4ILAA

The pentameric ligand-gated ion channel glic a237f in complex with cesium
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilaA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilaA01
3U8KA 2WZYA 2BYSA 2LKHA 2XNVA 1UW6A 3WTOA 3UU4A 4BFQA 4IREA 5LG3A 2ZJVA 2BYQA 4QH4A 3WTKA 3JAEA 2BJ0A 3RQUA 2BYNA 3EAMA 4IL4A 4TWHA 3TLSA 2Y7YA 3SIOA 4Z91A 3SQ6A 4QH1A 1UV6A 2MAWA 4Z90A 3EI0A 4NPPA 2YMDA 4UM3A 3U8NA 4B5DA 5BRXA 4QACA 5TVCA 3UU8A 4A97A 4XK9A 3RI5A 2YMEA 2Y54A 5AFMA 2LLYA 1OEDE 3WTMA 4QAAA 2XZ6A 5AFNA 2LM2A 2VL0A 4HFHA 3LSVA 3UQ4A 2PH9A 2BG9A 4X5TA 5J5GA 2WNLA 3U8MA 5HEHA 4ILCA 2BR8A 5HEGA 2UZ6A 2X00A 3WIPA 4AFGA 5J5HA 4ZRUA 2Y56A 4ZK4A 4ILBA 4UY2A 2BR7A 5HEOA 3WTHA 2ZJUA 4ILAA 2WNCA 4COFA 3TLWA 4HFDA 2YOEA 2XQ5A 5AFJA 2BG9C 4PIRA 4UM1A 4LMJA 5BP0A 4ZZCA 5AFHA 5HCMA 2BYPA 4ALXA 2M6IA 5J5IA 3PMZA 3TLUA 3UU6A 1OEDA 4EZ1A 2XNTA 2W8FA 4HFCA 2C9TA 3T4MA 2BYRA 4HFBA 3UU5A 2X00D 4LMKA 3IGQA 4TWDA 3UU3A 2WNJA 3RIFA 5AFKA 5HEJA 4ZJTA 5J0ZA 4D01A 5BW2A 2YN6A 4DBMA 3RQWA 2W8GA 5KZUA 3ZDHA 4HFIA 3JAFA 4TNWA 5FJVA 4ZR6A 3TLTA 3GUAA 5AFMB 2Y57A 2XQ8A 2XYTA 4XHEA 4WV9A 3P50A 2XZ5A 2BG9B 4FRRA 4HFEA 4QABA 3U8JA 4TNVA 3TLVA 3WTNA 4F8HA 4AFHA 2WN9A 3C79A 3JADA 3SQ9A 2M6BA 2XQ6A 1I9BA 3WTJA 4LMLA 3ZDGA 4UM3P 3SH1A 3WTLA 4UXUA 3RHWA 3WTIA 5AFLA 3PEOA 2BG9E 2KSRA 1OEDC 2XQ3A 3ZKRA 1UX2A 5CO5A 4AFTA 4ZK1A 2QC1B 2Y58A 4BQTA 3P4WA 4A98A 5JMEA 1OEDB 5L4EA 5L47A 4ZJSA 3U8LA 2LKGA 2XQ4A 5CFBA 5HEUA 3UQ7A 2PGZA 2XNUA 2XQ9A 4NZBA 5LXBA 3UUBA 5AINA 5HCJA 5KE4A 5L4HA 4HQPA 5J5FA 3C84A 3RIAA 2XQ7A 2YKSA 5IUXA 5SYOA 4UM3S 2XQAA 4TWFA 4ZZBA 4IL9A 3EHZA 4QH5A 2XYSA
chains in the Genus database with same CATH superfamily
2FUPA 2KNDA 3BQKA 4BFQA 3UULA 3N5LA 2CBIA 3QOFA 1UV6A 2DHRA 2XM2A 3ABVA 3HI2A 3L8RA 2FBWA 3EDVA 1MIVA 1L0VA 2PFVA 4OYJA 1HCIA 2PH9A 3VRBA 3CPZA 3O1IA 2VKOA 4NIQA 3ZCJA 2BKPA 2X9XA 3AE6A 4IIJE 3TLWA 3PUQA 4U7IA 3AA0B 1QSDA 2E5VA 3U78A 2D2SA 2C5IT 5FXVA 2NW9A 3ANWA 3B5MA 3UUNA 5EZYE 5FXZA 4H63V 5JDGA 2C0SA 2Y57A 2J1DG 4JYAT 2BVMA 4JI8T 5A1LA 3U8JA 2BKOA 4AQYT 3JADA 2JQHA 1WFDA 1T72A 4JLEA 2WWVA 4DR3T 4PK6A 1G8XA 3P4WA 2HPLA 4IDOA 4GKJT 3FZLB 2LSKA 2X68A 4HQPA 3RIAA 4ZZBA 3L09A 3RH3A 3PUXF 5LG3A 2KXPB 3I1AA 2BYQA 2DI4A 4TWHA 4DUZT 4PK5A 3ZPOA 3MZKB 3FBZA 4F6RC 4I4TE 4PW8A 4ZHQE 2WP9A 3AE9A 2XZ6A 5LBQB 3VKHA 2NR4A 3AECA 4ADZA 5JRCB 2VK9A 2CXFA 5AQJB 2VKHA 1IBMT 2WCAA 3AE8A 3BQIA 3P4RA 2ZJUA 2LSIA 2ES0A 2B76A 3U3IA 2HN2A 3OVUA 5AFUL 5AQKB 2J62A 1E1HB 4YHJA 4LMKA 3HKEE 3IEEA 4X1KE 4JEUB 5J0ZA 2LOPA 3B13A 1IBKT 3C4ZA 5FJVA 5E0OA 5FXXA 3TLTA 2WDRA 2Q9QD 2XAHB 4ZI3D 2W62A 1SUMB 4NUUA 1IBLT 3FBLA 5AQVB 3LK2B 1MMGA 3SQ9A 4TV8E 3N2OA 4EXTA 1Y64B 2E9XD 2W2UA 3N2KE 3ZKRA 2K5BB 2WY2A 2Y58A 3FZHB 4BJMA 4CI1B 3C4WA 3ETUA 2Q9QC 2XNUA 2PGZA 1ZEEA 2V8SV 4ZI3C 2VVSA 1VRBA 2YKSA 2WQYA 3AEBA 4UM3S 4UIGA 4L9IA 1J5ET 5BMVE 1UW6A 2N9DA 2ODVA 5LGTB 3RKGA 5JTGA 2MAWA 5HXHA 3UU8A 4UVAB 2LM2A 4HFHA 3LSVA 5LCYA 2NTXA 5AQNB 3PU8A 1D1AA 1O3XA 5H6RB 2WM9A 3T8OA 4AQFC 4PIRA 5J5IA 4IE6A 4EZ1A 4YXDA 2W8FA 4MFRA 3UU3A 4IE5A 3A7MA 4DV7T 2XASB 3VRAA 4HWCA 4HN9A 2W00A 2K9AA 3PJAJ 1SE7A 2VQFT 4PK4A 4U2ZA 3RX6A 3PUAA 3AEGA 3X1DA 3MXZA 3F31A 3P7IA 1YQ3A 4LFAT 3I0QA 4JI4T 1I9BA 4ZK1A 4WW0A 3UT5E 4AFTA 1NWMX 5CB4E 4A98A 3U8LA 5JDFA 1YXRA 4JI7T 3UTKA 3UUBA 2Q9QB 3AE1A 2H89A 2LM9A 5F8PA 1I6ZA 2ZM8A 3N9NA 4HEAA 1M7KA 1KNPA 5JH7E 1J5WA 2LJLA 2H7VC 2WSSV 3W15B 2MTQA 3QB5K 3SIOA 2E9XB 1MMDA 4UM3A 1GQEA 4P0AA 4AKRB 2ZLYA 2XSAA 4QHOA 5AQQB 4U72A 4QXBB 2VL0A 3BQLA 4UELA 4H9PC 2BG9A 5FY7A 4AKLA 5HEHA 3IBPA 3C64A 2CWOA 4QKNA 4JI2T 3KBUA 1LRZA 3KBTA 4H9OC 4AKGA 2LSJA 5LBMA 3GMIA 2WMOA 3ZN1B 1MIWA 3V5SA 4GK0E 4BJNA 4EOZB 1OWAA 4ZR6A 5IWAT 5AFMB 4CZZB 2EHOB 2VVNA 3KINB 2XQYA 2XZ5A 1IJ6A 4X20E 3L39A 5M4YA 