4ILAA

The pentameric ligand-gated ion channel glic a237f in complex with cesium
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilaA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilaA01
4IL4A 4ZJTA 4B5DA 4AFHA 3UU6A 4TWHA 4IREA 3WTKA 2BG9B 3PMZA 5L4HA 4ZZBA 2X00A 3ZDGA 2X00D 4UM3A 4COFA 3UU3A 2KSRA 2PH9A 5AFJA 4IL9A 5LG3A 2UZ6A 4XK9A 4ILBA 4UM1A 2BYRA 2LLYA 4TWFA 2BYPA 4UM3P 1OEDE 4QH1A 2BYNA 4QAAA 3WTOA 3U8MA 2BJ0A 2BG9C 3RI5A 5L4EA 3WTMA 3RHWA 3P50A 2XQ6A 2XYTA 4LMJA 4ALXA 4XHEA 2W8FA 3U8LA 2XQ5A 4QACA 2YKSA 3UQ7A 2YMDA 5J5IA 4LMKA 3UU4A 4X5TA 2XZ6A 5L47A 4A97A 4QH4A 2XNTA 2YMEA 3WTIA 3C79A 2BG9E 4AFTA 4QABA 5SYOA 5HCJA 4ILCA 3RQWA 3UU8A 2XQ8A 2PGZA 2WZYA 3UQ4A 4HQPA 2XQ7A 3ZKRA 2WNLA 3U8JA 3TLUA 3SQ6A 2LKGA 2LM2A 4AFGA 2ZJUA 3EI0A 2WN9A 3U8NA 5J0ZA 5HCMA 4DBMA 3P4WA 4HFIA 2BYSA 5AFNA 4NPPA 4EZ1A 1UW6A 2XQ9A 3JADA 4QH5A 5IUXA 2XZ5A 5AFHA 5AINA 3SH1A 3U8KA 2XQAA 3LSVA 3WTHA 5BW2A 2YN6A 1OEDA 2BR7A 4D01A 4ZRUA 2BYQA 5CO5A 4ZJSA 4HFCA 4HFBA 2M6IA 1OEDC 4WV9A 5JMEA 5LXBA 3WIPA 4HFDA 4ILAA 2BR8A 3TLTA 2W8GA 2ZJVA 4PIRA 4F8HA 5HEHA 2XNUA 4ZK4A 5BP0A 4TNVA 2XNVA 4UY2A 4HFEA 2XQ3A 4ZZCA 4Z90A 5AFMB 5AFKA 5AFMA 3EAMA 4ZR6A 3SQ9A 4Z91A 2Y58A 3UU5A 4BQTA 3PEOA 2XQ4A 3C84A 2Y56A 2Y54A 2WNCA 2VL0A 5HEGA 3RQUA 5CFBA 1OEDB 4FRRA 4ZK1A 4TWDA 2XYSA 5J5HA 4UM3S 5J5FA 3RIFA 3WTLA 5KZUA 1I9BA 3GUAA 4A98A 3WTNA 3WTJA 5AFLA 3JAFA 3UUBA 5FJVA 3JAEA 5KE4A 3TLSA 2M6BA 5BRXA 5HEUA 3SIOA 2YOEA 4HFHA 5J5GA 1UV6A 5TVCA 3T4MA 2Y57A 4TNWA 2QC1B 2Y7YA 3IGQA 1UX2A 3TLVA 5HEJA 2WNJA 3ZDHA 2BG9A 3EHZA 3RIAA 4BFQA 4NZBA 2C9TA 3TLWA 2MAWA 2LKHA 5HEOA 4UXUA 4LMLA
chains in the Genus database with same CATH superfamily
1MMGA 2HN2A 4TWHA 5EK4A 3WTKA 2K9AA 2NR4A 2CBIA 4ZZBA 4EZ4A 1KF6A 2WZIA 3LFMA 4CI3B 1CUNA 2CMRA 4IL9A 2FJEA 2Y48B 4FJOA 5KDMC 3AB3B 3JCFA 3SOLA 1WR0A 3RC3A 4O4HE 4X62T 3AXJB 2XNTA 4TV8E 2UXDT 4UEMA 2XQ8A 4YT0A 4ZI3C 3ZKRA 3MACA 4H9RC 5AQUB 1D1BA 2W67A 3PU3A 3FZHB 3PDYA 2E8IA 4DUYT 1EZ3A 2V6YA 3RRWA 3QK6A 3RGLA 3CX8B 3NBXX 3LSVA 2A2FX 2QGSA 5C3JA 4X1KE 4WV9A 2KWHA 2M6IA 3UUMA 1UCUA 2ZMAA 3U3IA 4ILAA 5LHHB 2XNUA 5FNVE 5ABGA 4JEHB 3J9X1 3AAAB 1E7PA 5CA0E 3CVRA 5HXEA 1QUUA 2VL8A 5FJVA 5HEUA 2YOEA 4TN7B 3IGQA 4AKRB 1J5ET 3VKHA 5HEJA 2XY8B 2VVNA 3AXJA 2JMHA 3KVAA 3PUSA 2V5DA 4B5DA 3EABA 3K3QC 3RKGA 1IJ5A 3LK42 1UGOA 3MA9A 5J1GA 3F31A 2OA5A 4NXMT 4UF0A 5JDQA 1HTJF 4IDNA 5IWAT 1VOMA 2HN1A 2WP9A 4QKNA 5L4EA 5J2TE 2XQ6A 3N9LA 3UU4A 4UXNB 1FMWA 4QH4A 3PU8A 2H3RA 2BG9E 5LOVE 4AQFA 4QXBB 2Z6EA 5KXJA 4DBMA 1YKHB 1HG2A 3UULA 2LRKA 4L9IA 4DMVA 5JH7E 5TAOA 5CO5A 3ZJ2A 2C5JA 2NP9A 3NRXA 5F8PA 4MFRA 5L2LA 1YXRA 4UELA 4P0AA 2XZEA 3PEOA 1G8XA 1YQ3A 3R6NA 1T98A 1G73A 4HWFA 1LVKA 3PTRB 1N36T 1HX1B 2X68A 1BR2A 4HFHA 2XPKA 3ZMVB 5ABFA 4O4JE 2WNJA 3ZDHA 3AE9A 5GONE 4ASKA 4CZZB 1VCSA 4UV9B 3CX7B 3ETUA 4QHOA 4EV6A 5FY1A 4IDQA 5F3JA 3OBVE 2PH9A 5AFJA 3RLFF 2LEHA 4I0UA 4QXHB 4PK5A 4OX9T 4K0KT 2NW8A 4PJNA 4B3RT 5JREA 3E22E 2F4VT 1Y01A 4DV1T 5M4YA 2WAUA 2FJDA 3AE5A 2BS4A 5ETWA 2XASB 5JDFA 4KHZF 1UW6A 3AE4A 2X66A 2E9XC 4I43B 2MTQA 4GIWA 2CWOA 1J1JA 4HFBA 5JMEA 2CHOA 4YTMA 3SS1A 4HFEA 1I94T 5JTGA 3CIRA 3IF8B 3RYIE 5KZUA 2E9XD 4H9OC 1N34T 4LF5T 2XSAA 2HPJA 2UXNB 4DV0T 4PAGA 3PUWF 4IL4A 2XJ7A 3VR8A 2JIWA 2N9DA 4CI2B 5H6QB 4B6XA 3KVBA 2WM9A 