4ILAA

The pentameric ligand-gated ion channel glic a237f in complex with cesium
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilaA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilaA01
4F8HA 5SYOA 5AFMA 2BYNA 1OEDE 3WTKA 2XQ3A 4LMKA 1OEDC 3UQ7A 5CO5A 5AFJA 4AFTA 5AFKA 3TLSA 2XZ6A 3SIOA 2BR7A 2ZJUA 4ZZCA 3WIPA 5HCJA 3EHZA 3UU3A 4UM3S 1I9BA 3U8KA 3UQ4A 2WNCA 4WV9A 2UZ6A 3T4MA 5BP0A 4QH4A 5JMEA 5HCMA 2BG9A 4TWFA 5IUXA 4HFEA 2BG9B 3C84A 3WTNA 4A97A 2YMEA 2XNUA 1UV6A 2ZJVA 2XNTA 2LKHA 3PMZA 4DBMA 2LLYA 3U8NA 2WNLA 3WTOA 4UY2A 4QAAA 2MAWA 4UM1A 5AFMB 2WNJA 3P4WA 2WZYA 2Y56A 3ZDHA 4HFHA 3TLTA 4ZRUA 2XQ7A 4IREA 5L4EA 5J0ZA 2XYTA 4QACA 3WTJA 3ZKRA 2LM2A 5FJVA 3RQWA 1UW6A 3WTIA 5KZUA 2M6IA 4IL9A 2BG9C 4PIRA 2KSRA 3JAEA 2XZ5A 5L47A 3ZDGA 2Y58A 2Y57A 4UM3A 4ZK1A 4LMJA 5AINA 2WN9A 4NZBA 4IL4A 2YN6A 5L4HA 3LSVA 4XHEA 2LKGA 4AFGA 4ILAA 3TLVA 4NPPA 4ZR6A 4X5TA 3UU5A 5AFLA 2W8GA 1UX2A 3P50A 2XQAA 2BYPA 5AFHA 5HEGA 2W8FA 3RIAA 3PEOA 4UXUA 4ILCA 4HQPA 2BYSA 2XQ4A 5LG3A 3IGQA 2BG9E 4LMLA 4TWDA 4QABA 3RIFA 5AFNA 5J5FA 4BFQA 4D01A 2Y54A 3SH1A 5KE4A 2QC1B 4ZZBA 2BJ0A 3GUAA 3WTHA 5J5HA 2YOEA 3RQUA 3TLWA 2BYQA 3TLUA 3UUBA 2X00D 4AFHA 5CFBA 2XNVA 5TVCA 3EI0A 2XYSA 4QH5A 3UU6A 4FRRA 5HEJA 4TNVA 4ILBA 5HEHA 2PGZA 3JAFA 2X00A 2C9TA 2Y7YA 5J5GA 3SQ6A 3U8LA 4COFA 3WTLA 3UU8A 4ALXA 4B5DA 1OEDA 5LXBA 4UM3P 3U8JA 2XQ8A 4HFBA 3WTMA 1OEDB 5BW2A 2XQ6A 4HFIA 2M6BA 3U8MA 2XQ9A 4HFCA 2YKSA 3UU4A 4EZ1A 4TNWA 4TWHA 2BYRA 4Z90A 5BRXA 4QH1A 3RI5A 5J5IA 4A98A 4ZJTA 4XK9A 4ZJSA 3JADA 4BQTA 4Z91A 2BR8A 3RHWA 3SQ9A 2YMDA 5HEOA 2PH9A 4ZK4A 5HEUA 2VL0A 3EAMA 2XQ5A 4HFDA 3C79A
chains in the Genus database with same CATH superfamily
4JEUB 4H63V 4ISTA 1OEDC 2CWYA 2DL1A 2OA5A 3Q5DA 5AQSB 5LB7B 1HF8A 5EK3A 3DTOA 3P4PA 2WNCA 5JMEA 4HFEA 1UURA 2NW8A 2PG8A 3UULA 2C5IT 2YU2A 4HE8A 4A97A 1EZ3A 1L0VA 2LLYA 3KBUA 3U8NA 2JQQA 3O1JA 5M4YA 2YDSA 4DV7T 2W0GA 2VL8A 3NRYA 4DV4T 4U2ZA 2K9AA 4OYJA 3BQIA 3ZKRA 1IJ6A 1UW6A 4CQIA 1HX8A 5AFUL 2W61A 4LMJA 3PUWF 2JPFA 3VHLA 3RF1A 3SRZA 5JREA 3R6NA 4XZCA 4JI6T 3OVUA 4JI7T 3RX6A 2CXLA 3P7IA 3C4XA 4GK0E 5KE4A 4CI1B 3WTHA 5JRCA 2X00D 1QLBA 3IEEA 5ABFA 3MZKB 5JDFA 5TVCA 4AFHA 4DO0A 3UU8A 3WTMA 1OEDB 4I50E 2HHHT 2XQ9A 2LEHA 5H6QB 2WY2A 4TNWA 4PK4A 2E5VA 2LM9A 3L8RA 3EDUA 5GONE 3QC9A 4Z8XA 2IDOB 2XASB 4F8HA 1WCRA 5AFMA 1G73A 2LOSA 3N9QA 2HH7A 4LMKA 1YQ4A 3AE2A 3PURA 3NWIA 5HCJA 4KMCA 1Y64B 2AXDS 4IT4A 1I9BA 3AE6A 4KHZF 1UX4A 2CHOA 5JR9C 2XNUA 3RRWA 3K8PC 2C5JA 3L3PA 3AAEB 2NTYA 3GN5B 4QX7B 3ZDHA 4DR4T 4UVAB 4DR7T 4QACA 2ZM6T 3RQWA 1W09A 3PUZF 2NR4A 4I4TE 5L47A 3PUVF 1OXZA 5AQVB 4PJMA 2L3LA 5AQLB 4IL4A 2VASA 1KNZA 3FBLA 4I0UA 4IDOA 2BYPA 3NZQA 5HEGA 3AEGA 3UT5E 5AQRB 3GWHA 1DU2A 1XNRT 3PU3A 3N2KE 3WAKA 3ZJ1A 2NOXA 3KV6A 2PGZA 4LF4T 2X00A 2C9TA 2FJDA 3SQ6A 4YJ3E 5LXBA 1WR0A 2XQ6A 4JI3T 3FXEB 2KZ7B 1D0YA 2ZM0A 4JI4T 2DWGA 4NXMT 2FBWA 3PU8A 3H3AA 4BQTA 4N78D 3R84B 1IBLT 4WYVA 3A7MA 4TUYE 2MPKA 5JR9B 3RYFE 2WCAA 2LSGA 2H88A 4DMWA 2CE7A 5H6RB 2V6YB 3MK7C 2DCFA 1HCIA 4ANJA 3OYZA 5J2UE 2MYSA 4WZXA 4EZ4A 3J9X1 3RYHE 4AQFA 3LJCA 5L4EA 2X9WA 5FY1A 2BG9C 4JYAT 3AB3B 1SUMB 4H9OC 3RIUA 1HG2A 2QVAA 4UM3A 2D2SA 3UFGA 2YN6A 2FJEA 4XHEA 4DR3T 4AKGA 3P50A 4CXWA 2Y6XA 4EIWA 3AA7B 5BR8T 5EZYE 2VVNA 3TLWA 1GQEA 4DV1T 4ZI3C 3FZLB 3FZMB 5AQPB 3ANWA 4DR6T 2WDRA 2XY8B 5KX5E 4U3CA 4B5DA 2KXPB 4YY3T 4HFBA 2YDQA 4HFCA 4EYUA 3ZC1A 2WQYA 4O2BE 3RHWA 3NRXA 1NAFA 2CCQA 2VKDA 2WBLA 1CUNA 4AKIA 1D1BA 3U3IA 2WDQA 5L3GB 1Y01A 1WRDA 2L9QA 1MNEA 1XZYA 2CMRA 2NTXA 4QH4A 2WZHA 2WDVA 2GK9A 2BG9B 4HN9A 2H7VC 4ZI2C 5FXVA 3M65A 3SFDA 5J0ZA 3ABVA 2OV9A 2LM2A 4QHOA 5FJVA 5KZUA 4EAHA 4L9IA 4F6RC 4ZK1A 2VB6A 3N9PA 4ZS2A 3N9MA 1UK5A 4MLKA 4AKHA 3GA8A 5FY7A 1XDPA 2ODVA 2XQ4A 4YHJA 3LK42 4CN1A 4YFSA 2E9XD 