4ASKA 3VHLA 1OEDC 2BS3A 1CUNA 4BQTA 2X66A 5HEUA 2V6XA 4YY3T 5HCJA 3AA6B 2IIUA 4PJJA 4EYYR 4TV9E 3WTOA 3SFEA 3FHNA 1X9BA 2BYNA 4Z91A 5ADXL 4QWNB 3SS1A 4QH1A 5FY1A 5JDLA 2YMDA 2CPTA 5FY0A 3OTOT 3CK6A 1FIOA 2HPJA 4UVBB 2W0GA 1JNZA 4KBMB 3FZMB 1T8BA 5FYMA 2PJQA 4PNIA 4N78D 4QX8B 2ODUA 4DIDB 3WIPA 1HS7A 3OPCA 2YOEA 4TZ4C 5AFJA 2XAJB 2Z6EA 3FXEB 1QUUA 1SHZC 2QRXA 4HFBA 4LFCT 4OK0A 5AQGB 1VCSA 5BW2A 1UK5A 3EDUA 4DBMA 2V7JA 3NRXA 4BA9A 1WR0A 2QYWA 4PAGA 2E2AA 4EV6A 1YKEB 2YK0A 4WV9A 4IE4A 2WU5A 2VL8A 5DQWA 5EK2A 2XPKA 2N2NA 5KDMC 5AFLA 3PUVF 4UXUA 5AQMB 4ZI2D 3WTIA 2IDOB 3B57A 4B3RT 5JMEA 1OEDB 4WBOA 2K3WA 3SFDA 3AEDA 4DR4T 2Y48B 5KX5E 4LF4T 3PJAA 3NZPA 4KI0F 5ABGA 1MIYA 4IL9A 2CLYC 1N32T 4AQGA 1CHUA 1KNRA 2LOSA 3EAMA 1XMOT 3RGLA 4DV5T 3KDSE 3CX7B 5FNVE 5TVCA 2X67A 2JQ9A 2Y54A 5JDHA 3PUWF 2KWHA 3PUZF 3OKQA 4ILUA 3UQ4A 4I43B 3E08A 2X00A 1KEYA 3GWHA 2DL1A 2WNCA 2XQ5A 2X51A 2BG9C 2IHR1 4KUMB 5JDQA 3K3NA 1YD8G 1US7B 3RRWA 4HFCA 2C9TA 2W67A 2WAUA 5JR9A 2BVLA 2QGSA 4AXPA 3PUGA 3CMLA 3RLFF 4HFIA 2FJEA 3T1YT 4U7YA 4ISSA 1E7PA 4WBNE 1OXZA 3DTOA 2CCQA 4DUYT 1QLBA 5L3FB 5CGMA 2IC6A 4F8HA 3O1JA 2ACXA 3HL6A 3SH1A 1WYCA 3N9PA 3F57A 4YTMA 3RYFE 5JDNA 4ZJSA 3NZQA 2M67A 4JI1T 2UXXB 2X0LB 4UF0A 3ZN0B 4DR5T 3HR0A 4YSZA 3NVOA 3C84A 2XQAA 3AEFA 4EGWA 5DABA 4GKKT 3ZT6A 5J1GA 2LEHA 3UU4A 5J2TE 2ZJVA 4EEDA 3Q5EA 4LF8T 4IL4A 2DLRA 2BKNA 5AQFB 2H88A 3DP7A 4ANJA 4E7SA 4J2CA 3N9LA 2V1DB 2XAFB 4DV1T 2X0HA 3CQGB 4QAAA 5FVLA 2AXDS 5J5GA 1Y01A 2XUEA 2BR8A 2OA5A 5J5HA 4G63A 3KVBA 5HEOA 1U5PA 2YDSA 4UM1A 1ZOYA 1MMNA 3UU6A 2DNXA 3ZT5A 4X1YE 4O2BE 4DBRA 3ESLA 2WNJA 2LT3A 4B6XA 3CQCB 4ZS3A 5AFKA 2YN6A 4JBWF 3ZDHA 3HKBE 5ABEA 3HKCE 4ZI7E 1Z0PA 2XQ8A 3ONJA 4DR7T 2LRKA 3VKGA 2WBLA 1D0YA 4CN1A 5H6QB 3ZMZB 3CIRA 3AE2A 3PUYF 4IT4A 3OBVE 1BR1A 4JI3T 1D0ZA 4JI0T 1UX2A 3ZMVB 3CX8B 3K8PC 4YSYA 2IC9A 5L4EA 2BBJA 2A3DA 1UURA 3C4XA 5AINA 2X9WA 2LHRA 2I0MA 3ZCIA 3AE7A 2XNVA 3D0TA 3OYXA 4NUVA 3Q5DA 2YDRA 3WI3A 4JI6T 2CM0A 2Y7YA 4YFSA 3FZKB 2SPCA 2V5CA 2WS3A 2CRBA 4DVDA 3I9WA 3FB2A 3ZMUB 4DNDA 1DU2A 1XWMA 5DJQC 5IHYA 5KMGP 4I0UA 2UZ6A 4ILBA 2D0UA 2BR7A 3R84B 3CQXC 4ERRA 4IDQA 2HN1A 3M3ZB 5FP3A 5JQGE 3SWHA 2UUCT 2WZHA 2X0YA 2NW7A 2E5LT 5HYAA 5L3GB 1LVFA 1UUSA 3GUAA 1VOMA 3N9OA 3F2EA 5JR9C 4EZ4A 3QB5A 4YTPA 2UU9T 4UV9B 4AFHA 3ZYKA 3WTJA 4BAYB 3PEOA 2K48A 5AQTB 3RYIE 3UQ7A 5ABFB 1XDPA 5KE4A 3PURA 5LYJE 4TWFA 4XZCA 2UXCT 3S4UA 3RIUA 2FJBA 4H9QC 1HF8A 2RA1A 3JAEA 3P4SA 3LG7A 3TLSA 5LGUB 4V1Av 3GN5B 4G2AA 4L0RA 5FMNA 2XAGB 2V6YB 4X62T 2CHOA 4FI5A 2UUAT 5J2UE 3LDQB 1W09A 3AA7B 2YEVC 1XZYA 4H9RC 3ZMTB 1N36T 5BP0A 4AI6A 3J9X1 2PBIA 2V5DA 2XZEA 2MBGA 3UUMA 3AA1B 2BYRA 3IGQA 2BS4A 2OLTA 3PDYA 4TWDA 4CN4A 3PE0A 5KZUA 2KZ7B 4O4JE 4KHPT 1WCRA 4HWDA 2LHNA 3RC3A 5AQUB 2ZM0A 4ZEYA 2DWKA 1UX5A 2NP9A 4OYKA 4P0BA 3ZEFB 3R6NA 2WN9A 3C79A 3ZYMA 3K1SA 2RPAA 3ZDGA 1E2AA 2IUBA 1KNZA 5CO5A 3O9XA 4O4HE 3MK7C 5JRCA 2WMNA 2LKGA 4IDPA 5AQIB 1J1JA 2ZM6T 2CBJA 2H3RA 1I94T 3KV6A 2VB6A 3ZJ1A 2CEAA 5GONE 1H7CA 3ANWB 4CN6A 3N9QA 2JQQA 2BJ0A 3I0OA 1HG2A 4U33A 1LKXA 4Z90A 4NPPA 3NRYA 3ZC0A 4GYRA 1YKHB 4JI5T 2YINA 5C2TA 4YHHT 4YSXA 1FMVA 2VQET 3QK6A 4X5TA 5LP6E 4IE7A 4LF9T 2CE7A 1AJ3A 5CA1E 2FJDA 3QNUA 3WAKA 1UGOA 3RKOA 1KF6A 4DV0T 3KFWX 4ALXA 2CMRA 3ZSTA 5HXRA 1MNDA 5FL0A 2YDQA 4CQIA 2X9YA 4XBFB 3JC6C 5FVKA 5JDMA 2VKDA 4ZS2A 1XDOA 1NAFA 4U74A 2D0TA 3ETVA 2W66A 4UEMA 1R8IA 3L3PA 2R6GF 3MACA 3PUSA 3C51A 5HAXA 2N1GA 5CFBA 2WU2A 1ZKEA 1WRDA 3AAIA 3UFEA 4M1PA 2BZBA 3G06A 3U8KA 4CI2B 4EYUA 4YJ2E 5LNKA 3K3QC 4HE8A 4CXYA 4B3ST 5AQSB 4DV2T 2WB5A 3EI0A 3P4PA 4IDZA 4O4LE 3PU3A 5ABHA 4HKAA 3A5XA 2JJ9A 5LMNT 1FMWA 1T7SA 4DMWA 4ILAA 4COFA 4HFDA 4K0UA 5AFHA 2M6IA 3ZYLA 3TLUA 3GN5A 4MHCA 1LVKA 2Q9QA 4DR6T 2V6YA 2W61A 3H3AA 2MOZA 4DO0A 2ZM2A 4OFZA 4X64T 