4JEUB 4YHJA 4DBQA 2L3LA 2I6HA 2WMNA 4U2YA 5L3DB 1U4QA 1GQEA 3T1YT 2ZM2A 3HA4A 3UQ7A 2G0UA 3IHRA 2JQQA 5AQFB 4QABA 4ZEYA 4ILCA 2ZJUA 2WN9A 2WSSV 3V5UA 3UFEA 3CQCB 3FXEB 2E2AA 4Z8XA 3KV4A 3GN5A 5HWYA 5LCYA 2BYQA 4AISA 2UXBT 4YHHT 3L8RA 3EDUA 2LE8A 4HWIB 4PNIA 2UUBT 4AI6A 4Z90A 2D0UA 3Q2MA 1XDOA 3OYZA 4BQTA 2W4XA 3AA0B 4UF0B 1XMQT 2CA5A 2L9QA 2X9XA 5JR9C 3GN5B 5IYZE 3CKDA 1I9BA 3ZT6A 5KX5E 5BRXA 2LSIA 5JDNA 3FZKB 4PJJA 3ZMZB 3N9QA 3MZKB 3U8KA 3AEDA 2KSRA 4IDZA 4G2AA 3UU6A 2D2SA 4ANJA 4B3MT 2Q9QA 4NUUA 2V7LA 4YTPA 3DJBA 1MNDA 4XK9A 3BQLA 1D0ZA 2UUAT 4ILBA 5LMUT 3NZQA 5L3BB 2BYPA 2BYNA 3WTOA 3M3ZB 2FJAA 3HL6A 4EB6E 3PUXF 1E2AA 2Q9QD 5HXHA 4OFZA 3U78A 4LFBT 5SYOA 2KLQA 2V6YB 5JDHA 3EI0A 5HCMA 1HCIA 1BR1A 4OK0A 4JI1T 2DLRA 2EHOD 2XUEA 2IDOB 4PIRA 3LG7A 3HR0A 2NOXA 5ADXL 3DTOA 2LHRA 3SQ9A 4OHFA 4NIQA 1T7SA 2K24A 2H88A 2Y56A 1X9BA 2WU2A 3RQUA 1FJGT 5J5FA 4A98A 2RA1A 3LDQB 1KNZA 5DABA 3RKOA 2EHOA 3E0ZA 4I4TE 4M1PA 4TNWA 2NTYA 1YW0A 3TLWA 3Q5WA 3F2EA 3N9NA 3KDSE 4XAXB 3LK2B 2X9YA 4LF6T 4EYUA 2VURA 3SWHA 4H9QC 2FBWA 1YKEB 4KBMB 2FUPA 5LHGB 1ZP0A 3FXDB 3P50A 1QSDA 2XQ5A 5FXVA 5LA6E 2AXDS 3WTIA 3C79A 5C2TA 1VCTA 2NTXA 5LJNA 4IGUA 1BR0A 3ZN0B 4EEBA 3HI2A 3TLUA 3K3OA 3ZN1B 3K8PC 3JADA 1XDPA 5AFHA 3OYXA 3QB5K 2XQAA 5AQQB 4DNDA 5JRCB 2BR8A 5JQGE 3OPCA 2H7VC 4P1NA 1US7B 3ZEFB 2DNXA 3EDVA 5FP3A 2VKOA 3Q5EA 1FEWA 4MLKA 3AEFA 5ABFB 5HYAA 3PUGA 2H7OA 3WTLA 3BQKA 2V7JA 4WYVA 2BS3A 1NWMX 3JAEA 2CRBA 2XQYA 2VQFT 2V7IA 1T72A 3MK7C 4E7ZA 5TVCA 3T4MA 2Y57A 1HFAA 4GYRA 2QC1B 3AVSA 3CK6A 4JI2T 5AQSB 5HEOA 4GKJT 5FXZA 2K48A 4DR4T 5ABEA 1IZNB 1O3XA 4UVCB 4H9NC 3PMZA 2BKOA 2UUCT 3PJAA 4OYJA 2VQET 5LG3A 2E5VA 3UFGA 2CEAA 4QAAA 1B7TA 4KHPT 5LP6E 2JQKA 3E08A 4EYYR 1HX8A 3L09A 4CN4A 2CXFA 2JRKA 3RQWA 4HQPA 3ETVA 4EGWA 4DV5T 2B76A 1NAFA 2CHNA 4U31A 4HFIA 2LSKA 2BZBA 2C5IT 2B1EA 3CPZA 5AINA 5L3CB 2IHR1 3ABVA 2WY2A 5A1LA 4ZRUA 3PUZF 5AQMB 1W0AA 5DQVA 4HWHA 4JYAT 5FXWA 4DR6T 4WNKA 3AA7B 4IDOA 1UURA 1IBKT 5ABHA 1I6ZA 2Y54A 5KMGP 3IA3A 1XWMA 4UM3S 3ONXA 3GUAA 2K5BB 1FMVA 5LXTE 3KINB 4Q25A 2X0YA 2W2UA 3C4WA 4PFPA 2DL1A 2YDSA 4IE6A 4HKAA 4DV7T 2C9TA 2W61A 2X00D 4UM3A 4U72A 4LF4T 2XAQB 5H6RB 4YSYA 2BKPA 4BJMA 2SPCA 4ZI7E 3KV9A 1L0VA 3ZLIA 1KK7A 2HH7A 2LSJA 1LVFA 3PJAJ 2GK9A 3UTKA 2XQ7A 2W62A 1XNQT 3DP7A 4MBQA 3WAKA 4PK6A 5J0ZA 2VB6A 1QLBA 2ZM0A 2X9HA 2NWBA 3NZPA 4NXNT 4UV8B 3WTHA 5LG4A 3BQIA 1OEDC 4HE8A 3RYCE 5BP0A 5HEHA 2WU5A 3CWZB 4QX8B 3MKDA 4ZOLE 4F6RC 5AQKB 2J62A 2XTLA 1UX4A 3OKQA 3PUAA 1MNEA 1KNRA 5C8YE 3HKDE 2LOPA 5FYMA 2X0HA 3GWHA 5LGTB 3B13A 1SA0E 4L5GA 2MBGA 1UX2A 3F57A 4CXXA 3RIAA 2WB5A 5J2UE 1HNXT 5AFKA 2ACZA 3C4ZA 4JI7T 4O2BE 3B57A 5LJMA 3HKEE 3ZDGA 1KFYA 4IE0A 3MXZA 1HNWT 2RPAA 4G63A 2D5UA 2D0TA 2UZ6A 4B3TT 5AQHB 1IBLT 5JDGA 4U7YA 4XHEA 2W8FA 2CLYC 3ZCJA 3W15B 3PUQA 2HPLA 5J5IA 4LMKA 4X5TA 2KZ7B 1ZKEA 2CPTA 2WDRA 4IE5A 4HN9A 3VKGA 2YDRA 3B5MA 1MIYA 1D0YA 3T1HT 5HXCA 1H7CA 5AQTB 3X1DA 5FL1A 2X9WA 2WMOA 3L39A 2M67A 2VWAA 2FJBA 2J1DG 4AKHA 3TLTA 3TKLB 4ZK4A 2BKNA 5EK3A 5AFMB 4QX7B 4AQYT 2VASA 3KV6A 1IAPA 4KX6A 5FMNA 3RPUA 4TZ4C 1BR4A 4IE7A 3C84A 2WNCA 4AIUA 3AEEA 3IEEA 3Q5XA 4H63V 4ZK1A 1S35A 3AEBA 1JNZA 1XZYA 2PBIA 3AE7A 4ZI3D 3C64A 1IBMT 4JI4T 2ACXA 1HS7A 2J4GA 2C0SA 1X79A 5CJ5A 5JVDE 3PUYF 3VRAA 2IIUA 2NW7A 2NW9A 2MAWA 2CXLA 2AE9A 