2UXXB 2BS2A 4U7YA 2HN2A 3ZCIA 4QH5A 4UXNB 2IW5B 4O8SA 4ILBA 3GMIA 3HI2A 2D9DA 2M6BA 4EZ1A 2WS3A 3AXJA 3KV9A 3H37A 3MJXA 3PJAJ 5JDNA 3KFWX 2RP4A 5LGNB 3HA4A 1D1AA 1OWAA 5SYOA 2K24A 3PUQA 5AFKA 3O1IA 5C8YE 3ZPOA 3N5LA 5FP3A 2XUEA 2MBGA 3JC6D 4YJ2E 1UCUA 2DNXA 1MIVA 2LSJA 2V7LA 2UU9T 1UV6A 1QSDA 2JQKA 3DP7A 3MXZA 4DV2T 4UY2A 4BA9A 4FJOA 2WNJA 2WZYA 4ZRUA 3ONXA 3B5MA 3X1DA 1VRBA 4IL9A 4GYRA 5J2TE 2LT3A 2LSKA 3JAEA 2A9UA 4DV5T 2DHRA 2Y8DA 2ES0A 3Q2MA 4JI1T 1IJ5A 5FXZA 3ZMUB 4HQPA 2EHOB 4NUUA 5FY0A 2VWAA 2C0SA 2W00A 2E9XA 3RQUA 2WMNA 2N2NA 5AQNB 2V7KA 1KK7A 3N9NA 2FUPA 2JRKA 4COFA 3WTLA 2CRBA 3B57A 1G8XA 2HN1A 2MOZA 4EEBA 3CX8B 2XM1A 2J47A 3QB5A 2DWKA 1D1CA 1R8IA 4PW8A 3IHRA 1FJGT 4LF5T 4TZ4C 3P4QA 4AFTA 4O4LE 3TLSA 1NWMX 3F57A 4ASKA 4DV0T 2ZJUA 3PUXF 3T4MA 4JBWF 5LBMA 2IIUA 3O9XA 3EVYA 2B76A 4CI3B 5CA1E 5ABGA 4AIUA 4MALA 3RLFF 3AEDA 4JI5T 2VKOA 3AE5A 4TX5A 5JDHA 2XYTA 3C98B 3WTIA 2ODUA 2CXDA 2PTFA 1BR1A 2M6IA 4B6XA 3BQLA 2Y57A 2WP9A 5FL1A 3Q9DA 4IE6A 5AINA 2N9DA 1YW0A 4EEDA 5FL0A 4ILAA 4NPPA 4BJMA 3LG7A 5CA0E 5AQFB 2XAGB 2ZM8A 3ZCJA 4KHPT 4ZZBA 2BJ0A 3GUAA 2BYQA 3OYXA 3TLUA 2X9XA 3UUBA 4DVDA 2JMKA 2XYSA 5HEJA 5HEHA 2YK0A 4GKJT 2YINA 4L5GA 1V9DA 4UM3P 2CBJA 3U8MA 1KEYA 1M7KA 3L39A 4BJNA 1BR4A 4TWHA 5BRXA 2XZEA 4XK9A 3PUGA 3ZSSA 2W63A 1Z8UA 5HEOA 4G2AA 3ZSTA 3GN5A 3AA6B 3FZKB 5AQMB 1J5ET 5CO5A 5HXEA 1S35A 3FB2A 3UQ4A 1HTJF 4ZS3A 4KX6A 2ACZA 4PJJA 4UIGA 4YT0A 4DR2T 2NP9A 3TKLB 5JDMA 4X65T 3V5UA 2JQHA 3WTNA 3FXDB 4DV6T 3PMZA 4OK0A 5JVDE 2UUCT 3BK9A 5HAXA 2IMLA 4QAAA 1XNQT 3C50A 5L3FB 3O4XE 2I6HA 1KNRA 1N36T 1KFYA 4IE4A 2ZMAA 4O4HE 4ZXLA 2VQFT 2WMOA 2KINB 5JQGE 2KWHA 2L8KA 2CM0A 4HWCA 4JEHB 3PJAA 4X5TA 2X9YA 5FXXA 5ETWA 4DR5T 3RYCE 3RIAA 4UEMA 2BG9E 4LMLA 4BFQA 4IIJE 4QXHB 4EB6E 1WLXA 3CKDA 5J5HA 5JR9A 3ZN0B 3RC8A 3W15B 5F5WA 3AE8A 5FKYA 2XNVA 4ZHQE 2WWVA 4A5XA 2Q9QD 4IDQA 4PNIA 2XQ8A 3FHNA 4X62T 2VKHA 3QUJA 2V6YA 5CB4E 1AJ3A 1SA0E 3LK3B 2XTLA 2XAQB 2ZM2A 2JQ9A 3JADA 3AEAA 2YMDA 1MMAA 4HWFA 2XQ5A 4X1KE 5DQVA 4AQGA 1YXRA 3MKDA 3FZFB 4P09A 2BS3A 2XJ7A 3IA3A 2CEAA 3EHZA 1LVKA 3UU3A 1WYBA 5BP0A 4H9RC 5IUXA 3LDQB 3OBVE 4ISSA 3ZLIA 3C84A 5F8PA 4WBNE 3NKZA 4CN4A 3E08A 2CXFA 2JMHA 2MAWA 2JIWA 4U2YA 5JDLA 5AQGB 3CIRA 3ETVA 5LJMA 3QB5K 4PIRA 2KSRA 3AE1A 3PTRB 2BVLA 4JV5T 1SHZC 2WN9A 2CWOA 1BR0A 2UUBT 3OTOT 5HWYA 1LVFA 2W8GA 5DQWA 3OJAA 2UUAT 3UUNA 3PEOA 1VOMA 4ILCA 4H9NC 2V26A 1D0ZA 5AQUB 2A3DA 4QXCB 3RIUC 3PDYA 4ZEYA 3UTKA 5KXJA 5EK2A 4HWHA 4IHJE 4HTEA 2Q9QA 4IE5A 4HFIA 4QKNA 2X66A 4Z90A 4AXPA 3WAJA 1HG5A 4PFOA 2X67A 1HR0T 3CQGB 4YTNA 4PAGA 4X20E 5AQOB 3Q5XA 2LHNA 4KBMB 5C3JA 2LSIA 2I59A 4CXYA 5HCMA 1M62A 2YMEA 2OLTA 4DBMA 3V5SA 4U33A 2W67A 5F3JA 1MMGA 2XSBA 3JCFA 5HYAA 3KVAA 2EHOD 2WM9A 4ILUA 4C91A 1N32T 2UXBT 5C2TA 4J2CA 2RPAA 4EGWA 1XDOA 3C64A 1U5PA 2NW7A 5A1LA 2VK9A 2IUBA 2W8FA 4DUZT 2LRLA 3SS1A 5LG3A 3LBXB 1FMWA 3VKHA 4DMVA 1BR2A 4NXNT 4EV6A 1CHUA 3N9LA 5IYZE 3HKCE 2X0HA 2LE8A 2Y7YA 2R6GF 4ALXA 2DI4A 2XSAA 4UVCB 4TV8E 3P4SA 4G63A 3CQXC 4OYKA 5LA6E 2CA5A 5ADXL 4JLEA 5LGTB 3I0QA 5HXHA 1UX5A 2VL0A 1YQ3A 4PFPA 5FXWA 4B3RT 3ZN1B 4YHHT 4AKLA 2SPCA 3T1YT 3ONLC 3RGLA 4WNKA 5IHYA 3VKGA 3U8KA 2FJAA 3U78A 2QYWA 4E7SA 4LFCT 2XQYA 4YXDA 3AECA 4UM1A 1B7TA 2D0UA 3FBZA 3WI3A 3ZEFB 1Z0PA 2EHOA 5E0OA 4PJLA 1XWMA 4DBQA 3E0ZA 3ZDGA 5LYJE 5L4HA 2V7JA 4U72A 4TV9E 2IC9A 3HKBE 3I9WA 3EABA 4AI6A 1UUSA 5J5FA 3MACA 2WZIA 1MNDA 2W62A 2YOEA 4IDZA 4L0RA 5CFBA 4AQYT 1T7SA 3UU6A 4TNVA 4EZHA 5BW2A 4UF0A 1WYCA 4DNDA 3ZYLA 3AXJB 3A8YC 4A98A 4IE7A 2E9XC 5LJNA 3ZMTB 3UUXB 3I9YA 4ZK4A 1ZEEA 5HEUA 3MA9A 3VU7H 2XHEB 5DABA 1HNXT 1I6ZA 1T8BA 4OX9T 3WIPA 2NWBA 3BQKA 4JUYA 1E1HB 5L2LA 4H9PC 5JDGA 2ACXA 5AQKB 2UXCT 2DLRA 4GIWA 4ADZA 5LHGB 1T98A 5LBQB 1S94A 2KWIB 1X9BA 3WTJA 4NUVA 1N34T 4MFRA 4YSYA 