5C8YE 1HFAA 3HA4A 4TNWA 3ONLC 1HNZT 5F5WA 3DJBA 2IAKA 2E9XA 4FRRA 2Y8DA 2X9HA 4LMLA 3KV4A 5LMUT 4B3TT 2QC1B 4U31A 5L47A 2JPFA 5ETWA 1YW0A 4DBQA 2XQ7A 3SRZA 4A5XA 4YLHA 2V7KA 3QC9A 5JVDE 4O4IE 4WZXA 4AQFA 4DV4T 2BYSA 4CXWA 3M65A 2CA5A 3RQUA 4I55E 4AISA 3J7Yq 1W9RA 4PJLA 1X79A 2V7LA 3RC8A 4LF6T 2YMEA 4UVCB 4U3CA 5HXCA 3ZT7A 5AFMA 2PG8A 3WTMA 2EHOA 2VWAA 2CLYB 4AIUA 3O1HA 5EK4A 3LK42 4ZOLE 4UY2A 2AE9A 2LRLA 3SOLA 5HCMA 5AQOB 3PMZA 2IMLA 2L9QA 4EZHA 3VR8A 2CXLA 3CX6B 2CHNA 4PJNA 3RIFA 2KLQA 1V9DA 5HEJA 3EVYA 4IE0A 4EB6E 3Q5XA 4MALA 1W0AA 3BK9A 4HGAA 4DV6T 4XHEA 1WYBA 4C90A 2UXBT 2BG9B 4HFEA 3AB3B 3TLVA 2BDEA 5CA0E 3WTNA 2FJAA 4LF5T 2XQ6A 5LHIB 1HR0T 4UM3P 3RHWA 2XQ3A 3AAEB 5LXTE 4DV3T 2D5UA 5C3JA 2XQ9A 5AQHB 2DCFA 2I59A 2B1EA 2NOXA 2XYSA 4H9SE 2CWYA 4K0KT 2WWUA 4IREA 4GYSA 4NXMT 2JIWA 4YT0A 1IZNB 3CWZB 4IDNA 4UV8B 4ISTA 5L3CB 4PFOA 3SQ6A 3ZMSB 2XJ7A 4JEHB 4XK9A 3UUXB 3RI5A 4EAHA 1OEDE 5AFNA 3OJAA 3QUJA 1ZHCA 2W4XA 3H3MA 4B3MT 4X1IE 1SA0E 4H9NC 2WNLA 2F4VT 4IHJE 2C5JA 5HEGA 4ZRUA 2DWGA 4JV5T 3WTHA 3AXJB 4LFBT 5L3DB 4ZZCA 3UFGA 3ZLIA 4C91A 4GIWA 1OEDA 3MA9A 2X00D 1WR6A 3LK3B 3KV9A 1HX1B 3Q2MA 3ZJ2A 2L8KA 5TAOA 5KXJA 3JAFA 4KMCA 4UR9A 1S94A 5LA6E 1EZ3A 5HXEA 2NW8A 3LJCA 1M62A 2YU1A 5DQVA 2L3LA 3TKLB 3LBXB 2CXDA 2E9XC 3RYHE 5LHGB 3Q5WA 3GA8A 2LSGA 2XQ4A 2XY8B 4NZBA 3RF1A 5L4HA 2G0UA 4HWHA 5J5FA 1N33T 4MBQA 1D1CA 3AE4A 3AE5A 2LKHA 2Y6XA 3H37A 3RYCE 3AE3A 2EHOD 3AAAB 4B5DA 5BRXA 5FL1A 4TUYE 2LE8A 4HWFA 4DR1T 4KP3C 2LLYA 2D9DA 2ACZA 3U8MA 4ILCA 4ZK4A 5LJNA 2EHOC 3MJXA 4O2AE 3KV5A 1BR2A 3K3OA 4CXXA 2XAQB 4PJMA 5AQPB 3LFMA 1BR0A 4AKHA 2RP4A 4X65T 2QVAA 4EEBA 1W0BA 3RQWA 2W8GA 3P4QA 4AKIA 1UX4A 3PV0F 3AEEA 2XYTA 1HNWT 2UUBT 3P50A 4EIWA 3P8CD 2XTLA 1IAPA 1D1BA 4QABA 3T1HT 3HKDE 3FXDB 1BR4A 2W63A 3EUHA 5BR8T 2BG9E 1N34T 1YQ4A 5LXBA 2VKJA 1B7TA 5JR9B 3RPUA 4Q25A 4ZXLA 5JREA 5F3JA 3OYZA 3JCFA 2XSBA 4Z8XA 1HG5A 2JQKA 3Q9DA 2XM1A 1XMQT 2IW5B 2JMKA 4L5GA 4A97A 4H63H 1T98A 5L3BB 3NWIA 3I9YA 4DR2T 1FJGT 2C5KT 1HTJF 4PFPA 2LSYA 2OV9A 4UF0B 4AFGA 2Y56A 2BBHA 2VASA 4LMJA 4NXNT 3KVAA 2XNTA 3CKDA 3T4MA 3UU5A 1G73A 5HWXA 2E8IA 3CVRA 1MNEA 3E22E 3AEAA 4O8SA 3PTRB 2MPKA 3AVSA 4U2YA 3C98B 2A72A 3JC6D 3NBXX 4P1NA 2BS2A 4YTNA 3AXJA 5CJ5A 2P9BA 5LG4A 4A56A 2KT9A 2M6BA 2WDVA 2J4GA 4WNKA 1MMAA 2K24A 2I6HA 3VU7H 2NTYA 1ZP0A 3ZC1A 4OX9T 5SYOA 5IUXA 3N9MA 1Z8UA 1ZV4X 3EHZA 4QH5A 1XNQT 3O4XE 2WZYA 4IGUA 4I50E 4QH4A 2WZIA 3WTKA 2ZMAA 3LBXA 5FXWA 4QX7B 4DMVA 3E0ZA 1VCTA 3U8NA 4UXNB 5L2LA 4QACA 4WYVA 5LB7B 1U4QA 3AVRA 4X66T 3IA3A 2KINB 2JRKA 2V7IA 5IYZE 3WAJA 4GOUA 5L3EB 2A9UA 4KHZF 3VR9A 4QXHB 4HTEA 3N2GE 4OHFA 2UXDT 2YU2A 3C50A 3IF8B 4FJOA 1XNRT 5EK3A 3RIUC 1WLXA 5LJMA 5AQLB 4LF7T 4XAXB 4MLKA 1IJ5A 4HWIB 4GK5E 5ABFA 2XHEB 4P09A 2J47A 4ZJTA 5HWYA 4D01A 5HXSA 4TX5A 1NENA 3ZSSA 4CI3B 1FEWA 3MKDA 2PTFA 2QA7A 2UXNB 2KWIB 1HNXT 2H7OA 1D0XA 2HHHT 3ONXA 3V5UA 5AQRB 2V7MA 2A2FX 3FZFB 2GK9A 2V26A 4TNVA 3IHRA 1HX8A 4ZI2C 5LGNB 1KK7A 3WTLA 2WDQA 1UCUA 4E7ZA 1JNRA 3EABA 2KSRA 4HFVA 5FKYA 2NWBA 1S35A 5LOVE 4JUYA 3RRCA 1NEKA 2JMHA 2MYSA 4KX6A 4QXCB 2KMFA 3A8YC 1KFYA 2VURA 3NKZA 4TN7B 2HH7A 2BYPA 5LHHB 4YJ3E
chains in the Genus database with same CATH topology
3U8KA 2WZYA 2BYSA 2LKHA 2XNVA 1UW6A 3WTOA 3UU4A 4BFQA 4IREA 5LG3A 2ZJVA 2BYQA 4QH4A 3WTKA 3JAEA 2BJ0A 3RQUA 2BYNA 3EAMA 4IL4A 4TWHA 3TLSA 2Y7YA 3SIOA 4Z91A 3SQ6A 4QH1A 1UV6A 2MAWA 4Z90A 3EI0A 4NPPA 2YMDA 4UM3A 3U8NA 4B5DA 5BRXA 4QACA 5TVCA 3UU8A 4A97A 4XK9A 3RI5A 2YMEA 2Y54A 5AFMA 2LLYA 1OEDE 3WTMA 4QAAA 2XZ6A 5AFNA 2LM2A 2VL0A 4HFHA 3LSVA 3UQ4A 2PH9A 2BG9A 4X5TA 5J5GA 2WNLA 3U8MA 5HEHA 4ILCA 2BR8A 5HEGA 2UZ6A 2X00A 3WIPA 4AFGA 5J5HA 4ZRUA 2Y56A 4ZK4A 4ILBA 4UY2A 2BR7A 5HEOA 3WTHA 2ZJUA 4ILAA 2WNCA 4COFA 3TLWA 4HFDA 2YOEA 2XQ5A 5AFJA 2BG9C 