 A;  4TWD A;  3TLS A;  4HFD A;  3WTM A;  5AFJ A;  5HEO A;  2BYP A;  5J0Z A;  4BQT A;  2Y58 A;  4ILB A;  5L4E A;  5J5I A;  2XQA A;  3SH1 A;  3SIO A;  5HCJ A;  2XQ4 A;  5HEU A;  5HCM A;  4HFI A;  3UUB A;  4HFB A;  5L47 A;  3SQ9 A;  2XNU A;  4ALX A;  2WN9 A;  3WTI A;  5AFL A;  3RIA A;  2XQ3 A;  4QH1 A;  3GUA A;  4ZZB A;  4UXU A;  2X00 D;  5HEG A;  4B5D A;  4UM3 S;  2XQ9 A;  2XYT A;  4LMJ A;  4ZRU A;  3RHW A;  2X00 A;  4TNV A;  4UM1 A;  4Z91 A;  5BP0 A;  3P50 A;  3JAF A;  5BRX A;  4UM3 A;  3TLW A;  3IGQ A;  3WTO A;  4IL4 A;  3PMZ A;  5CO5 A;  3WTL A;  5AFH A;  2BYR A;  2C9T A;  5AFN A;  5KZU A;  3ZDH A;  2YKS A;  4HFC A;  2BG9 B;  2YME A;  4HFE A;  5HEJ A;  4IRE A;  2WNL A;  5AIN A;  3TLU A;  4F8H A;  4LMK A;  1I9B A;  5BW2 A;  2BYN A;  2YMD A;  4PIR A;  5TVC A;  2ZJU A;  3WTH A;  4QH5 A;  3UU4 A;  2XNV A;  4X5T A;  3UU3 A;  2BG9 A;  3PEO A;  3UU5 A;  1UW6 A;  2VL0 A;  2XNT A;  3SQ6 A;  5IUX A;  3UQ7 A;  4QAB A;  5LXB A;  2BJ0 A;  1UX2 A;  2YN6 A;  3JAE A;  3LSV A;  3WTJ A;  4ILA A;  4HFH A;  4Z90 A;  5J5F A;  4AFG A;  5CFB A;  4XK9 A;  5AFM B;  2YOE A;  4XHE A;  2Y57 A;  2BG9 E;  3U8J A;  2ZJV A;  4EZ1 A;  4TWF A;  4COF A;  3RIF A;  3ZKR A;  2BG9 C;  2BYS A;  3WTN A;  2PH9 A;  3WTK A;  2WNJ A;  3EAM A;  3UU8 A;  2WNC A;  3U8M A;  3TLT A;  4BFQ A;  4ZK4 A;  3P4W A;  3TLV A;  4IL9 A;  3UQ4 A;  3C79 A;  4D01 A;  3U8K A;  3T4M A;  4NPP A;  5AFM A;  4ILC A;  2XQ6 A;  5JME A;  4NZB A;  2XZ5 A;  4A98 A;  4DBM A;  3C84 A;  4HQP A;  3EI0 A;  5FJV A;  4UY2 A;  4TNW A;  2XQ8 A;  5J5G A;  4WV9 A;  4AFH A;  3U8L A;  2QC1 B;  4ZZC A;  4UM3 P;  2PGZ A;  5AFK A;  4ZK1 A;  4A97 A;  2WZY A;  5KE4 A;  2Y7Y A;  3RQW A;  4TWH A;  2UZ6 A;  3RI5 A;  2BR7 A;  2XZ6 A;  5SYO A;  5J5H A;  4ZR6 A;  3RQU A;  5HEH A;  2Y54 A;  3ZDG A;  2BR8 A;  4FRR A;  4AFT A;  4QH4 A;  2W8G A;  4QAC A;  4ZJT A;  4QAA A;  5L4H A;  2BYQ A;  3JAD A;  2XQ7 A;  1UV6 A;  2XYS A;  3U8N A;  4ZJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...