4XBFB 3JC6C 4ERRA 1N33T 4KI0F 3UUMA 4DR1T 1E2AA 4HWDA 1QUUA 4I43B 2ZLYA 4P1NA 5AQHB 3KV4A 4ZR6A 2BKPA 5LHHB 3N2OA 2M67A 2LHRA 1I94T 3RC3A 2BYSA 3AA1B 2BZBA 5L3EB 2QC1B 2K5BB 2NW9A 1T72A 3EI0A 2BVMA 5LXTE 3FZHB 2H3RA 5LHIB 1OEDA 2UXDT 3S4UA 5CJ5A 2K48A 3UU4A 1KF6A 2D0TA 1FIOA 1E7PA 1MMNA 4DUYT 4JI8T 4LF6T 4Z91A 2V1DB 4X64T 2PH9A 1ZHCA 2WNLA 4HFDA 3QOFA 1US7B 5HXCA 4O4JE 4UV8B 3T8OA 2G0UA 2HPJA 2WB5A 4I55E 3F2EA 3ZYMA 3O1HA 2CHNA 3VRBA 1JNZA 3G06A 4U74A 3HKDE 2LRKA 4CZZB 1WR6A 4WBOA 3QNUA 4YTPA 2QA7A 3ZT5A 3PUAA 4A56A 1VCSA 2W2UA 3NBXX 3KVBA 3CMLA 4ZOLE 2C5KT 2V5DA 4UV9B 1XMOT 3AEEA 4LF7T 2Y58A 4DBRA 4MBQA 4MHCA 2D5UA 3ZMZB 5AFLA 4UXUA 4BAYB 4GKKT 4QABA 5AFNA 3ZJ2A 4D01A 3EDVA 3K3OA 5BMVE 2J62A 4PJNA 4JI0T 2H7OA 5JH7E 4ZI7E 4UELA 1SE7A 3T1HT 3AAIA 2BYRA 3CWZB 5FMNA 1HNWT 3LK2B 2A2FX 5L3CB 3OPCA 2VQET 2BR8A 4EOZB 2N1GA 3SQ9A 5JTGA 5JDQA 2YEVC 3ZC0A 2V5CA 5JRCB 3Q5WA 5ABFB 2VURA 3WTKA 2F4VT 2V7MA 4M1PA 5TAOA 4ZZCA 4O4IE 2XAFB 2XPKA 3KINB 2MTQA 2FJBA 4DV3T 3RPUA 5HXRA 5HXSA 4IGUA 4P0AA 3CVRA 4TWFA 2X0LB 3PV0F 2UXNB 3PUSA 4JI2T 2XM2A 2PBIA 2RA1A 3M3ZB 2W66A 3WTOA 1NEKA 5AFMB 4OHFA 4LF9T 3SOLA 4HFHA 4GK5E 2QGSA 5J1GA 2XQ7A 2E8IA 4HEAA 5L3DB 2HPLA 4IE0A 1W0BA 3KBTA 4ZI3D 3F31A 3LFMA 3ZYKA 3N2GE 3AVRA 5LMNT 3AAAB 4CN6A 2IC6A 1UX2A 1NENA 2BBJA 3DJBA 3Q5EA 1MIWA 3SH1A 1MIYA 2CBIA 4V1Av 3SWHA 4HKAA 4LFBT 3ONJA 1H7CA 4PK5A 4AQFC 3I0OA 5L3BB 4YLHA 5CGMA 3SFEA 3HKEE 3KV5A 2YDRA 3RI5A 4B3TT 5J5IA 4ZJSA 3AVSA 4ZI2D 1HX1B 2WWUA 2E5LT 2KNDA 2V7IA 5LOVE 1D0XA 1IAPA 2Q9QC 2XZ6A 3SIOA 4UM3S 2WU5A 5FNVE 2UZ6A 2BG9A 1LRZA 1ZOYA 5LGUB 3PE0A 2XAJB 3IF8B 3KDSE 4U31A 4K0UA 5DJQC 3ZT6A 2JJ9A 3AE3A 2Y56A 2V8SV 3TLTA 3LBXA 5ABEA 2E2AA 3K3QC 3AE4A 5KMGP 4LF8T 3CX7B 1YKEB 4IDNA 4AFGA 1J5WA 3UU5A 3PUYF 3K3NA 5AQTB 2XQAA 5AFHA 5FVLA 2A72A 2KT9A 3I1AA 2KLQA 3IGQA 3C51A 5LNKA 5LP6E 4Q25A 2V6XA 1FEWA 5J5GA 3U8LA 3NVOA 1O3XA 4HWIB 2Q9QB 2WSSV 2BDEA 4QH1A 3ZT7A 2CPTA 4ZJTA 2BKNA 2X51A 3C79A 2P9BA 4EXTA 2BYNA 2PFVA 2AE9A 4QX8B 4X1YE 4NIQA 3ANWB 3B13A 1XMQT 3RRCA 4X1IE 3AA0B 3HR0A 5ABHA 2WAUA 2BR7A 1ZV4X 1IZNB 1J1JA 2BS4A 3OKQA 1IBMT 3AE9A 4AISA 3ZMVB 4XAXB 3EUHA 2LKHA 3NZPA 3P8CD 4GYSA 1W9RA 3A5XA 1HS7A 4HGAA 4IREA 2IAKA 1ZKEA 3CX6B 2XZ5A 1HFAA 2X68A 2YU1A 1YD8G 3CPZA 3LSVA 1VCTA 1KNPA 4HFVA 3AE7A 1YKHB 2EHOC 2IHR1 5AQIB 1MMDA 4LFAT 3N9OA 2BBHA 4E7ZA 2J1DG 2LSYA 3J7Yq 5FYMA 3RIFA 2J4GA 3QK6A 3K1SA 4K0KT 1U4QA 4CI2B 4YSXA 4FRRA 3RKGA 4U7IA 4AKRB 2X9HA 3C4WA 4H9SE 4OFZA 5LMUT 5AQJB 5FVKA 2B1EA 3CK6A 3RYIE 3VR9A 4UR9A 3E22E 5LCYA 4YTMA 3RH3A 1WFDA 4DIDB 2X0YA 3P4RA 1OEDE 2LOPA 5AQQB 2XQ3A 3IBPA 3UQ7A 3ZMSB 5AFJA 5HWXA 1FMVA 2XAHB 4WV9A 4IDPA 4TN7B 2CLYC 2VKJA 3ESLA 1HNZT 2ZJVA 2XNTA 5KDMC 1ZP0A 4H63H 2H89A 4P0BA 3H3MA 4X66T 3P4WA 1W0AA 2W4XA 4PK6A 4O2AE 2Y48B 1IBKT 3ETUA 4GOUA 4YSZA 4B3MT 4C90A 2I0MA 3L09A 4NZBA 2LKGA 4WW0A 3TLVA 4KUMB 1X79A 3RKOA 3VR8A 3VRAA 1JNRA 2LJLA 4EYYR 4TWDA 4KP3C 2BKOA 2Y54A 3AEFA 4B3ST 2WU2A 3D0TA 3JAFA 3C4ZA 2K3WA 3U8JA 4FI5A 5IWAT 5LG4A 1UGOA 4UVBB 2KMFA 3AEBA 3HL6A 2YKSA 4UF0B 4CXXA 3UFEA 2QRXA 4QXBB 2PJQA 2VVSA 4H9QC 3CQCB 2CLYB 2Z6EA 5EK4A 1LKXA 4QWNB 3EAMA 2E9XB
chains in the Genus database with same CATH topology
4F8HA 5SYOA 5AFMA 2BYNA 1OEDE 3WTKA 2XQ3A 4LMKA 1OEDC 3UQ7A 5CO5A 5AFJA 4AFTA 5AFKA 3TLSA 2XZ6A 3SIOA 2BR7A 2ZJUA 4ZZCA 3WIPA 5HCJA 3EHZA 3UU3A 4UM3S 1I9BA 3U8KA 3UQ4A 2WNCA 4WV9A 2UZ6A 3T4MA 5BP0A 4QH4A 5JMEA 5HCMA 2BG9A 4TWFA 5IUXA 4HFEA 2BG9B 3C84A 3WTNA 4A97A 2YMEA 2XNUA 1UV6A 2ZJVA 2XNTA 2LKHA 3PMZA 4DBMA 2LLYA 3U8NA 2WNLA 3WTOA 4UY2A 4QAAA 2MAWA 4UM1A 5AFMB 2WNJA 3P4WA 2WZYA 2Y56A 3ZDHA 4HFHA 3TLTA 4ZRUA 2XQ7A 4IREA 5L4EA 5J0ZA 2XYTA 4QACA 3WTJA 3ZKRA 2LM2A 5FJVA 3RQWA 1UW6A 3WTIA 5KZUA 2M6IA 4IL9A 2BG9C 4PIRA 2KSRA 3JAEA 2XZ5A 5L47A 