4PIRA 4UM1A 4LMJA 5BP0A 4ZZCA 5AFHA 5HCMA 2BYPA 4ALXA 2M6IA 5J5IA 3PMZA 3TLUA 3UU6A 1OEDA 4EZ1A 2XNTA 2W8FA 4HFCA 2C9TA 3T4MA 2BYRA 4HFBA 3UU5A 2X00D 4LMKA 3IGQA 4TWDA 3UU3A 2WNJA 3RIFA 5AFKA 5HEJA 4ZJTA 5J0ZA 4D01A 5BW2A 2YN6A 4DBMA 3RQWA 2W8GA 5KZUA 3ZDHA 4HFIA 3JAFA 4TNWA 5FJVA 4ZR6A 3TLTA 3GUAA 5AFMB 2Y57A 2XQ8A 2XYTA 4XHEA 4WV9A 3P50A 2XZ5A 2BG9B 4FRRA 4HFEA 4QABA 3U8JA 4TNVA 3TLVA 3WTNA 4F8HA 4AFHA 2WN9A 3C79A 3JADA 3SQ9A 2M6BA 2XQ6A 1I9BA 3WTJA 4LMLA 3ZDGA 4UM3P 3SH1A 3WTLA 4UXUA 3RHWA 3WTIA 5AFLA 3PEOA 2BG9E 2KSRA 1OEDC 2XQ3A 3ZKRA 1UX2A 5CO5A 4AFTA 4ZK1A 2QC1B 2Y58A 4BQTA 3P4WA 4A98A 5JMEA 1OEDB 5L4EA 5L47A 4ZJSA 3U8LA 2LKGA 2XQ4A 5CFBA 5HEUA 3UQ7A 2PGZA 2XNUA 2XQ9A 4NZBA 5LXBA 3UUBA 5AINA 5HCJA 5KE4A 5L4HA 4HQPA 5J5FA 3C84A 3RIAA 2XQ7A 2YKSA 5IUXA 5SYOA 4UM3S 2XQAA 4TWFA 4ZZBA 4IL9A 3EHZA 4QH5A 2XYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8K A;  2WZY A;  2BYS A;  2LKH A;  2XNV A;  1UW6 A;  3WTO A;  3UU4 A;  4BFQ A;  4IRE A;  5LG3 A;  2ZJV A;  2BYQ A;  4QH4 A;  3WTK A;  3JAE A;  2BJ0 A;  3RQU A;  2BYN A;  3EAM A;  4IL4 A;  4TWH A;  3TLS A;  2Y7Y A;  3SIO A;  4Z91 A;  3SQ6 A;  4QH1 A;  1UV6 A;  2MAW A;  4Z90 A;  3EI0 A;  4NPP A;  2YMD A;  4UM3 A;  3U8N A;  4B5D A;  5BRX A;  4QAC A;  5TVC A;  3UU8 A;  4A97 A;  4XK9 A;  3RI5 A;  2YME A;  2Y54 A;  5AFM A;  2LLY A;  1OED E;  3WTM A;  4QAA A;  2XZ6 A;  5AFN A;  2LM2 A;  2VL0 A;  4HFH A;  3LSV A;  3UQ4 A;  2PH9 A;  2BG9 A;  4X5T A;  5J5G A;  2WNL A;  3U8M A;  5HEH A;  4ILC A;  2BR8 A;  5HEG A;  2UZ6 A;  2X00 A;  3WIP A;  4AFG A;  5J5H A;  4ZRU A;  2Y56 A;  4ZK4 A;  4ILB A;  4UY2 A;  2BR7 A;  5HEO A;  3WTH A;  2ZJU A;  4ILA A;  2WNC A;  4COF A;  3TLW A;  4HFD A;  2YOE A;  2XQ5 A;  5AFJ A;  2BG9 C;  4PIR A;  4UM1 A;  4LMJ A;  5BP0 A;  4ZZC A;  5AFH A;  5HCM A;  2BYP A;  4ALX A;  2M6I A;  5J5I A;  3PMZ A;  3TLU A;  3UU6 A;  1OED A;  4EZ1 A;  2XNT A;  2W8F A;  4HFC A;  2C9T A;  3T4M A;  2BYR A;  4HFB A;  3UU5 A;  2X00 D;  4LMK A;  3IGQ A;  4TWD A;  3UU3 A;  2WNJ A;  3RIF A;  5AFK A;  5HEJ A;  4ZJT A;  5J0Z A;  4D01 A;  5BW2 A;  2YN6 A;  4DBM A;  3RQW A;  2W8G A;  5KZU A;  3ZDH A;  4HFI A;  3JAF A;  4TNW A;  5FJV A;  4ZR6 A;  3TLT A;  3GUA A;  5AFM B;  2Y57 A;  2XQ8 A;  2XYT A;  4XHE A;  4WV9 A;  3P50 A;  2XZ5 A;  2BG9 B;  4FRR A;  4HFE A;  4QAB A;  3U8J A;  4TNV A;  3TLV A;  3WTN A;  4F8H A;  4AFH A;  2WN9 A;  3C79 A;  3JAD A;  3SQ9 A;  2M6B A;  2XQ6 A;  1I9B A;  3WTJ A;  4LML A;  3ZDG A;  4UM3 P;  3SH1 A;  3WTL A;  4UXU A;  3RHW A;  3WTI A;  5AFL A;  3PEO A;  2BG9 E;  2KSR A;  1OED C;  2XQ3 A;  3ZKR A;  1UX2 A;  5CO5 A;  4AFT A;  4ZK1 A;  2QC1 B;  2Y58 A;  4BQT A;  3P4W A;  4A98 A;  5JME A;  1OED B;  5L4E A;  5L47 A;  4ZJS A;  3U8L A;  2LKG A;  2XQ4 A;  5CFB A;  5HEU A;  3UQ7 A;  2PGZ A;  2XNU A;  2XQ9 A;  4NZB A;  5LXB A;  3UUB A;  5AIN A;  5HCJ A;  5KE4 A;  5L4H A;  4HQP A;  5J5F A;  3C84 A;  3RIA A;  2XQ7 A;  2YKS A;  5IUX A;  5SYO A;  4UM3 S;  2XQA A;  4TWF A;  4ZZB A;  4IL9 A;  3EHZ A;  4QH5 A;  2XYS A; 
#chains in the Genus database with same CATH topology
 2FUP A;  2KND A;  3BQK A;  4BFQ A;  3UUL A;  3N5L A;  2CBI A;  3QOF A;  1UV6 A;  2DHR A;  2XM2 A;  3ABV A;  3HI2 A;  3L8R A;  2FBW A;  3EDV A;  1MIV A;  1L0V A;  2PFV A;  4OYJ A;  1HCI A;  2PH9 A;  3VRB A;  3CPZ A;  3O1I A;  2VKO A;  4NIQ A;  3ZCJ A;  2BKP A;  2X9X A;  3AE6 A;  4IIJ E;  3TLW A;  3PUQ A;  4U7I A;  3AA0 B;  1QSD A;  2E5V A;  3U78 A;  2D2S A;  2C5I T;  5FXV A;  2NW9 A;  3ANW A;  3B5M A;  3UUN A;  5EZY E;  5FXZ A;  4H63 V;  5JDG A;  2C0S A;  2Y57 A;  2J1D G;  4JYA T;  2BVM A;  4JI8 T;  5A1L A;  3U8J A;  2BKO A;  4AQY T;  3JAD A;  2JQH A;  1WFD A;  1T72 A;  4JLE A;  2WWV A;  4DR3 T;  4PK6 A;  1G8X A;  3P4W