3ZYMA 4AKGA 2BBHA 2XM1A 4DR7T 2I59A 3OVUA 4COFA 4IDPA 3AA6B 4DBRA 3NWIA 3K3NA 2R6GF 3AA1B 3WAJA 4JI5T 1KEYA 3LJCA 4J2CA 3P4PA 4UM3P 5EK2A 4GK5E 2V5CA 4E7SA 1UX5A 4DMWA 3RYFE 3C98B 4YTNA 2YKSA 4ZI2C 2RP4A 5AQOB 3A5XA 4CQIA 4JI8T 4X66T 2MPKA 4LF8T 4H63H 3A7MA 3O4XE 2XSBA 2LOSA 4AXPA 3P4WA 2BDEA 2VKJA 4EIWA 4JLEA 4QH5A 5IUXA 3P8CD 3FZFB 3RF1A 4YY3T 4MHCA 5CA1E 5LXBA 1WR6A 2CWYA 3WIPA 4LF7T 2YEVC 4AKLA 5LB7B 4LFAT 3EAMA 3J7Yq 2XQ4A 3A8YC 4P09A 3SFEA 4ZI2D 4CI1B 4JUYA 2XYSA 2YDQA 4YLHA 3OTOT 3WTNA 2V8SV 1AJ3A 3VHLA 3JAFA 2DWKA 3N5LA 2X51A 3GA8A 3MJXA 4UR9A 2WBLA 3EHZA 4BFQA 4NZBA 5LMNT 2LRLA 4UXUA 4ZJTA 3T8OA 3AE8A 3RC8A 1T8BA 1D1CA 2W63A 3HKBE 3H3MA 3AAEB 4DV3T 3C50A 2XAJB 4ILUA 2CXDA 3P4QA 4ISSA 5FY7A 2LSYA 4B3ST 4GYSA 2C5KT 3AE2A 2KWIB 2ZM8A 1N33T 1M7KA 4ZXLA 4HWDA 2ES0A 1Z8UA 2KINB 4X1IE 5L47A 2V6XA 1FIOA 3AEGA 1CHUA 4PFOA 5HXRA 4UVAB 3SQ6A 2LKGA 2LM2A 3GMIA 1WYBA 1N32T 3RH3A 4NPPA 1VRBA 3I1AA 2KNDA 4O4IE 2OLTA 1SHZC 4ERRA 3CQXC 1D1AA 3WI3A 3O9XA 1MMDA 4D01A 4AQFC 2YU2A 2A72A 3QOFA 5EZYE 1S94A 4L0RA 2ZJVA 2XNVA 5AFMA 3ZT7A 4I50E 2MOZA 1M62A 3UU5A 5JR9B 2UU9T 5LGNB 2QA7A 2XAFB 5CFBA 3EUHA 3H37A 4GK0E 5AFLA 4YXDA 2JPFA 2UXCT 5HAXA 5KE4A 2I0MA 3QUJA 4KUMB 1XNRT 5AQIB 3PURA 2QRXA 5J5GA 5HWXA 3TLVA 4WZXA 4LF9T 5FVLA 3VU7H 4X20E 1MIWA 1HR0T 1W09A 4EAHA 2BG9B 2XAHB 3OJAA 2P9BA 1YD8G 2WWVA 3CX6B 4C91A 3ZT5A 3AECA 3P4SA 3ZMTB 5DQWA 4ZS3A 4ISTA 4BA9A 1Y64B 1OEDE 4AQGA 3U8MA 4XBFB 4H9PC 4X1YE 3WTMA 4UVBB 5JR9A 5F5WA 2DCFA 3C51A 2H89A 5LBMA 4XZCA 3RIUA 2WNLA 4AFGA 5AFNA 2WQYA 4EZ1A 2XZ5A 4WBOA 4DO0A 5BW2A 2LT3A 2YN6A 3VR9A 4HFCA 5FXXA 3RX6A 4KP3C 5CB4E 4HFDA 2V1DB 1WYCA 5FVKA 2Y58A 3N2GE 4BAYB 3AVRA 3BK9A 5LHIB 2VL0A 4HEAA 2L8KA 2N2NA 3RIFA 5HXSA 2ZM6T 2Y6XA 4U2ZA 1IJ6A 2VVSA 4JV5T 5AQNB 3ZC0A 5AQRB 2EHOB 4PJLA 4AFHA 5AQVB 4DV6T 3ZSSA 3N9PA 1UUSA 1WRDA 4A56A 2BS2A 2YU1A 4ZS2A 3UU3A 5BMVE 5CGMA 5DJQC 1ZEEA 2KMFA 2E5LT 1ZHCA 2LLYA 3NVOA 2LHNA 3C4XA 2OV9A 2CLYB 1J5WA 2JQ9A 3RI5A 3I0OA 2XYTA 4ALXA 4DR5T 3N9OA 4QACA 2V7MA 4WBNE 3KBUA 2V7KA 5FL0A 2E9XA 2PGZA 2WZYA 2ZLYA 4IT4A 1HG5A 1MMAA 3ZJ1A 2WDQA 2K3WA 3U8NA 3FBLA 2YK0A 5LYJE 4YSZA 2XQ9A 3I9WA 2ODUA 3CQGB 4BJNA 5FKYA 4TX5A 4CN6A 3ZC1A 4DIDB 4P0BA 4DVDA 3ONLC 4TNVA 2W0GA 5HEGA 2Q9QC 3HKCE 3P7IA 2Q9QB 4FI5A 3WTJA 5E0OA 4I55E 3NKZA 3O1JA 4DR1T 3AE6A 3RIUC 4JBWF 2ODVA 2W66A 3FZMB 1SE7A 2LKHA 4QXCB 4IREA 4O2AE 4C90A 4WW0A 2IC9A 4HGAA 2XM2A 2BYRA 4DV2T 3PE0A 3I9YA 4IE4A 3EVYA 2D9DA 3RHWA 2E9XB 3LBXB 2BVMA 2QYWA 2LJLA 2BVLA 4AFTA 2IC6A 4HTEA 1DU2A 5LNKA 4K0UA 3FHNA 4U3CA 1KNPA 4U33A 4JI0T 2CE7A 2IMLA 2BBJA 1OEDA 2BR7A 4KI0F 3UT5E 2IAKA 3QB5A 3UUNA 2A3DA 4DUZT 2MYSA 2WCAA 3Q5DA 3L3PA 4AKIA 4LFCT 1OEDB 2EHOC 2JQHA 2VKHA 3UUBA 3ZPOA 3QNUA 2M6BA 2V26A 1NENA 4X64T 4U74A 5LGUB 2WZHA 5LBQB 3RYHE 4LMLA 3PUVF 2WDVA 5L4HA 3LBXA 2N1GA 4A5XA 5FY0A 2KXPB 4EOZB 2DHRA 2Y8DA 2PJQA 3AE3A 3N9MA 4O4LE 4TWFA 1WFDA 4QH1A 4PJMA 4TUYE 5AQGB 2BJ0A 5L3GB 2PG8A 1Z0PA 2BG9C 2PFVA 4X65T 3U8LA 3ZSTA 2LSGA 2YMDA 4O8SA 2YMEA 3RRCA 1V9DA 3ANWA 5HCJA 1SUMB 5AFUL 5JDLA 3UQ4A 3U8JA 3ZYKA 1NEKA 1R8IA 2UXXB 1MMNA 5JRCA 4MALA 2DWGA 4GKKT 3SH1A 3FB2A 3O1IA 2IUBA 1D0XA 4YSXA 3FBZA 1U5PA 3IBPA 2W8GA 4F8HA 4DV4T 4ADZA 2WWUA 4UY2A 2QVAA 2XQ3A 4ZZCA 5AQJB 3VRBA 3FZLB 4U7IA 4Z91A 1W0BA 5JDMA 4CXWA 5AQPB 3K1SA 4QWNB 