3ZDGA 2Y58A 2Y57A 4UM3A 4ZK1A 4LMJA 5AINA 2WN9A 4NZBA 4IL4A 2YN6A 5L4HA 3LSVA 4XHEA 2LKGA 4AFGA 4ILAA 3TLVA 4NPPA 4ZR6A 4X5TA 3UU5A 5AFLA 2W8GA 1UX2A 3P50A 2XQAA 2BYPA 5AFHA 5HEGA 2W8FA 3RIAA 3PEOA 4UXUA 4ILCA 4HQPA 2BYSA 2XQ4A 5LG3A 3IGQA 2BG9E 4LMLA 4TWDA 4QABA 3RIFA 5AFNA 5J5FA 4BFQA 4D01A 2Y54A 3SH1A 5KE4A 2QC1B 4ZZBA 2BJ0A 3GUAA 3WTHA 5J5HA 2YOEA 3RQUA 3TLWA 2BYQA 3TLUA 3UUBA 2X00D 4AFHA 5CFBA 2XNVA 5TVCA 3EI0A 2XYSA 4QH5A 3UU6A 4FRRA 5HEJA 4TNVA 4ILBA 5HEHA 2PGZA 3JAFA 2X00A 2C9TA 2Y7YA 5J5GA 3SQ6A 3U8LA 4COFA 3WTLA 3UU8A 4ALXA 4B5DA 1OEDA 5LXBA 4UM3P 3U8JA 2XQ8A 4HFBA 3WTMA 1OEDB 5BW2A 2XQ6A 4HFIA 2M6BA 3U8MA 2XQ9A 4HFCA 2YKSA 3UU4A 4EZ1A 4TNWA 4TWHA 2BYRA 4Z90A 5BRXA 4QH1A 3RI5A 5J5IA 4A98A 4ZJTA 4XK9A 4ZJSA 3JADA 4BQTA 4Z91A 2BR8A 3RHWA 3SQ9A 2YMDA 5HEOA 2PH9A 4ZK4A 5HEUA 2VL0A 3EAMA 2XQ5A 4HFDA 3C79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8H A;  5SYO A;  5AFM A;  2BYN A;  1OED E;  3WTK A;  2XQ3 A;  4LMK A;  1OED C;  3UQ7 A;  5CO5 A;  5AFJ A;  4AFT A;  5AFK A;  3TLS A;  2XZ6 A;  3SIO A;  2BR7 A;  2ZJU A;  4ZZC A;  3WIP A;  5HCJ A;  3EHZ A;  3UU3 A;  4UM3 S;  1I9B A;  3U8K A;  3UQ4 A;  2WNC A;  4WV9 A;  2UZ6 A;  3T4M A;  5BP0 A;  4QH4 A;  5JME A;  5HCM A;  2BG9 A;  4TWF A;  5IUX A;  4HFE A;  2BG9 B;  3C84 A;  3WTN A;  4A97 A;  2YME A;  2XNU A;  1UV6 A;  2ZJV A;  2XNT A;  2LKH A;  3PMZ A;  4DBM A;  2LLY A;  3U8N A;  2WNL A;  3WTO A;  4UY2 A;  4QAA A;  2MAW A;  4UM1 A;  5AFM B;  2WNJ A;  3P4W A;  2WZY A;  2Y56 A;  3ZDH A;  4HFH A;  3TLT A;  4ZRU A;  2XQ7 A;  4IRE A;  5L4E A;  5J0Z A;  2XYT A;  4QAC A;  3WTJ A;  3ZKR A;  2LM2 A;  5FJV A;  3RQW A;  1UW6 A;  3WTI A;  5KZU A;  2M6I A;  4IL9 A;  2BG9 C;  4PIR A;  2KSR A;  3JAE A;  2XZ5 A;  5L47 A;  3ZDG A;  2Y58 A;  2Y57 A;  4UM3 A;  4ZK1 A;  4LMJ A;  5AIN A;  2WN9 A;  4NZB A;  4IL4 A;  2YN6 A;  5L4H A;  3LSV A;  4XHE A;  2LKG A;  4AFG A;  4ILA A;  3TLV A;  4NPP A;  4ZR6 A;  4X5T A;  3UU5 A;  5AFL A;  2W8G A;  1UX2 A;  3P50 A;  2XQA A;  2BYP A;  5AFH A;  5HEG A;  2W8F A;  3RIA A;  3PEO A;  4UXU A;  4ILC A;  4HQP A;  2BYS A;  2XQ4 A;  5LG3 A;  3IGQ A;  2BG9 E;  4LML A;  4TWD A;  4QAB A;  3RIF A;  5AFN A;  5J5F A;  4BFQ A;  4D01 A;  2Y54 A;  3SH1 A;  5KE4 A;  2QC1 B;  4ZZB A;  2BJ0 A;  3GUA A;  3WTH A;  5J5H A;  2YOE A;  3RQU A;  3TLW A;  2BYQ A;  3TLU A;  3UUB A;  2X00 D;  4AFH A;  5CFB A;  2XNV A;  5TVC A;  3EI0 A;  2XYS A;  4QH5 A;  3UU6 A;  4FRR A;  5HEJ A;  4TNV A;  4ILB A;  5HEH A;  2PGZ A;  3JAF A;  2X00 A;  2C9T A;  2Y7Y A;  5J5G A;  3SQ6 A;  3U8L A;  4COF A;  3WTL A;  3UU8 A;  4ALX A;  4B5D A;  1OED A;  5LXB A;  4UM3 P;  3U8J A;  2XQ8 A;  4HFB A;  3WTM A;  1OED B;  5BW2 A;  2XQ6 A;  4HFI A;  2M6B A;  3U8M A;  2XQ9 A;  4HFC A;  2YKS A;  3UU4 A;  4EZ1 A;  4TNW A;  4TWH A;  2BYR A;  4Z90 A;  5BRX A;  4QH1 A;  3RI5 A;  5J5I A;  4A98 A;  4ZJT A;  4XK9 A;  4ZJS A;  3JAD A;  4BQT A;  4Z91 A;  2BR8 A;  3RHW A;  3SQ9 A;  2YMD A;  5HEO A;  2PH9 A;  4ZK4 A;  5HEU A;  2VL0 A;  3EAM A;  2XQ5 A;  4HFD A;  3C79 A; 
#chains in the Genus database with same CATH topology
 4JEU B;  4H63 V;  4IST A;  1OED C;  2CWY A;  2DL1 A;  2OA5 A;  3Q5D A;  5AQS B;  5LB7 B;  1HF8 A;  5EK3 A;  3DTO A;  3P4P A;  2WNC A;  5JME A;  4HFE A;  1UUR A;  2NW8 A;  2PG8 A;  3UUL A;  2C5I T;  2YU2 A;  4HE8 A;  4A97 A;  1EZ3 A;  1L0V A;  2LLY A;  3KBU A;  3U8N A;  2JQQ A;  3O1J A;  5M4Y A;  2YDS A;  4DV7 T;  2W0G A;  2VL8 A;  3NRY A;  4DV4 T;  4U2Z A;  2K9A A;  4OYJ A;  3BQI A;  3ZKR A;  1IJ6 A;  1UW6 A;  4CQI A;  1HX8 A;  5AFU L;  2W61 A;  4LMJ A;  3PUW F;  2JPF A;  3VHL A;  3RF1 A;  3SRZ A;  5JRE A;  3R6N A;  4XZC A;  4JI6 T;  3OVU A;  4JI7 T;  3RX6 A;  2CXL A;  3P7I A;  3C4X A;  4GK0 E;  5KE4 A;  4CI1 B;  3WTH