A;  2HPL A;  4IDO A;  4GKJ T;  3FZL B;  2LSK A;  2X68 A;  4HQP A;  3RIA A;  4ZZB A;  3L09 A;  3RH3 A;  3PUX F;  5LG3 A;  2KXP B;  3I1A A;  2BYQ A;  2DI4 A;  4TWH A;  4DUZ T;  4PK5 A;  3ZPO A;  3MZK B;  3FBZ A;  4F6R C;  4I4T E;  4PW8 A;  4ZHQ E;  2WP9 A;  3AE9 A;  2XZ6 A;  5LBQ B;  3VKH A;  2NR4 A;  3AEC A;  4ADZ A;  5JRC B;  2VK9 A;  2CXF A;  5AQJ B;  2VKH A;  1IBM T;  2WCA A;  3AE8 A;  3BQI A;  3P4R A;  2ZJU A;  2LSI A;  2ES0 A;  2B76 A;  3U3I A;  2HN2 A;  3OVU A;  5AFU L;  5AQK B;  2J62 A;  1E1H B;  4YHJ A;  4LMK A;  3HKE E;  3IEE A;  4X1K E;  4JEU B;  5J0Z A;  2LOP A;  3B13 A;  1IBK T;  3C4Z A;  5FJV A;  5E0O A;  5FXX A;  3TLT A;  2WDR A;  2Q9Q D;  2XAH B;  4ZI3 D;  2W62 A;  1SUM B;  4NUU A;  1IBL T;  3FBL A;  5AQV B;  3LK2 B;  1MMG A;  3SQ9 A;  4TV8 E;  3N2O A;  4EXT A;  1Y64 B;  2E9X D;  2W2U A;  3N2K E;  3ZKR A;  2K5B B;  2WY2 A;  2Y58 A;  3FZH B;  4BJM A;  4CI1 B;  3C4W A;  3ETU A;  2Q9Q C;  2XNU A;  2PGZ A;  1ZEE A;  2V8S V;  4ZI3 C;  2VVS A;  1VRB A;  2YKS A;  2WQY A;  3AEB A;  4UM3 S;  4UIG A;  4L9I A;  1J5E T;  5BMV E;  1UW6 A;  2N9D A;  2ODV A;  5LGT B;  3RKG A;  5JTG A;  2MAW A;  5HXH A;  3UU8 A;  4UVA B;  2LM2 A;  4HFH A;  3LSV A;  5LCY A;  2NTX A;  5AQN B;  3PU8 A;  1D1A A;  1O3X A;  5H6R B;  2WM9 A;  3T8O A;  4AQF C;  4PIR A;  5J5I A;  4IE6 A;  4EZ1 A;  4YXD A;  2W8F A;  4MFR A;  3UU3 A;  4IE5 A;  3A7M A;  4DV7 T;  2XAS B;  3VRA A;  4HWC A;  4HN9 A;  2W00 A;  2K9A A;  3PJA J;  1SE7 A;  2VQF T;  4PK4 A;  4U2Z A;  3RX6 A;  3PUA A;  3AEG A;  3X1D A;  3MXZ A;  3F31 A;  3P7I A;  1YQ3 A;  4LFA T;  3I0Q A;  4JI4 T;  1I9B A;  4ZK1 A;  4WW0 A;  3UT5 E;  4AFT A;  1NWM X;  5CB4 E;  4A98 A;  3U8L A;  5JDF A;  1YXR A;  4JI7 T;  3UTK A;  3UUB A;  2Q9Q B;  3AE1 A;  2H89 A;  2LM9 A;  5F8P A;  1I6Z A;  2ZM8 A;  3N9N A;  4HEA A;  1M7K A;  1KNP A;  5JH7 E;  1J5W A;  2LJL A;  2H7V C;  2WSS V;  3W15 B;  2MTQ A;  3QB5 K;  3SIO A;  2E9X B;  1MMD A;  4UM3 A;  1GQE A;  4P0A A;  4AKR B;  2ZLY A;  2XSA A;  4QHO A;  5AQQ B;  4U72 A;  4QXB B;  2VL0 A;  3BQL A;  4UEL A;  4H9P C;  2BG9 A;  5FY7 A;  4AKL A;  5HEH A;  3IBP A;  3C64 A;  2CWO A;  4QKN A;  4JI2 T;  3KBU A;  1LRZ A;  3KBT A;  4H9O C;  4AKG A;  2LSJ A;  5LBM A;  3GMI A;  2WMO A;  3ZN1 B;  1MIW A;  3V5S A;  4GK0 E;  4BJN A;  4EOZ B;  1OWA A;  4ZR6 A;  5IWA T;  5AFM B;  4CZZ B;  2EHO B;  2VVN A;  3KIN B;  2XQY A;  2XZ5 A;  1IJ6 A;  4X20 E;  3L39 A;  5M4Y A;  4ASK A;  3VHL A;  1OED C;  2BS3 A;  1CUN A;  4BQT A;  2X66 A;  5HEU A;  2V6X A;  4YY3 T;  5HCJ A;  3AA6 B;  2IIU A;  4PJJ A;  4EYY R;  4TV9 E;  3WTO A;  3SFE A;  3FHN A;  1X9B A;  2BYN A;  4Z91 A;  5ADX L;  4QWN B;  3SS1 A;  4QH1 A;  5FY1 A;  5JDL A;  2YMD A;  2CPT A;  5FY0 A;  3OTO T;  3CK6 A;  1FIO A;  2HPJ A;  4UVB B;  2W0G A;  1JNZ A;  4KBM B;  3FZM B;  1T8B A;  5FYM A;  2PJQ A;  4PNI A;  4N78 D;  4QX8 B;  2ODU A;  4DID B;  3WIP A;  1HS7 A;  3OPC A;  2YOE A;  4TZ4 C;  5AFJ A;  2XAJ B;  2Z6E A;  3FXE B;  1QUU A;  1SHZ C;  2QRX A;  4HFB A;  4LFC T;  4OK0 A;  5AQG B;  1VCS A;  5BW2 A;  1UK5 A;  3EDU A;  4DBM A;  2V7J A;  3NRX A;  4BA9 A;  1WR0 A;  2QYW A;  4PAG A;  2E2A A;  4EV6 A;  1YKE B;  2YK0 A;  4WV9 A;  4IE4 A;  2WU5 A;  2VL8 A;  5DQW A;  5EK2 A;  2XPK A;  2N2N A;  5KDM C;  5AFL A;  3PUV F;  4UXU A;  5AQM B;  4ZI2 D;  3WTI A;  2IDO B;  3B57 A;  4B3R T;  5JME A;  1OED B;  4WBO A;  2K3W A;  3SFD A;  3AED A;  4DR4 T;  2Y48 B;  5KX5 E;  4LF4 T;  3PJA A;  3NZP A;  4KI0 F;  5ABG A;  1MIY A;  4IL9 A;  2CLY C;  1N32 T;  4AQG A;  1CHU A;  1KNR A;  2LOS A;  3EAM A;  1XMO T;  3RGL A;  4DV5 T;  3KDS E;  3CX7 B;  5FNV E;  5TVC A;  2X67 A;  2JQ9 A;  2Y54 A;  5JDH A;  3PUW F;  2KWH A;  3PUZ F;  3OKQ A;  4ILU A;  3UQ4 A;  4I43 B;  3E08 A;  2X00 A;  