2LM9A 4TWDA 2JMKA 2XHEB 5J5HA 3P4RA 3ZMUB 3TLSA 2J47A 1UK5A 4CN1A 3G06A 1UV6A 3ZYLA 2BG9A 4GOUA 1E1HB 1ZOYA 4IHJE 3R84B 2WS3A 3ESLA 2IW5B 2PTFA 3ONJA 2X00A 2VK9A 1HNZT 4KMCA 3UUXB 2CCQA 3JC6C 4UM1A 2YINA 4DR2T 2DI4A 1JNRA 3O1HA 3H3AA 4LMJA 4EEDA 3AEAA 3I0QA 3D0TA 4EXTA 2XZ6A 2CM0A 3KFWX 4A97A 4DR3T 2JJ9A 3KV5A 1YQ4A 3NRYA 4N78D 3UU8A 1W9RA 4JI6T 5BR8T 1MIVA 4PK4A 1WCRA 3JC6D 4PW8A 2VKDA 2BYSA 5L3FB 4OYKA 1LKXA 2CBJA 4ZHQE 3SRZA 2HHHT 1LRZA 5L3EB 3M65A 1OXZA 4JI3T 3V5SA 3S4UA 2XAGB 3PV0F 4TV9E 4IIJE 4ZJSA 2X67A 1WLXA 2W00A 3ANWB 4ZR6A 4YFSA 3N2OA 2A9UA 3N2KE 3KBTA 4V1Av 3LK3B 4EZHA 4H9SE 5IHYA 4YJ3E 4FRRA 4HFVA 5AQLB 3SFDA 2KT9A 3QC9A 1HF8A 4YJ2E 4HWCA 4CXYA 3Q9DA 3ZMSB 3SIOA 1ZV4X 4UIGA 2X0LB 4NUVA 2Y7YA 3ZCIA 3CMLA 3AAIA 3AE1A 1XMOT 1OWAA
chains in the Genus database with same CATH topology
4IL4A 4ZJTA 4B5DA 4AFHA 3UU6A 4TWHA 4IREA 3WTKA 2BG9B 3PMZA 5L4HA 4ZZBA 2X00A 3ZDGA 2X00D 4UM3A 4COFA 3UU3A 2KSRA 2PH9A 5AFJA 4IL9A 5LG3A 2UZ6A 4XK9A 4ILBA 4UM1A 2BYRA 2LLYA 4TWFA 2BYPA 4UM3P 1OEDE 4QH1A 2BYNA 4QAAA 3WTOA 3U8MA 2BJ0A 2BG9C 3RI5A 5L4EA 3WTMA 3RHWA 3P50A 2XQ6A 2XYTA 4LMJA 4ALXA 4XHEA 2W8FA 3U8LA 2XQ5A 4QACA 2YKSA 3UQ7A 2YMDA 5J5IA 4LMKA 3UU4A 4X5TA 2XZ6A 5L47A 4A97A 4QH4A 2XNTA 2YMEA 3WTIA 3C79A 2BG9E 4AFTA 4QABA 5SYOA 5HCJA 4ILCA 3RQWA 3UU8A 2XQ8A 2PGZA 2WZYA 3UQ4A 4HQPA 2XQ7A 3ZKRA 2WNLA 3U8JA 3TLUA 3SQ6A 2LKGA 2LM2A 4AFGA 2ZJUA 3EI0A 2WN9A 3U8NA 5J0ZA 5HCMA 4DBMA 3P4WA 4HFIA 2BYSA 5AFNA 4NPPA 4EZ1A 1UW6A 2XQ9A 3JADA 4QH5A 5IUXA 2XZ5A 5AFHA 5AINA 3SH1A 3U8KA 2XQAA 3LSVA 3WTHA 5BW2A 2YN6A 1OEDA 2BR7A 4D01A 4ZRUA 2BYQA 5CO5A 4ZJSA 4HFCA 4HFBA 2M6IA 1OEDC 4WV9A 5JMEA 5LXBA 3WIPA 4HFDA 4ILAA 2BR8A 3TLTA 2W8GA 2ZJVA 4PIRA 4F8HA 5HEHA 2XNUA 4ZK4A 5BP0A 4TNVA 2XNVA 4UY2A 4HFEA 2XQ3A 4ZZCA 4Z90A 5AFMB 5AFKA 5AFMA 3EAMA 4ZR6A 3SQ9A 4Z91A 2Y58A 3UU5A 4BQTA 3PEOA 2XQ4A 3C84A 2Y56A 2Y54A 2WNCA 2VL0A 5HEGA 3RQUA 5CFBA 1OEDB 4FRRA 4ZK1A 4TWDA 2XYSA 5J5HA 4UM3S 5J5FA 3RIFA 3WTLA 5KZUA 1I9BA 3GUAA 4A98A 3WTNA 3WTJA 5AFLA 3JAFA 3UUBA 5FJVA 3JAEA 5KE4A 3TLSA 2M6BA 5BRXA 5HEUA 3SIOA 2YOEA 4HFHA 5J5GA 1UV6A 5TVCA 3T4MA 2Y57A 4TNWA 2QC1B 2Y7YA 3IGQA 1UX2A 3TLVA 5HEJA 2WNJA 3ZDHA 2BG9A 3EHZA 3RIAA 4BFQA 4NZBA 2C9TA 3TLWA 2MAWA 2LKHA 5HEOA 4UXUA 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL4 A;  4ZJT A;  4B5D A;  4AFH A;  3UU6 A;  4TWH A;  4IRE A;  3WTK A;  2BG9 B;  3PMZ A;  5L4H A;  4ZZB A;  2X00 A;  3ZDG A;  2X00 D;  4UM3 A;  4COF A;  3UU3 A;  2KSR A;  2PH9 A;  5AFJ A;  4IL9 A;  5LG3 A;  2UZ6 A;  4XK9 A;  4ILB A;  4UM1 A;  2BYR A;  2LLY A;  4TWF A;  2BYP A;  4UM3 P;  1OED E;  4QH1 A;  2BYN A;  4QAA A;  3WTO A;  3U8M A;  2BJ0 A;  2BG9 C;  3RI5 A;  5L4E A;  3WTM A;  3RHW A;  3P50 A;  2XQ6 A;  2XYT A;  4LMJ A;  4ALX A;  4XHE A;  2W8F A;  3U8L A;  2XQ5 A;  4QAC A;  2YKS A;  3UQ7 A;  2YMD A;  5J5I A;  4LMK A;  3UU4 A;  4X5T A;  2XZ6 A;  5L47 A;  4A97 A;  4QH4 A;  2XNT A;  2YME A;  3WTI A;  3C79 A;  2BG9 E;  4AFT A;  4QAB A;  5SYO A;  5HCJ A;  4ILC A;  3RQW A;  3UU8 A;  2XQ8 A;  2PGZ A;  2WZY A;  3UQ4 A;  4HQP A;  2XQ7 A;  3ZKR A;  2WNL A;  3U8J A;  3TLU A;  3SQ6 A;  2LKG A;  2LM2 A;  4AFG A;  2ZJU A;  3EI0 A;  2WN9 A;  3U8N A;  5J0Z A;  5HCM A;  4DBM A;  3P4W A;  4HFI A;  2BYS A;  5AFN A;  4NPP A;  4EZ1 A;  