A;  5JRC A;  2X00 D;  1QLB A;  3IEE A;  5ABF A;  3MZK B;  5JDF A;  5TVC A;  4AFH A;  4DO0 A;  3UU8 A;  3WTM A;  1OED B;  4I50 E;  2HHH T;  2XQ9 A;  2LEH A;  5H6Q B;  2WY2 A;  4TNW A;  4PK4 A;  2E5V A;  2LM9 A;  3L8R A;  3EDU A;  5GON E;  3QC9 A;  4Z8X A;  2IDO B;  2XAS B;  4F8H A;  1WCR A;  5AFM A;  1G73 A;  2LOS A;  3N9Q A;  2HH7 A;  4LMK A;  1YQ4 A;  3AE2 A;  3PUR A;  3NWI A;  5HCJ A;  4KMC A;  1Y64 B;  2AXD S;  4IT4 A;  1I9B A;  3AE6 A;  4KHZ F;  1UX4 A;  2CHO A;  5JR9 C;  2XNU A;  3RRW A;  3K8P C;  2C5J A;  3L3P A;  3AAE B;  2NTY A;  3GN5 B;  4QX7 B;  3ZDH A;  4DR4 T;  4UVA B;  4DR7 T;  4QAC A;  2ZM6 T;  3RQW A;  1W09 A;  3PUZ F;  2NR4 A;  4I4T E;  5L47 A;  3PUV F;  1OXZ A;  5AQV B;  4PJM A;  2L3L A;  5AQL B;  4IL4 A;  2VAS A;  1KNZ A;  3FBL A;  4I0U A;  4IDO A;  2BYP A;  3NZQ A;  5HEG A;  3AEG A;  3UT5 E;  5AQR B;  3GWH A;  1DU2 A;  1XNR T;  3PU3 A;  3N2K E;  3WAK A;  3ZJ1 A;  2NOX A;  3KV6 A;  2PGZ A;  4LF4 T;  2X00 A;  2C9T A;  2FJD A;  3SQ6 A;  4YJ3 E;  5LXB A;  1WR0 A;  2XQ6 A;  4JI3 T;  3FXE B;  2KZ7 B;  1D0Y A;  2ZM0 A;  4JI4 T;  2DWG A;  4NXM T;  2FBW A;  3PU8 A;  3H3A A;  4BQT A;  4N78 D;  3R84 B;  1IBL T;  4WYV A;  3A7M A;  4TUY E;  2MPK A;  5JR9 B;  3RYF E;  2WCA A;  2LSG A;  2H88 A;  4DMW A;  2CE7 A;  5H6R B;  2V6Y B;  3MK7 C;  2DCF A;  1HCI A;  4ANJ A;  3OYZ A;  5J2U E;  2MYS A;  4WZX A;  4EZ4 A;  3J9X 1;  3RYH E;  4AQF A;  3LJC A;  5L4E A;  2X9W A;  5FY1 A;  2BG9 C;  4JYA T;  3AB3 B;  1SUM B;  4H9O C;  3RIU A;  1HG2 A;  2QVA A;  4UM3 A;  2D2S A;  3UFG A;  2YN6 A;  2FJE A;  4XHE A;  4DR3 T;  4AKG A;  3P50 A;  4CXW A;  2Y6X A;  4EIW A;  3AA7 B;  5BR8 T;  5EZY E;  2VVN A;  3TLW A;  1GQE A;  4DV1 T;  4ZI3 C;  3FZL B;  3FZM B;  5AQP B;  3ANW A;  4DR6 T;  2WDR A;  2XY8 B;  5KX5 E;  4U3C A;  4B5D A;  2KXP B;  4YY3 T;  4HFB A;  2YDQ A;  4HFC A;  4EYU A;  3ZC1 A;  2WQY A;  4O2B E;  3RHW A;  3NRX A;  1NAF A;  2CCQ A;  2VKD A;  2WBL A;  1CUN A;  4AKI A;  1D1B A;  3U3I A;  2WDQ A;  5L3G B;  1Y01 A;  1WRD A;  2L9Q A;  1MNE A;  1XZY A;  2CMR A;  2NTX A;  4QH4 A;  2WZH A;  2WDV A;  2GK9 A;  2BG9 B;  4HN9 A;  2H7V C;  4ZI2 C;  5FXV A;  3M65 A;  3SFD A;  5J0Z A;  3ABV A;  2OV9 A;  2LM2 A;  4QHO A;  5FJV A;  5KZU A;  4EAH A;  4L9I A;  4F6R C;  4ZK1 A;  2VB6 A;  3N9P A;  4ZS2 A;  3N9M A;  1UK5 A;  4MLK A;  4AKH A;  3GA8 A;  5FY7 A;  1XDP A;  2ODV A;  2XQ4 A;  4YHJ A;  3LK4 2;  4CN1 A;  4YFS A;  2E9X D;  2UXX B;  2BS2 A;  4U7Y A;  2HN2 A;  3ZCI A;  4QH5 A;  4UXN B;  2IW5 B;  4O8S A;  4ILB A;  3GMI A;  3HI2 A;  2D9D A;  2M6B A;  4EZ1 A;  2WS3 A;  3AXJ A;  3KV9 A;  3H37 A;  3MJX A;  3PJA J;  5JDN A;  3KFW X;  2RP4 A;  5LGN B;  3HA4 A;  1D1A A;  1OWA A;  5SYO A;  2K24 A;  3PUQ A;  5AFK A;  3O1I A;  5C8Y E;  3ZPO A;  3N5L A;  5FP3 A;  2XUE A;  2MBG A;  3JC6 D;  4YJ2 E;  1UCU A;  2DNX A;  1MIV A;  2LSJ A;  2V7L A;  2UU9 T;  1UV6 A;  1QSD A;  2JQK A;  3DP7 A;  3MXZ A;  4DV2 T;  4UY2 A;  4BA9 A;  4FJO A;  2WNJ A;  2WZY A;  4ZRU A;  3ONX A;  3B5M A;  3X1D A;  1VRB A;  4IL9 A;  4GYR A;  5J2T E;  2LT3 A;  2LSK A;  3JAE A;  2A9U A;  4DV5 T;  2DHR A;  2Y8D A;  2ES0 A;  3Q2M A;  4JI1 T;  1IJ5 A;  5FXZ A;  3ZMU B;  4HQP A;  2EHO B;  4NUU A;  5FY0 A;  2VWA A;  2C0S A;  2W00 A;  2E9X A;  3RQU A;  2WMN A;  2N2N A;  5AQN B;  2V7K A;  1KK7 A;  3N9N A;  2FUP A;  2JRK A;  4COF A;  3WTL A;  2CRB A;  3B57 A;  1G8X A;  2HN1 A;  2MOZ A;  4EEB A;  3CX8 B;  2XM1 A;  2J47 A;  3QB5 A;  2DWK A;  1D1C A;  1R8I A;  4PW8 A;  3IHR A;  1FJG T;  4LF5 T;  4TZ4 C;  3P4Q A;  4AFT A;  4O4L E;  3TLS A;  1NWM X;  3F57 A;  4ASK A;  4DV0 T;  2ZJU A;  3PUX F;  3T4M A;  4JBW F;  5LBM A;  2IIU A;  3O9X A;  3EVY A;  2B76 A;  4CI3 B;  5CA1 E;  5ABG A;  4AIU A;  4MAL A;  3RLF F;  3AED A;  