1KEY A;  3GWH A;  2DL1 A;  2WNC A;  2XQ5 A;  2X51 A;  2BG9 C;  2IHR 1;  4KUM B;  5JDQ A;  3K3N A;  1YD8 G;  1US7 B;  3RRW A;  4HFC A;  2C9T A;  2W67 A;  2WAU A;  5JR9 A;  2BVL A;  2QGS A;  4AXP A;  3PUG A;  3CML A;  3RLF F;  4HFI A;  2FJE A;  3T1Y T;  4U7Y A;  4ISS A;  1E7P A;  4WBN E;  1OXZ A;  3DTO A;  2CCQ A;  4DUY T;  1QLB A;  5L3F B;  5CGM A;  2IC6 A;  4F8H A;  3O1J A;  2ACX A;  3HL6 A;  3SH1 A;  1WYC A;  3N9P A;  3F57 A;  4YTM A;  3RYF E;  5JDN A;  4ZJS A;  3NZQ A;  2M67 A;  4JI1 T;  2UXX B;  2X0L B;  4UF0 A;  3ZN0 B;  4DR5 T;  3HR0 A;  4YSZ A;  3NVO A;  3C84 A;  2XQA A;  3AEF A;  4EGW A;  5DAB A;  4GKK T;  3ZT6 A;  5J1G A;  2LEH A;  3UU4 A;  5J2T E;  2ZJV A;  4EED A;  3Q5E A;  4LF8 T;  4IL4 A;  2DLR A;  2BKN A;  5AQF B;  2H88 A;  3DP7 A;  4ANJ A;  4E7S A;  4J2C A;  3N9L A;  2V1D B;  2XAF B;  4DV1 T;  2X0H A;  3CQG B;  4QAA A;  5FVL A;  2AXD S;  5J5G A;  1Y01 A;  2XUE A;  2BR8 A;  2OA5 A;  5J5H A;  4G63 A;  3KVB A;  5HEO A;  1U5P A;  2YDS A;  4UM1 A;  1ZOY A;  1MMN A;  3UU6 A;  2DNX A;  3ZT5 A;  4X1Y E;  4O2B E;  4DBR A;  3ESL A;  2WNJ A;  2LT3 A;  4B6X A;  3CQC B;  4ZS3 A;  5AFK A;  2YN6 A;  4JBW F;  3ZDH A;  3HKB E;  5ABE A;  3HKC E;  4ZI7 E;  1Z0P A;  2XQ8 A;  3ONJ A;  4DR7 T;  2LRK A;  3VKG A;  2WBL A;  1D0Y A;  4CN1 A;  5H6Q B;  3ZMZ B;  3CIR A;  3AE2 A;  3PUY F;  4IT4 A;  3OBV E;  1BR1 A;  4JI3 T;  1D0Z A;  4JI0 T;  1UX2 A;  3ZMV B;  3CX8 B;  3K8P C;  4YSY A;  2IC9 A;  5L4E A;  2BBJ A;  2A3D A;  1UUR A;  3C4X A;  5AIN A;  2X9W A;  2LHR A;  2I0M A;  3ZCI A;  3AE7 A;  2XNV A;  3D0T A;  3OYX A;  4NUV A;  3Q5D A;  2YDR A;  3WI3 A;  4JI6 T;  2CM0 A;  2Y7Y A;  4YFS A;  3FZK B;  2SPC A;  2V5C A;  2WS3 A;  2CRB A;  4DVD A;  3I9W A;  3FB2 A;  3ZMU B;  4DND A;  1DU2 A;  1XWM A;  5DJQ C;  5IHY A;  5KMG P;  4I0U A;  2UZ6 A;  4ILB A;  2D0U A;  2BR7 A;  3R84 B;  3CQX C;  4ERR A;  4IDQ A;  2HN1 A;  3M3Z B;  5FP3 A;  5JQG E;  3SWH A;  2UUC T;  2WZH A;  2X0Y A;  2NW7 A;  2E5L T;  5HYA A;  5L3G B;  1LVF A;  1UUS A;  3GUA A;  1VOM A;  3N9O A;  3F2E A;  5JR9 C;  4EZ4 A;  3QB5 A;  4YTP A;  2UU9 T;  4UV9 B;  4AFH A;  3ZYK A;  3WTJ A;  4BAY B;  3PEO A;  2K48 A;  5AQT B;  3RYI E;  3UQ7 A;  5ABF B;  1XDP A;  5KE4 A;  3PUR A;  5LYJ E;  4TWF A;  4XZC A;  2UXC T;  3S4U A;  3RIU A;  2FJB A;  4H9Q C;  1HF8 A;  2RA1 A;  3JAE A;  3P4S A;  3LG7 A;  3TLS A;  5LGU B;  4V1A v;  3GN5 B;  4G2A A;  4L0R A;  5FMN A;  2XAG B;  2V6Y B;  4X62 T;  2CHO A;  4FI5 A;  2UUA T;  5J2U E;  3LDQ B;  1W09 A;  3AA7 B;  2YEV C;  1XZY A;  4H9R C;  3ZMT B;  1N36 T;  5BP0 A;  4AI6 A;  3J9X 1;  2PBI A;  2V5D A;  2XZE A;  2MBG A;  3UUM A;  3AA1 B;  2BYR A;  3IGQ A;  2BS4 A;  2OLT A;  3PDY A;  4TWD A;  4CN4 A;  3PE0 A;  5KZU A;  2KZ7 B;  4O4J E;  4KHP T;  1WCR A;  4HWD A;  2LHN A;  3RC3 A;  5AQU B;  2ZM0 A;  4ZEY A;  2DWK A;  1UX5 A;  2NP9 A;  4OYK A;  4P0B A;  3ZEF B;  3R6N A;  2WN9 A;  3C79 A;  3ZYM A;  3K1S A;  2RPA A;  3ZDG A;  1E2A A;  2IUB A;  1KNZ A;  5CO5 A;  3O9X A;  4O4H E;  3MK7 C;  5JRC A;  2WMN A;  2LKG A;  4IDP A;  5AQI B;  1J1J A;  2ZM6 T;  2CBJ A;  2H3R A;  1I94 T;  3KV6 A;  2VB6 A;  3ZJ1 A;  2CEA A;  5GON E;  1H7C A;  3ANW B;  4CN6 A;  3N9Q A;  2JQQ A;  2BJ0 A;  3I0O A;  1HG2 A;  4U33 A;  1LKX A;  4Z90 A;  4NPP A;  3NRY A;  3ZC0 A;  4GYR A;  1YKH B;  4JI5 T;  2YIN A;  5C2T A;  4YHH T;  4YSX A;  1FMV A;  2VQE T;  3QK6 A;  4X5T A;  5LP6 E;  4IE7 A;  4LF9 T;  2CE7 A;  1AJ3 A;  5CA1 E;  2FJD A;  3QNU A;  3WAK A;  1UGO A;  3RKO A;  1KF6 A;  4DV0 T;  3KFW X;  4ALX A;  2CMR A;  3ZST A;  5HXR A;  1MND A;  5FL0 A;  2YDQ A;  4CQI A;  2X9Y A;  4XBF B;  3JC6 C;  5FVK A;  5JDM A;  2VKD A;  4ZS2 A;  1XDO A;  1NAF A;  4U74 A;  2D0T A;  3ETV A;  2W66 A;  4UEM A;  1R8I A;  3L3P A;  2R6G