1UW6 A;  2XQ9 A;  3JAD A;  4QH5 A;  5IUX A;  2XZ5 A;  5AFH A;  5AIN A;  3SH1 A;  3U8K A;  2XQA A;  3LSV A;  3WTH A;  5BW2 A;  2YN6 A;  1OED A;  2BR7 A;  4D01 A;  4ZRU A;  2BYQ A;  5CO5 A;  4ZJS A;  4HFC A;  4HFB A;  2M6I A;  1OED C;  4WV9 A;  5JME A;  5LXB A;  3WIP A;  4HFD A;  4ILA A;  2BR8 A;  3TLT A;  2W8G A;  2ZJV A;  4PIR A;  4F8H A;  5HEH A;  2XNU A;  4ZK4 A;  5BP0 A;  4TNV A;  2XNV A;  4UY2 A;  4HFE A;  2XQ3 A;  4ZZC A;  4Z90 A;  5AFM B;  5AFK A;  5AFM A;  3EAM A;  4ZR6 A;  3SQ9 A;  4Z91 A;  2Y58 A;  3UU5 A;  4BQT A;  3PEO A;  2XQ4 A;  3C84 A;  2Y56 A;  2Y54 A;  2WNC A;  2VL0 A;  5HEG A;  3RQU A;  5CFB A;  1OED B;  4FRR A;  4ZK1 A;  4TWD A;  2XYS A;  5J5H A;  4UM3 S;  5J5F A;  3RIF A;  3WTL A;  5KZU A;  1I9B A;  3GUA A;  4A98 A;  3WTN A;  3WTJ A;  5AFL A;  3JAF A;  3UUB A;  5FJV A;  3JAE A;  5KE4 A;  3TLS A;  2M6B A;  5BRX A;  5HEU A;  3SIO A;  2YOE A;  4HFH A;  5J5G A;  1UV6 A;  5TVC A;  3T4M A;  2Y57 A;  4TNW A;  2QC1 B;  2Y7Y A;  3IGQ A;  1UX2 A;  3TLV A;  5HEJ A;  2WNJ A;  3ZDH A;  2BG9 A;  3EHZ A;  3RIA A;  4BFQ A;  4NZB A;  2C9T A;  3TLW A;  2MAW A;  2LKH A;  5HEO A;  4UXU A;  4LML A; 
#chains in the Genus database with same CATH topology
 1MMG A;  2HN2 A;  4TWH A;  5EK4 A;  3WTK A;  2K9A A;  2NR4 A;  2CBI A;  4ZZB A;  4EZ4 A;  1KF6 A;  2WZI A;  3LFM A;  4CI3 B;  1CUN A;  2CMR A;  4IL9 A;  2FJE A;  2Y48 B;  4FJO A;  5KDM C;  3AB3 B;  3JCF A;  3SOL A;  1WR0 A;  3RC3 A;  4O4H E;  4X62 T;  3AXJ B;  2XNT A;  4TV8 E;  2UXD T;  4UEM A;  2XQ8 A;  4YT0 A;  4ZI3 C;  3ZKR A;  3MAC A;  4H9R C;  5AQU B;  1D1B A;  2W67 A;  3PU3 A;  3FZH B;  3PDY A;  2E8I A;  4DUY T;  1EZ3 A;  2V6Y A;  3RRW A;  3QK6 A;  3RGL A;  3CX8 B;  3NBX X;  3LSV A;  2A2F X;  2QGS A;  5C3J A;  4X1K E;  4WV9 A;  2KWH A;  2M6I A;  3UUM A;  1UCU A;  2ZMA A;  3U3I A;  4ILA A;  5LHH B;  2XNU A;  5FNV E;  5ABG A;  4JEH B;  3J9X 1;  3AAA B;  1E7P A;  5CA0 E;  3CVR A;  5HXE A;  1QUU A;  2VL8 A;  5FJV A;  5HEU A;  2YOE A;  4TN7 B;  3IGQ A;  4AKR B;  1J5E T;  3VKH A;  5HEJ A;  2XY8 B;  2VVN A;  3AXJ A;  2JMH A;  3KVA A;  3PUS A;  2V5D A;  4B5D A;  3EAB A;  3K3Q C;  3RKG A;  1IJ5 A;  3LK4 2;  1UGO A;  3MA9 A;  5J1G A;  3F31 A;  2OA5 A;  4NXM T;  4UF0 A;  5JDQ A;  1HTJ F;  4IDN A;  5IWA T;  1VOM A;  2HN1 A;  2WP9 A;  4QKN A;  5L4E A;  5J2T E;  2XQ6 A;  3N9L A;  3UU4 A;  4UXN B;  1FMW A;  4QH4 A;  3PU8 A;  2H3R A;  2BG9 E;  5LOV E;  4AQF A;  4QXB B;  2Z6E A;  5KXJ A;  4DBM A;  1YKH B;  1HG2 A;  3UUL A;  2LRK A;  4L9I A;  4DMV A;  5JH7 E;  5TAO A;  5CO5 A;  3ZJ2 A;  2C5J A;  2NP9 A;  3NRX A;  5F8P A;  4MFR A;  5L2L A;  1YXR A;  4UEL A;  4P0A A;  2XZE A;  3PEO A;  1G8X A;  1YQ3 A;  3R6N A;  1T98 A;  1G73 A;  4HWF A;  1LVK A;  3PTR B;  1N36 T;  1HX1 B;  2X68 A;  1BR2 A;  4HFH A;  2XPK A;  3ZMV B;  5ABF A;  4O4J E;  2WNJ A;  3ZDH A;  3AE9 A;  5GON E;  4ASK A;  4CZZ B;  1VCS A;  4UV9 B;  3CX7 B;  3ETU A;  4QHO A;  4EV6 A;  5FY1 A;  4IDQ A;  5F3J A;  3OBV E;  2PH9 A;  5AFJ A;  3RLF F;  2LEH A;  4I0U A;  4QXH B;  4PK5 A;  4OX9 T;  4K0K T;  2NW8 A;  4PJN A;  4B3R T;  5JRE A;  3E22 E;  2F4V T;  1Y01 A;  4DV1 T;  5M4Y A;  2WAU A;  2FJD A;  3AE5 A;  2BS4 A;  5ETW A;  2XAS B;  5JDF A;  4KHZ F;  1UW6 A;  3AE4 A;  2X66 A;  2E9X C;  4I43 B;  2MTQ A;  4GIW