4JI5 T;  2VKO A;  3AE5 A;  4TX5 A;  5JDH A;  2XYT A;  3C98 B;  3WTI A;  2ODU A;  2CXD A;  2PTF A;  1BR1 A;  2M6I A;  4B6X A;  3BQL A;  2Y57 A;  2WP9 A;  5FL1 A;  3Q9D A;  4IE6 A;  5AIN A;  2N9D A;  1YW0 A;  4EED A;  5FL0 A;  4ILA A;  4NPP A;  4BJM A;  3LG7 A;  5CA0 E;  5AQF B;  2XAG B;  2ZM8 A;  3ZCJ A;  4KHP T;  4ZZB A;  2BJ0 A;  3GUA A;  2BYQ A;  3OYX A;  3TLU A;  2X9X A;  3UUB A;  4DVD A;  2JMK A;  2XYS A;  5HEJ A;  5HEH A;  2YK0 A;  4GKJ T;  2YIN A;  4L5G A;  1V9D A;  4UM3 P;  2CBJ A;  3U8M A;  1KEY A;  1M7K A;  3L39 A;  4BJN A;  1BR4 A;  4TWH A;  5BRX A;  2XZE A;  4XK9 A;  3PUG A;  3ZSS A;  2W63 A;  1Z8U A;  5HEO A;  4G2A A;  3ZST A;  3GN5 A;  3AA6 B;  3FZK B;  5AQM B;  1J5E T;  5CO5 A;  5HXE A;  1S35 A;  3FB2 A;  3UQ4 A;  1HTJ F;  4ZS3 A;  4KX6 A;  2ACZ A;  4PJJ A;  4UIG A;  4YT0 A;  4DR2 T;  2NP9 A;  3TKL B;  5JDM A;  4X65 T;  3V5U A;  2JQH A;  3WTN A;  3FXD B;  4DV6 T;  3PMZ A;  4OK0 A;  5JVD E;  2UUC T;  3BK9 A;  5HAX A;  2IML A;  4QAA A;  1XNQ T;  3C50 A;  5L3F B;  3O4X E;  2I6H A;  1KNR A;  1N36 T;  1KFY A;  4IE4 A;  2ZMA A;  4O4H E;  4ZXL A;  2VQF T;  2WMO A;  2KIN B;  5JQG E;  2KWH A;  2L8K A;  2CM0 A;  4HWC A;  4JEH B;  3PJA A;  4X5T A;  2X9Y A;  5FXX A;  5ETW A;  4DR5 T;  3RYC E;  3RIA A;  4UEM A;  2BG9 E;  4LML A;  4BFQ A;  4IIJ E;  4QXH B;  4EB6 E;  1WLX A;  3CKD A;  5J5H A;  5JR9 A;  3ZN0 B;  3RC8 A;  3W15 B;  5F5W A;  3AE8 A;  5FKY A;  2XNV A;  4ZHQ E;  2WWV A;  4A5X A;  2Q9Q D;  4IDQ A;  4PNI A;  2XQ8 A;  3FHN A;  4X62 T;  2VKH A;  3QUJ A;  2V6Y A;  5CB4 E;  1AJ3 A;  1SA0 E;  3LK3 B;  2XTL A;  2XAQ B;  2ZM2 A;  2JQ9 A;  3JAD A;  3AEA A;  2YMD A;  1MMA A;  4HWF A;  2XQ5 A;  4X1K E;  5DQV A;  4AQG A;  1YXR A;  3MKD A;  3FZF B;  4P09 A;  2BS3 A;  2XJ7 A;  3IA3 A;  2CEA A;  3EHZ A;  1LVK A;  3UU3 A;  1WYB A;  5BP0 A;  4H9R C;  5IUX A;  3LDQ B;  3OBV E;  4ISS A;  3ZLI A;  3C84 A;  5F8P A;  4WBN E;  3NKZ A;  4CN4 A;  3E08 A;  2CXF A;  2JMH A;  2MAW A;  2JIW A;  4U2Y A;  5JDL A;  5AQG B;  3CIR A;  3ETV A;  5LJM A;  3QB5 K;  4PIR A;  2KSR A;  3AE1 A;  3PTR B;  2BVL A;  4JV5 T;  1SHZ C;  2WN9 A;  2CWO A;  1BR0 A;  2UUB T;  3OTO T;  5HWY A;  1LVF A;  2W8G A;  5DQW A;  3OJA A;  2UUA T;  3UUN A;  3PEO A;  1VOM A;  4ILC A;  4H9N C;  2V26 A;  1D0Z A;  5AQU B;  2A3D A;  4QXC B;  3RIU C;  3PDY A;  4ZEY A;  3UTK A;  5KXJ A;  5EK2 A;  4HWH A;  4IHJ E;  4HTE A;  2Q9Q A;  4IE5 A;  4HFI A;  4QKN A;  2X66 A;  4Z90 A;  4AXP A;  3WAJ A;  1HG5 A;  4PFO A;  2X67 A;  1HR0 T;  3CQG B;  4YTN A;  4PAG A;  4X20 E;  5AQO B;  3Q5X A;  2LHN A;  4KBM B;  5C3J A;  2LSI A;  2I59 A;  4CXY A;  5HCM A;  1M62 A;  2YME A;  2OLT A;  4DBM A;  3V5S A;  4U33 A;  2W67 A;  5F3J A;  1MMG A;  2XSB A;  3JCF A;  5HYA A;  3KVA A;  2EHO D;  2WM9 A;  4ILU A;  4C91 A;  1N32 T;  2UXB T;  5C2T A;  4J2C A;  2RPA A;  4EGW A;  1XDO A;  3C64 A;  1U5P A;  2NW7 A;  5A1L A;  2VK9 A;  2IUB A;  2W8F A;  4DUZ T;  2LRL A;  3SS1 A;  5LG3 A;  3LBX B;  1FMW A;  3VKH A;  4DMV A;  1BR2 A;  4NXN T;  4EV6 A;  1CHU A;  3N9L A;  5IYZ E;  3HKC E;  2X0H A;  2LE8 A;  2Y7Y A;  2R6G F;  4ALX A;  2DI4 A;  2XSA A;  4UVC B;  4TV8 E;  3P4S A;  4G63 A;  3CQX C;  4OYK A;  5LA6 E;  2CA5 A;  5ADX L;  4JLE A;  5LGT B;  3I0Q A;  5HXH A;  1UX5 A;  2VL0 A;  1YQ3 A;  4PFP A;  5FXW A;  4B3R T;  3ZN1 B;  4YHH T;  4AKL A;  2SPC A;  3T1Y T;  3ONL C;  3RGL A;  4WNK A;  5IHY A;  3VKG A;  3U8K A;  2FJA A;  3U78 A;  2QYW A;  4E7S A;  4LFC T;  2XQY A;  4YXD A;  3AEC A;  4UM1 A;  1B7T A;  2D0U A;  3FBZ A;  3WI3 A;  3ZEF B;  1Z0P A;  2EHO A;  5E0O A;  4PJL A;  1XWM A;  4DBQ A;  3E0Z A;  3ZDG A;  5LYJ E;  5L4H A;  2V7J A;  4U72 A;  4TV9 E;  2IC9 A;  3HKB E;  3I9W A;  3EAB A;  4AI6 A;  1UUS A;  5J5F A;  3MAC A;  2WZI A;  1MND