F;  3MAC A;  3PUS A;  3C51 A;  5HAX A;  2N1G A;  5CFB A;  2WU2 A;  1ZKE A;  1WRD A;  3AAI A;  3UFE A;  4M1P A;  2BZB A;  3G06 A;  3U8K A;  4CI2 B;  4EYU A;  4YJ2 E;  5LNK A;  3K3Q C;  4HE8 A;  4CXY A;  4B3S T;  5AQS B;  4DV2 T;  2WB5 A;  3EI0 A;  3P4P A;  4IDZ A;  4O4L E;  3PU3 A;  5ABH A;  4HKA A;  3A5X A;  2JJ9 A;  5LMN T;  1FMW A;  1T7S A;  4DMW A;  4ILA A;  4COF A;  4HFD A;  4K0U A;  5AFH A;  2M6I A;  3ZYL A;  3TLU A;  3GN5 A;  4MHC A;  1LVK A;  2Q9Q A;  4DR6 T;  2V6Y A;  2W61 A;  3H3A A;  2MOZ A;  4DO0 A;  2ZM2 A;  4OFZ A;  4X64 T;  5C8Y E;  1HFA A;  3HA4 A;  4TNW A;  3ONL C;  1HNZ T;  5F5W A;  3DJB A;  2IAK A;  2E9X A;  4FRR A;  2Y8D A;  2X9H A;  4LML A;  3KV4 A;  5LMU T;  4B3T T;  2QC1 B;  4U31 A;  5L47 A;  2JPF A;  5ETW A;  1YW0 A;  4DBQ A;  2XQ7 A;  3SRZ A;  4A5X A;  4YLH A;  2V7K A;  3QC9 A;  5JVD E;  4O4I E;  4WZX A;  4AQF A;  4DV4 T;  2BYS A;  4CXW A;  3M65 A;  2CA5 A;  3RQU A;  4I55 E;  4AIS A;  3J7Y q;  1W9R A;  4PJL A;  1X79 A;  2V7L A;  3RC8 A;  4LF6 T;  2YME A;  4UVC B;  4U3C A;  5HXC A;  3ZT7 A;  5AFM A;  2PG8 A;  3WTM A;  2EHO A;  2VWA A;  2CLY B;  4AIU A;  3O1H A;  5EK4 A;  3LK4 2;  4ZOL E;  4UY2 A;  2AE9 A;  2LRL A;  3SOL A;  5HCM A;  5AQO B;  3PMZ A;  2IML A;  2L9Q A;  4EZH A;  3VR8 A;  2CXL A;  3CX6 B;  2CHN A;  4PJN A;  3RIF A;  2KLQ A;  1V9D A;  5HEJ A;  3EVY A;  4IE0 A;  4EB6 E;  3Q5X A;  4MAL A;  1W0A A;  3BK9 A;  4HGA A;  4DV6 T;  4XHE A;  1WYB A;  4C90 A;  2UXB T;  2BG9 B;  4HFE A;  3AB3 B;  3TLV A;  2BDE A;  5CA0 E;  3WTN A;  2FJA A;  4LF5 T;  2XQ6 A;  5LHI B;  1HR0 T;  4UM3 P;  3RHW A;  2XQ3 A;  3AAE B;  5LXT E;  4DV3 T;  2D5U A;  5C3J A;  2XQ9 A;  5AQH B;  2DCF A;  2I59 A;  2B1E A;  2NOX A;  2XYS A;  4H9S E;  2CWY A;  4K0K T;  2WWU A;  4IRE A;  4GYS A;  4NXM T;  2JIW A;  4YT0 A;  1IZN B;  3CWZ B;  4IDN A;  4UV8 B;  4IST A;  5L3C B;  4PFO A;  3SQ6 A;  3ZMS B;  2XJ7 A;  4JEH B;  4XK9 A;  3UUX B;  3RI5 A;  4EAH A;  1OED E;  5AFN A;  3OJA A;  3QUJ A;  1ZHC A;  2W4X A;  3H3M A;  4B3M T;  4X1I E;  1SA0 E;  4H9N C;  2WNL A;  2F4V T;  4IHJ E;  2C5J A;  5HEG A;  4ZRU A;  2DWG A;  4JV5 T;  3WTH A;  3AXJ B;  4LFB T;  5L3D B;  4ZZC A;  3UFG A;  3ZLI A;  4C91 A;  4GIW A;  1OED A;  3MA9 A;  2X00 D;  1WR6 A;  3LK3 B;  3KV9 A;  1HX1 B;  3Q2M A;  3ZJ2 A;  2L8K A;  5TAO A;  5KXJ A;  3JAF A;  4KMC A;  4UR9 A;  1S94 A;  5LA6 E;  1EZ3 A;  5HXE A;  2NW8 A;  3LJC A;  1M62 A;  2YU1 A;  5DQV A;  2L3L A;  3TKL B;  3LBX B;  2CXD A;  2E9X C;  3RYH E;  5LHG B;  3Q5W A;  3GA8 A;  2LSG A;  2XQ4 A;  2XY8 B;  4NZB A;  3RF1 A;  5L4H A;  2G0U A;  4HWH A;  5J5F A;  1N33 T;  4MBQ A;  1D1C A;  3AE4 A;  3AE5 A;  2LKH A;  2Y6X A;  3H37 A;  3RYC E;  3AE3 A;  2EHO D;  3AAA B;  4B5D A;  5BRX A;  5FL1 A;  4TUY E;  2LE8 A;  4HWF A;  4DR1 T;  4KP3 C;  2LLY A;  2D9D A;  2ACZ A;  3U8M A;  4ILC A;  4ZK4 A;  5LJN A;  2EHO C;  3MJX A;  4O2A E;  3KV5 A;  1BR2 A;  3K3O A;  4CXX A;  2XAQ B;  4PJM A;  5AQP B;  3LFM A;  1BR0 A;  4AKH A;  2RP4 A;  4X65 T;  2QVA A;  4EEB A;  1W0B A;  3RQW A;  2W8G A;  3P4Q A;  4AKI A;  1UX4 A;  3PV0 F;  3AEE A;  2XYT A;  1HNW T;  2UUB T;  3P50 A;  4EIW A;  3P8C D;  2XTL A;  1IAP A;  1D1B A;  4QAB A;  3T1H T;  3HKD E;  3FXD B;  1BR4 A;  2W63 A;  3EUH A;  5BR8 T;  2BG9 E;  1N34 T;  1YQ4 A;  5LXB A;  2VKJ A;  1B7T A;  5JR9 B;  3RPU A;  4Q25 A;  4ZXL A;  5JRE A;  5F3J A;  3OYZ A;  3JCF A;  2XSB A;  4Z8X A;  1HG5 A;  2JQK A;  3Q9D A;  2XM1 A;  1XMQ T;  2IW5 B;  2JMK A;  4L5G A;  4A97 A;  4H63 H;  1T98 A;  5L3B B;  3NWI A;  3I9Y A;  4DR2 T;  1FJG T;  2C5K T;  1HTJ F;  4PFP A;  2LSY A;  2OV9 A;  4UF0 B;  4AFG A;  2Y56 A;  2BBH A;  2VAS A;  4LMJ A;  4NXN T;  3KVA A;  2XNT A;  3CKD A;  3T4M A;  3UU5 A;  1G73 A;  5HWX A;  2E8I A;  3CVR A;  