A;  2CWO A;  1J1J A;  4HFB A;  5JME A;  2CHO A;  4YTM A;  3SS1 A;  4HFE A;  1I94 T;  5JTG A;  3CIR A;  3IF8 B;  3RYI E;  5KZU A;  2E9X D;  4H9O C;  1N34 T;  4LF5 T;  2XSA A;  2HPJ A;  2UXN B;  4DV0 T;  4PAG A;  3PUW F;  4IL4 A;  2XJ7 A;  3VR8 A;  2JIW A;  2N9D A;  4CI2 B;  5H6Q B;  4B6X A;  3KVB A;  2WM9 A;  4JEU B;  4YHJ A;  4DBQ A;  2L3L A;  2I6H A;  2WMN A;  4U2Y A;  5L3D B;  1U4Q A;  1GQE A;  3T1Y T;  2ZM2 A;  3HA4 A;  3UQ7 A;  2G0U A;  3IHR A;  2JQQ A;  5AQF B;  4QAB A;  4ZEY A;  4ILC A;  2ZJU A;  2WN9 A;  2WSS V;  3V5U A;  3UFE A;  3CQC B;  3FXE B;  2E2A A;  4Z8X A;  3KV4 A;  3GN5 A;  5HWY A;  5LCY A;  2BYQ A;  4AIS A;  2UXB T;  4YHH T;  3L8R A;  3EDU A;  2LE8 A;  4HWI B;  4PNI A;  2UUB T;  4AI6 A;  4Z90 A;  2D0U A;  3Q2M A;  1XDO A;  3OYZ A;  4BQT A;  2W4X A;  3AA0 B;  4UF0 B;  1XMQ T;  2CA5 A;  2L9Q A;  2X9X A;  5JR9 C;  3GN5 B;  5IYZ E;  3CKD A;  1I9B A;  3ZT6 A;  5KX5 E;  5BRX A;  2LSI A;  5JDN A;  3FZK B;  4PJJ A;  3ZMZ B;  3N9Q A;  3MZK B;  3U8K A;  3AED A;  2KSR A;  4IDZ A;  4G2A A;  3UU6 A;  2D2S A;  4ANJ A;  4B3M T;  2Q9Q A;  4NUU A;  2V7L A;  4YTP A;  3DJB A;  1MND A;  4XK9 A;  3BQL A;  1D0Z A;  2UUA T;  4ILB A;  5LMU T;  3NZQ A;  5L3B B;  2BYP A;  2BYN A;  3WTO A;  3M3Z B;  2FJA A;  3HL6 A;  4EB6 E;  3PUX F;  1E2A A;  2Q9Q D;  5HXH A;  4OFZ A;  3U78 A;  4LFB T;  5SYO A;  2KLQ A;  2V6Y B;  5JDH A;  3EI0 A;  5HCM A;  1HCI A;  1BR1 A;  4OK0 A;  4JI1 T;  2DLR A;  2EHO D;  2XUE A;  2IDO B;  4PIR A;  3LG7 A;  3HR0 A;  2NOX A;  5ADX L;  3DTO A;  2LHR A;  3SQ9 A;  4OHF A;  4NIQ A;  1T7S A;  2K24 A;  2H88 A;  2Y56 A;  1X9B A;  2WU2 A;  3RQU A;  1FJG T;  5J5F A;  4A98 A;  2RA1 A;  3LDQ B;  1KNZ A;  5DAB A;  3RKO A;  2EHO A;  3E0Z A;  4I4T E;  4M1P A;  4TNW A;  2NTY A;  1YW0 A;  3TLW A;  3Q5W A;  3F2E A;  3N9N A;  3KDS E;  4XAX B;  3LK2 B;  2X9Y A;  4LF6 T;  4EYU A;  2VUR A;  3SWH A;  4H9Q C;  2FBW A;  1YKE B;  4KBM B;  2FUP A;  5LHG B;  1ZP0 A;  3FXD B;  3P50 A;  1QSD A;  2XQ5 A;  5FXV A;  5LA6 E;  2AXD S;  3WTI A;  3C79 A;  5C2T A;  1VCT A;  2NTX A;  5LJN A;  4IGU A;  1BR0 A;  3ZN0 B;  4EEB A;  3HI2 A;  3TLU A;  3K3O A;  3ZN1 B;  3K8P C;  3JAD A;  1XDP A;  5AFH A;  3OYX A;  3QB5 K;  2XQA A;  5AQQ B;  4DND A;  5JRC B;  2BR8 A;  5JQG E;  3OPC A;  2H7V C;  4P1N A;  1US7 B;  3ZEF B;  2DNX A;  3EDV A;  5FP3 A;  2VKO A;  3Q5E A;  1FEW A;  4MLK A;  3AEF A;  5ABF B;  5HYA A;  3PUG A;  2H7O A;  3WTL A;  3BQK A;  2V7J A;  4WYV A;  2BS3 A;  1NWM X;  3JAE A;  2CRB A;  2XQY A;  2VQF T;  2V7I A;  1T72 A;  3MK7 C;  4E7Z A;  5TVC A;  3T4M A;  2Y57 A;  1HFA A;  4GYR A;  2QC1 B;  3AVS A;  3CK6 A;  4JI2 T;  5AQS B;  5HEO A;  4GKJ T;  5FXZ A;  2K48 A;  4DR4 T;  5ABE A;  1IZN B;  1O3X A;  4UVC B;  4H9N C;  3PMZ A;  2BKO A;  2UUC T;  3PJA A;  4OYJ A;  2VQE T;  5LG3 A;  2E5V A;  3UFG A;  2CEA A;  4QAA A;  1B7T A;  4KHP T;  5LP6 E;  2JQK A;  3E08 A;  4EYY R;  1HX8 A;  3L09 A;  4CN4 A;  2CXF A;  2JRK A;  3RQW A;  4HQP A;  3ETV A;  4EGW A;  4DV5 T;  2B76 A;  1NAF A;  2CHN A;  4U31 A;  4HFI A;  2LSK A;  2BZB A;  2C5I T;  2B1E A;  3CPZ A;  5AIN A;  5L3C B;  2IHR 1;  3ABV A;  2WY2 A;  5A1L A;  4ZRU A;  3PUZ F;  5AQM B;  1W0A A;  5DQV A;  4HWH A;  4JYA T;  5FXW A;  4DR6 T;  4WNK A;  3AA7 B;  4IDO A;  1UUR A;  1IBK T;  