A;  2W62 A;  2YOE A;  4IDZ A;  4L0R A;  5CFB A;  4AQY T;  1T7S A;  3UU6 A;  4TNV A;  4EZH A;  5BW2 A;  4UF0 A;  1WYC A;  4DND A;  3ZYL A;  3AXJ B;  3A8Y C;  4A98 A;  4IE7 A;  2E9X C;  5LJN A;  3ZMT B;  3UUX B;  3I9Y A;  4ZK4 A;  1ZEE A;  5HEU A;  3MA9 A;  3VU7 H;  2XHE B;  5DAB A;  1HNX T;  1I6Z A;  1T8B A;  4OX9 T;  3WIP A;  2NWB A;  3BQK A;  4JUY A;  1E1H B;  5L2L A;  4H9P C;  5JDG A;  2ACX A;  5AQK B;  2UXC T;  2DLR A;  4GIW A;  4ADZ A;  5LHG B;  1T98 A;  5LBQ B;  1S94 A;  2KWI B;  1X9B A;  3WTJ A;  4NUV A;  1N34 T;  4MFR A;  4YSY A;  4XBF B;  3JC6 C;  4ERR A;  1N33 T;  4KI0 F;  3UUM A;  4DR1 T;  1E2A A;  4HWD A;  1QUU A;  4I43 B;  2ZLY A;  4P1N A;  5AQH B;  3KV4 A;  4ZR6 A;  2BKP A;  5LHH B;  3N2O A;  2M67 A;  2LHR A;  1I94 T;  3RC3 A;  2BYS A;  3AA1 B;  2BZB A;  5L3E B;  2QC1 B;  2K5B B;  2NW9 A;  1T72 A;  3EI0 A;  2BVM A;  5LXT E;  3FZH B;  2H3R A;  5LHI B;  1OED A;  2UXD T;  3S4U A;  5CJ5 A;  2K48 A;  3UU4 A;  1KF6 A;  2D0T A;  1FIO A;  1E7P A;  1MMN A;  4DUY T;  4JI8 T;  4LF6 T;  4Z91 A;  2V1D B;  4X64 T;  2PH9 A;  1ZHC A;  2WNL A;  4HFD A;  3QOF A;  1US7 B;  5HXC A;  4O4J E;  4UV8 B;  3T8O A;  2G0U A;  2HPJ A;  2WB5 A;  4I55 E;  3F2E A;  3ZYM A;  3O1H A;  2CHN A;  3VRB A;  1JNZ A;  3G06 A;  4U74 A;  3HKD E;  2LRK A;  4CZZ B;  1WR6 A;  4WBO A;  3QNU A;  4YTP A;  2QA7 A;  3ZT5 A;  3PUA A;  4A56 A;  1VCS A;  2W2U A;  3NBX X;  3KVB A;  3CML A;  4ZOL E;  2C5K T;  2V5D A;  4UV9 B;  1XMO T;  3AEE A;  4LF7 T;  2Y58 A;  4DBR A;  4MBQ A;  4MHC A;  2D5U A;  3ZMZ B;  5AFL A;  4UXU A;  4BAY B;  4GKK T;  4QAB A;  5AFN A;  3ZJ2 A;  4D01 A;  3EDV A;  3K3O A;  5BMV E;  2J62 A;  4PJN A;  4JI0 T;  2H7O A;  5JH7 E;  4ZI7 E;  4UEL A;  1SE7 A;  3T1H T;  3AAI A;  2BYR A;  3CWZ B;  5FMN A;  1HNW T;  3LK2 B;  2A2F X;  5L3C B;  3OPC A;  2VQE T;  2BR8 A;  4EOZ B;  2N1G A;  3SQ9 A;  5JTG A;  5JDQ A;  2YEV C;  3ZC0 A;  2V5C A;  5JRC B;  3Q5W A;  5ABF B;  2VUR A;  3WTK A;  2F4V T;  2V7M A;  4M1P A;  5TAO A;  4ZZC A;  4O4I E;  2XAF B;  2XPK A;  3KIN B;  2MTQ A;  2FJB A;  4DV3 T;  3RPU A;  5HXR A;  5HXS A;  4IGU A;  4P0A A;  3CVR A;  4TWF A;  2X0L B;  3PV0 F;  2UXN B;  3PUS A;  4JI2 T;  2XM2 A;  2PBI A;  2RA1 A;  3M3Z B;  2W66 A;  3WTO A;  1NEK A;  5AFM B;  4OHF A;  4LF9 T;  3SOL A;  4HFH A;  4GK5 E;  2QGS A;  5J1G A;  2XQ7 A;  2E8I A;  4HEA A;  5L3D B;  2HPL A;  4IE0 A;  1W0B A;  3KBT A;  4ZI3 D;  3F31 A;  3LFM A;  3ZYK A;  3N2G E;  3AVR A;  5LMN T;  3AAA B;  4CN6 A;  2IC6 A;  1UX2 A;  1NEN A;  2BBJ A;  3DJB A;  3Q5E A;  1MIW A;  3SH1 A;  1MIY A;  2CBI A;  4V1A v;  3SWH A;  4HKA A;  4LFB T;  3ONJ A;  1H7C A;  4PK5 A;  4AQF C;  3I0O A;  5L3B B;  4YLH A;  5CGM A;  3SFE A;  3HKE E;  3KV5 A;  2YDR A;  3RI5 A;  4B3T T;  5J5I A;  4ZJS A;  3AVS A;  4ZI2 D;  1HX1 B;  2WWU A;  2E5L T;  2KND A;  2V7I A;  5LOV E;  1D0X A;  1IAP A;  2Q9Q C;  2XZ6 A;  3SIO A;  4UM3 S;  2WU5 A;  5FNV E;  2UZ6 A;  2BG9 A;  1LRZ A;  1ZOY A;  5LGU B;  3PE0 A;  2XAJ B;  3IF8 B;  3KDS E;  4U31 A;  4K0U A;  5DJQ C;  3ZT6 A;  2JJ9 A;  3AE3 A;  2Y56 A;  2V8S V;  3TLT A;  3LBX A;  5ABE A;  2E2A A;  3K3Q C;  3AE4 A;  5KMG P;  4LF8 T;  3CX7 B;  1YKE B;  4IDN A;  4AFG A;  1J5W A;  3UU5 A;  3PUY F;  3K3N A;  5AQT B;  2XQA A;  5AFH A;  5FVL A;  2A72 A;  2KT9 A;  3I1A A;  2KLQ A;  3IGQ A;  3C51 A;  5LNK A;  5LP6 E;  4Q25 A;  2V6X A;  1FEW A;  5J5G A;  3U8L A;  3NVO A;  1O3X A;  4HWI B;  2Q9Q B;  2WSS V;  2BDE A;  4QH1 A;  3ZT7 A;  2CPT A;  4ZJT A;  2BKN A;  2X51 A;  3C79 A;  2P9B A;  4EXT A;  2BYN A;  2PFV A;  2AE9 A;  4QX8 B;  4X1Y E;  4NIQ A;  3ANW B;  3B13 A;  1XMQ T;  3RRC A;  4X1I E;  3AA0 B;  3HR0 A;  5ABH A;  2WAU A;  2BR7 A;  1ZV4 X;  1IZN B;  1J1J A;  2BS4 A;  3OKQ A;  1IBM T;  3AE9 A;  4AIS A;  