1MNE A;  3E22 E;  3AEA A;  4O8S A;  3PTR B;  2MPK A;  3AVS A;  4U2Y A;  3C98 B;  2A72 A;  3JC6 D;  3NBX X;  4P1N A;  2BS2 A;  4YTN A;  3AXJ A;  5CJ5 A;  2P9B A;  5LG4 A;  4A56 A;  2KT9 A;  2M6B A;  2WDV A;  2J4G A;  4WNK A;  1MMA A;  2K24 A;  2I6H A;  3VU7 H;  2NTY A;  1ZP0 A;  3ZC1 A;  4OX9 T;  5SYO A;  5IUX A;  3N9M A;  1Z8U A;  1ZV4 X;  3EHZ A;  4QH5 A;  1XNQ T;  3O4X E;  2WZY A;  4IGU A;  4I50 E;  4QH4 A;  2WZI A;  3WTK A;  2ZMA A;  3LBX A;  5FXW A;  4QX7 B;  4DMV A;  3E0Z A;  1VCT A;  3U8N A;  4UXN B;  5L2L A;  4QAC A;  4WYV A;  5LB7 B;  1U4Q A;  3AVR A;  4X66 T;  3IA3 A;  2KIN B;  2JRK A;  2V7I A;  5IYZ E;  3WAJ A;  4GOU A;  5L3E B;  2A9U A;  4KHZ F;  3VR9 A;  4QXH B;  4HTE A;  3N2G E;  4OHF A;  2UXD T;  2YU2 A;  3C50 A;  3IF8 B;  4FJO A;  1XNR T;  5EK3 A;  3RIU C;  1WLX A;  5LJM A;  5AQL B;  4LF7 T;  4XAX B;  4MLK A;  1IJ5 A;  4HWI B;  4GK5 E;  5ABF A;  2XHE B;  4P09 A;  2J47 A;  4ZJT A;  5HWY A;  4D01 A;  5HXS A;  4TX5 A;  1NEN A;  3ZSS A;  4CI3 B;  1FEW A;  3MKD A;  2PTF A;  2QA7 A;  2UXN B;  2KWI B;  1HNX T;  2H7O A;  1D0X A;  2HHH T;  3ONX A;  3V5U A;  5AQR B;  2V7M A;  2A2F X;  3FZF B;  2GK9 A;  2V26 A;  4TNV A;  3IHR A;  1HX8 A;  4ZI2 C;  5LGN B;  1KK7 A;  3WTL A;  2WDQ A;  1UCU A;  4E7Z A;  1JNR A;  3EAB A;  2KSR A;  4HFV A;  5FKY A;  2NWB A;  1S35 A;  5LOV E;  4JUY A;  3RRC A;  1NEK A;  2JMH A;  2MYS A;  4KX6 A;  4QXC B;  2KMF A;  3A8Y C;  1KFY A;  2VUR A;  3NKZ A;  4TN7 B;  2HH7 A;  2BYP A;  5LHH B;  4YJ3 E; 
#chains in the Genus database with same CATH homology
 3U8K A;  2WZY A;  2BYS A;  2LKH A;  2XNV A;  1UW6 A;  3WTO A;  3UU4 A;  4BFQ A;  4IRE A;  5LG3 A;  2ZJV A;  2BYQ A;  4QH4 A;  3WTK A;  3JAE A;  2BJ0 A;  3RQU A;  2BYN A;  3EAM A;  4IL4 A;  4TWH A;  3TLS A;  2Y7Y A;  3SIO A;  4Z91 A;  3SQ6 A;  4QH1 A;  1UV6 A;  2MAW A;  4Z90 A;  3EI0 A;  4NPP A;  2YMD A;  4UM3 A;  3U8N A;  4B5D A;  5BRX A;  4QAC A;  5TVC A;  3UU8 A;  4A97 A;  4XK9 A;  3RI5 A;  2YME A;  2Y54 A;  5AFM A;  2LLY A;  1OED E;  3WTM A;  4QAA A;  2XZ6 A;  5AFN A;  2LM2 A;  2VL0 A;  4HFH A;  3LSV A;  3UQ4 A;  2PH9 A;  2BG9 A;  4X5T A;  5J5G A;  2WNL A;  3U8M A;  5HEH A;  4ILC A;  2BR8 A;  5HEG A;  2UZ6 A;  2X00 A;  3WIP A;  4AFG A;  5J5H A;  4ZRU A;  2Y56 A;  4ZK4 A;  4ILB A;  4UY2 A;  2BR7 A;  5HEO A;  3WTH A;  2ZJU A;  4ILA A;  2WNC A;  4COF A;  3TLW A;  4HFD A;  2YOE A;  2XQ5 A;  5AFJ A;  2BG9 C;  4PIR A;  4UM1 A;  4LMJ A;  5BP0 A;  4ZZC A;  5AFH A;  5HCM A;  2BYP A;  4ALX A;  2M6I A;  5J5I A;  3PMZ A;  3TLU A;  3UU6 A;  1OED A;  4EZ1 A;  2XNT A;  2W8F A;  4HFC A;  2C9T A;  3T4M A;  2BYR A;  4HFB A;  3UU5 A;  2X00 D;  4LMK A;  3IGQ A;  4TWD A;  3UU3 A;  2WNJ A;  3RIF A;  5AFK A;  5HEJ A;  4ZJT A;  5J0Z A;  4D01 A;  5BW2 A;  2YN6 A;  4DBM A;  3RQW A;  2W8G A;  5KZU A;  3ZDH A;  4HFI A;  3JAF A;  4TNW A;  5FJV A;  4ZR6 A;  3TLT A;  3GUA A;  5AFM B;  2Y57 A;  2XQ8 A;  2XYT A;  4XHE A;  4WV9 A;  3P50 A;  2XZ5 A;  2BG9 B;  4FRR A;  4HFE A;  4QAB A;  3U8J A;  4TNV A;  3TLV A;  3WTN A;  4F8H A;  4AFH A;  2WN9 A;  3C79 A;  3JAD A;  3SQ9 A;  2M6B A;  2XQ6 A;  1I9B A;  3WTJ A;  4LML A;  3ZDG A;  4UM3 P;  3SH1 A;  3WTL A;  4UXU A;  3RHW A;  3WTI A;  5AFL A;  3PEO A;  2BG9 E;  2KSR A;  1OED C;  2XQ3 A;  3ZKR A;  1UX2 A;  5CO5 A;  4AFT A;  4ZK1 A;  2QC1 B;  2Y58 A;  4BQT A;  3P4W A;  4A98 A;  5JME A;  1OED B;  5L4E A;  5L47 A;  4ZJS A;  3U8L A;  2LKG A;  2XQ4 A;  5CFB A;  5HEU A;  3UQ7 A;  2PGZ A;  2XNU A;  2XQ9 A;  4NZB A;  5LXB A;  3UUB A;  5AIN A;  5HCJ A;  5KE4 A;  5L4H A;  4HQP A;  5J5F A;  3C84 A;  3RIA A;  2XQ7 A;  2YKS A;  5IUX A;  5SYO A;  4UM3 S;  2XQA A;  4TWF A;  4ZZB A;  4IL9 A;  3EHZ A;  4QH5 A;  2XYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...