5ABH A;  1I6Z A;  2Y54 A;  5KMG P;  3IA3 A;  1XWM A;  4UM3 S;  3ONX A;  3GUA A;  2K5B B;  1FMV A;  5LXT E;  3KIN B;  4Q25 A;  2X0Y A;  2W2U A;  3C4W A;  4PFP A;  2DL1 A;  2YDS A;  4IE6 A;  4HKA A;  4DV7 T;  2C9T A;  2W61 A;  2X00 D;  4UM3 A;  4U72 A;  4LF4 T;  2XAQ B;  5H6R B;  4YSY A;  2BKP A;  4BJM A;  2SPC A;  4ZI7 E;  3KV9 A;  1L0V A;  3ZLI A;  1KK7 A;  2HH7 A;  2LSJ A;  1LVF A;  3PJA J;  2GK9 A;  3UTK A;  2XQ7 A;  2W62 A;  1XNQ T;  3DP7 A;  4MBQ A;  3WAK A;  4PK6 A;  5J0Z A;  2VB6 A;  1QLB A;  2ZM0 A;  2X9H A;  2NWB A;  3NZP A;  4NXN T;  4UV8 B;  3WTH A;  5LG4 A;  3BQI A;  1OED C;  4HE8 A;  3RYC E;  5BP0 A;  5HEH A;  2WU5 A;  3CWZ B;  4QX8 B;  3MKD A;  4ZOL E;  4F6R C;  5AQK B;  2J62 A;  2XTL A;  1UX4 A;  3OKQ A;  3PUA A;  1MNE A;  1KNR A;  5C8Y E;  3HKD E;  2LOP A;  5FYM A;  2X0H A;  3GWH A;  5LGT B;  3B13 A;  1SA0 E;  4L5G A;  2MBG A;  1UX2 A;  3F57 A;  4CXX A;  3RIA A;  2WB5 A;  5J2U E;  1HNX T;  5AFK A;  2ACZ A;  3C4Z A;  4JI7 T;  4O2B E;  3B57 A;  5LJM A;  3HKE E;  3ZDG A;  1KFY A;  4IE0 A;  3MXZ A;  1HNW T;  2RPA A;  4G63 A;  2D5U A;  2D0T A;  2UZ6 A;  4B3T T;  5AQH B;  1IBL T;  5JDG A;  4U7Y A;  4XHE A;  2W8F A;  2CLY C;  3ZCJ A;  3W15 B;  3PUQ A;  2HPL A;  5J5I A;  4LMK A;  4X5T A;  2KZ7 B;  1ZKE A;  2CPT A;  2WDR A;  4IE5 A;  4HN9 A;  3VKG A;  2YDR A;  3B5M A;  1MIY A;  1D0Y A;  3T1H T;  5HXC A;  1H7C A;  5AQT B;  3X1D A;  5FL1 A;  2X9W A;  2WMO A;  3L39 A;  2M67 A;  2VWA A;  2FJB A;  2J1D G;  4AKH A;  3TLT A;  3TKL B;  4ZK4 A;  2BKN A;  5EK3 A;  5AFM B;  4QX7 B;  4AQY T;  2VAS A;  3KV6 A;  1IAP A;  4KX6 A;  5FMN A;  3RPU A;  4TZ4 C;  1BR4 A;  4IE7 A;  3C84 A;  2WNC A;  4AIU A;  3AEE A;  3IEE A;  3Q5X A;  4H63 V;  4ZK1 A;  1S35 A;  3AEB A;  1JNZ A;  1XZY A;  2PBI A;  3AE7 A;  4ZI3 D;  3C64 A;  1IBM T;  4JI4 T;  2ACX A;  1HS7 A;  2J4G A;  2C0S A;  1X79 A;  5CJ5 A;  5JVD E;  3PUY F;  3VRA A;  2IIU A;  2NW7 A;  2NW9 A;  2MAW A;  2CXL A;  2AE9 A;  3ZYM A;  4AKG A;  2BBH A;  2XM1 A;  4DR7 T;  2I59 A;  3OVU A;  4COF A;  4IDP A;  3AA6 B;  4DBR A;  3NWI A;  3K3N A;  2R6G F;  3AA1 B;  3WAJ A;  4JI5 T;  1KEY A;  3LJC A;  4J2C A;  3P4P A;  4UM3 P;  5EK2 A;  4GK5 E;  2V5C A;  4E7S A;  1UX5 A;  4DMW A;  3RYF E;  3C98 B;  4YTN A;  2YKS A;  4ZI2 C;  2RP4 A;  5AQO B;  3A5X A;  4CQI A;  4JI8 T;  4X66 T;  2MPK A;  4LF8 T;  4H63 H;  3A7M A;  3O4X E;  2XSB A;  2LOS A;  4AXP A;  3P4W A;  2BDE A;  2VKJ A;  4EIW A;  4JLE A;  4QH5 A;  5IUX A;  3P8C D;  3FZF B;  3RF1 A;  4YY3 T;  4MHC A;  5CA1 E;  5LXB A;  1WR6 A;  2CWY A;  3WIP A;  4LF7 T;  2YEV C;  4AKL A;  5LB7 B;  4LFA T;  3EAM A;  3J7Y q;  2XQ4 A;  3A8Y C;  4P09 A;  3SFE A;  4ZI2 D;  4CI1 B;  4JUY A;  2XYS A;  2YDQ A;  4YLH A;  3OTO T;  3WTN A;  2V8S V;  1AJ3 A;  3VHL A;  3JAF A;  2DWK A;  3N5L A;  2X51 A;  3GA8 A;  3MJX A;  4UR9 A;  2WBL A;  3EHZ A;  4BFQ A;  4NZB A;  5LMN T;  2LRL A;  4UXU A;  4ZJT A;  3T8O A;  3AE8 A;  3RC8 A;  1T8B A;  1D1C A;  2W63 A;  3HKB E;  3H3M A;  3AAE B;  4DV3 T;  3C50 A;  2XAJ B;  4ILU A;  2CXD A;  3P4Q A;  4ISS A;  5FY7 A;  2LSY A;  4B3S T;  4GYS A;  2C5K T;  3AE2 A;  2KWI B;  2ZM8 A;  1N33 T;  1M7K A;  4ZXL A;  4HWD A;  2ES0 A;  1Z8U A;  2KIN B;  4X1I E;  5L47 A;  2V6X A;  1FIO A;  3AEG A;  1CHU A;  4PFO A;  5HXR A;  4UVA