3ZMV B;  4XAX B;  3EUH A;  2LKH A;  3NZP A;  3P8C D;  4GYS A;  1W9R A;  3A5X A;  1HS7 A;  4HGA A;  4IRE A;  2IAK A;  1ZKE A;  3CX6 B;  2XZ5 A;  1HFA A;  2X68 A;  2YU1 A;  1YD8 G;  3CPZ A;  3LSV A;  1VCT A;  1KNP A;  4HFV A;  3AE7 A;  1YKH B;  2EHO C;  2IHR 1;  5AQI B;  1MMD A;  4LFA T;  3N9O A;  2BBH A;  4E7Z A;  2J1D G;  2LSY A;  3J7Y q;  5FYM A;  3RIF A;  2J4G A;  3QK6 A;  3K1S A;  4K0K T;  1U4Q A;  4CI2 B;  4YSX A;  4FRR A;  3RKG A;  4U7I A;  4AKR B;  2X9H A;  3C4W A;  4H9S E;  4OFZ A;  5LMU T;  5AQJ B;  5FVK A;  2B1E A;  3CK6 A;  3RYI E;  3VR9 A;  4UR9 A;  3E22 E;  5LCY A;  4YTM A;  3RH3 A;  1WFD A;  4DID B;  2X0Y A;  3P4R A;  1OED E;  2LOP A;  5AQQ B;  2XQ3 A;  3IBP A;  3UQ7 A;  3ZMS B;  5AFJ A;  5HWX A;  1FMV A;  2XAH B;  4WV9 A;  4IDP A;  4TN7 B;  2CLY C;  2VKJ A;  3ESL A;  1HNZ T;  2ZJV A;  2XNT A;  5KDM C;  1ZP0 A;  4H63 H;  2H89 A;  4P0B A;  3H3M A;  4X66 T;  3P4W A;  1W0A A;  2W4X A;  4PK6 A;  4O2A E;  2Y48 B;  1IBK T;  3ETU A;  4GOU A;  4YSZ A;  4B3M T;  4C90 A;  2I0M A;  3L09 A;  4NZB A;  2LKG A;  4WW0 A;  3TLV A;  4KUM B;  1X79 A;  3RKO A;  3VR8 A;  3VRA A;  1JNR A;  2LJL A;  4EYY R;  4TWD A;  4KP3 C;  2BKO A;  2Y54 A;  3AEF A;  4B3S T;  2WU2 A;  3D0T A;  3JAF A;  3C4Z A;  2K3W A;  3U8J A;  4FI5 A;  5IWA T;  5LG4 A;  1UGO A;  4UVB B;  2KMF A;  3AEB A;  3HL6 A;  2YKS A;  4UF0 B;  4CXX A;  3UFE A;  2QRX A;  4QXB B;  2PJQ A;  2VVS A;  4H9Q C;  3CQC B;  2CLY B;  2Z6E A;  5EK4 A;  1LKX A;  4QWN B;  3EAM A;  2E9X B; 
#chains in the Genus database with same CATH homology
 4F8H A;  5SYO A;  5AFM A;  2BYN A;  1OED E;  3WTK A;  2XQ3 A;  4LMK A;  1OED C;  3UQ7 A;  5CO5 A;  5AFJ A;  4AFT A;  5AFK A;  3TLS A;  2XZ6 A;  3SIO A;  2BR7 A;  2ZJU A;  4ZZC A;  3WIP A;  5HCJ A;  3EHZ A;  3UU3 A;  4UM3 S;  1I9B A;  3U8K A;  3UQ4 A;  2WNC A;  4WV9 A;  2UZ6 A;  3T4M A;  5BP0 A;  4QH4 A;  5JME A;  5HCM A;  2BG9 A;  4TWF A;  5IUX A;  4HFE A;  2BG9 B;  3C84 A;  3WTN A;  4A97 A;  2YME A;  2XNU A;  1UV6 A;  2ZJV A;  2XNT A;  2LKH A;  3PMZ A;  4DBM A;  2LLY A;  3U8N A;  2WNL A;  3WTO A;  4UY2 A;  4QAA A;  2MAW A;  4UM1 A;  5AFM B;  2WNJ A;  3P4W A;  2WZY A;  2Y56 A;  3ZDH A;  4HFH A;  3TLT A;  4ZRU A;  2XQ7 A;  4IRE A;  5L4E A;  5J0Z A;  2XYT A;  4QAC A;  3WTJ A;  3ZKR A;  2LM2 A;  5FJV A;  3RQW A;  1UW6 A;  3WTI A;  5KZU A;  2M6I A;  4IL9 A;  2BG9 C;  4PIR A;  2KSR A;  3JAE A;  2XZ5 A;  5L47 A;  3ZDG A;  2Y58 A;  2Y57 A;  4UM3 A;  4ZK1 A;  4LMJ A;  5AIN A;  2WN9 A;  4NZB A;  4IL4 A;  2YN6 A;  5L4H A;  3LSV A;  4XHE A;  2LKG A;  4AFG A;  4ILA A;  3TLV A;  4NPP A;  4ZR6 A;  4X5T A;  3UU5 A;  5AFL A;  2W8G A;  1UX2 A;  3P50 A;  2XQA A;  2BYP A;  5AFH A;  5HEG A;  2W8F A;  3RIA A;  3PEO A;  4UXU A;  4ILC A;  4HQP A;  2BYS A;  2XQ4 A;  5LG3 A;  3IGQ A;  2BG9 E;  4LML A;  4TWD A;  4QAB A;  3RIF A;  5AFN A;  5J5F A;  4BFQ A;  4D01 A;  2Y54 A;  3SH1 A;  5KE4 A;  2QC1 B;  4ZZB A;  2BJ0 A;  3GUA A;  3WTH A;  5J5H A;  2YOE A;  3RQU A;  3TLW A;  2BYQ A;  3TLU A;  3UUB A;  2X00 D;  4AFH A;  5CFB A;  2XNV A;  5TVC A;  3EI0 A;  2XYS A;  4QH5 A;  3UU6 A;  4FRR A;  5HEJ A;  4TNV A;  4ILB A;  5HEH A;  2PGZ A;  3JAF A;  2X00 A;  2C9T A;  2Y7Y A;  5J5G A;  3SQ6 A;  3U8L A;  4COF A;  3WTL A;  3UU8 A;  4ALX A;  4B5D A;  1OED A;  5LXB A;  4UM3 P;  3U8J A;  2XQ8 A;  4HFB A;  3WTM A;  1OED B;  5BW2 A;  2XQ6 A;  4HFI A;  2M6B A;  3U8M A;  2XQ9 A;  4HFC A;  2YKS A;  3UU4 A;  4EZ1 A;  4TNW A;  4TWH A;  2BYR A;  4Z90 A;  5BRX A;  4QH1 A;  3RI5 A;  5J5I A;  4A98 A;  4ZJT A;  4XK9 A;  4ZJS A;  3JAD A;  4BQT A;  4Z91 A;  2BR8 A;  3RHW A;  3SQ9 A;  2YMD A;  5HEO A;  2PH9 A;  4ZK4 A;  5HEU A;  2VL0 A;  3EAM A;  2XQ5 A;  4HFD A;  3C79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...