B;  3SQ6 A;  2LKG A;  2LM2 A;  3GMI A;  1WYB A;  1N32 T;  3RH3 A;  4NPP A;  1VRB A;  3I1A A;  2KND A;  4O4I E;  2OLT A;  1SHZ C;  4ERR A;  3CQX C;  1D1A A;  3WI3 A;  3O9X A;  1MMD A;  4D01 A;  4AQF C;  2YU2 A;  2A72 A;  3QOF A;  5EZY E;  1S94 A;  4L0R A;  2ZJV A;  2XNV A;  5AFM A;  3ZT7 A;  4I50 E;  2MOZ A;  1M62 A;  3UU5 A;  5JR9 B;  2UU9 T;  5LGN B;  2QA7 A;  2XAF B;  5CFB A;  3EUH A;  3H37 A;  4GK0 E;  5AFL A;  4YXD A;  2JPF A;  2UXC T;  5HAX A;  5KE4 A;  2I0M A;  3QUJ A;  4KUM B;  1XNR T;  5AQI B;  3PUR A;  2QRX A;  5J5G A;  5HWX A;  3TLV A;  4WZX A;  4LF9 T;  5FVL A;  3VU7 H;  4X20 E;  1MIW A;  1HR0 T;  1W09 A;  4EAH A;  2BG9 B;  2XAH B;  3OJA A;  2P9B A;  1YD8 G;  2WWV A;  3CX6 B;  4C91 A;  3ZT5 A;  3AEC A;  3P4S A;  3ZMT B;  5DQW A;  4ZS3 A;  4IST A;  4BA9 A;  1Y64 B;  1OED E;  4AQG A;  3U8M A;  4XBF B;  4H9P C;  4X1Y E;  3WTM A;  4UVB B;  5JR9 A;  5F5W A;  2DCF A;  3C51 A;  2H89 A;  5LBM A;  4XZC A;  3RIU A;  2WNL A;  4AFG A;  5AFN A;  2WQY A;  4EZ1 A;  2XZ5 A;  4WBO A;  4DO0 A;  5BW2 A;  2LT3 A;  2YN6 A;  3VR9 A;  4HFC A;  5FXX A;  3RX6 A;  4KP3 C;  5CB4 E;  4HFD A;  2V1D B;  1WYC A;  5FVK A;  2Y58 A;  3N2G E;  4BAY B;  3AVR A;  3BK9 A;  5LHI B;  2VL0 A;  4HEA A;  2L8K A;  2N2N A;  3RIF A;  5HXS A;  2ZM6 T;  2Y6X A;  4U2Z A;  1IJ6 A;  2VVS A;  4JV5 T;  5AQN B;  3ZC0 A;  5AQR B;  2EHO B;  4PJL A;  4AFH A;  5AQV B;  4DV6 T;  3ZSS A;  3N9P A;  1UUS A;  1WRD A;  4A56 A;  2BS2 A;  2YU1 A;  4ZS2 A;  3UU3 A;  5BMV E;  5CGM A;  5DJQ C;  1ZEE A;  2KMF A;  2E5L T;  1ZHC A;  2LLY A;  3NVO A;  2LHN A;  3C4X A;  2OV9 A;  2CLY B;  1J5W A;  2JQ9 A;  3RI5 A;  3I0O A;  2XYT A;  4ALX A;  4DR5 T;  3N9O A;  4QAC A;  2V7M A;  4WBN E;  3KBU A;  2V7K A;  5FL0 A;  2E9X A;  2PGZ A;  2WZY A;  2ZLY A;  4IT4 A;  1HG5 A;  1MMA A;  3ZJ1 A;  2WDQ A;  2K3W A;  3U8N A;  3FBL A;  2YK0 A;  5LYJ E;  4YSZ A;  2XQ9 A;  3I9W A;  2ODU A;  3CQG B;  4BJN A;  5FKY A;  4TX5 A;  4CN6 A;  3ZC1 A;  4DID B;  4P0B A;  4DVD A;  3ONL C;  4TNV A;  2W0G A;  5HEG A;  2Q9Q C;  3HKC E;  3P7I A;  2Q9Q B;  4FI5 A;  3WTJ A;  5E0O A;  4I55 E;  3NKZ A;  3O1J A;  4DR1 T;  3AE6 A;  3RIU C;  4JBW F;  2ODV A;  2W66 A;  3FZM B;  1SE7 A;  2LKH A;  4QXC B;  4IRE A;  4O2A E;  4C90 A;  4WW0 A;  2IC9 A;  4HGA A;  2XM2 A;  2BYR A;  4DV2 T;  3PE0 A;  3I9Y A;  4IE4 A;  3EVY A;  2D9D A;  3RHW A;  2E9X B;  3LBX B;  2BVM A;  2QYW A;  2LJL A;  2BVL A;  4AFT A;  2IC6 A;  4HTE A;  1DU2 A;  5LNK A;  4K0U A;  3FHN A;  4U3C A;  1KNP A;  4U33 A;  4JI0 T;  2CE7 A;  2IML A;  2BBJ A;  1OED A;  2BR7 A;  4KI0 F;  3UT5 E;  2IAK A;  3QB5 A;  3UUN A;  2A3D A;  4DUZ T;  2MYS A;  2WCA A;  3Q5D A;  3L3P A;  4AKI A;  4LFC T;  1OED B;  2EHO C;  2JQH A;  2VKH A;  3UUB A;  3ZPO A;  3QNU A;  2M6B A;  2V26 A;  1NEN A;  4X64 T;  4U74 A;  5LGU B;  2WZH A;  5LBQ B;  3RYH E;  4LML A;  3PUV F;  2WDV A;  5L4H A;  3LBX A;  2N1G A;  4A5X A;  5FY0 A;  2KXP B;  4EOZ B;  2DHR A;  2Y8D A;  2PJQ A;  3AE3 A;  3N9M A;  4O4L E;  4TWF A;  1WFD A;  4QH1 A;  4PJM A;  4TUY E;  5AQG B;  2BJ0 A;  5L3G B;  2PG8 A;  1Z0P A;  2BG9 C;  2PFV A;  4X65 T;  3U8L A;  3ZST A;  2LSG A;  2YMD A;  4O8S A;  2YME A;  3RRC A;  1V9D A;  3ANW A;  5HCJ A;  1SUM B;  5AFU L;  5JDL A;  3UQ4 A;  3U8J A;  3ZYK A;  1NEK A;  1R8I A;  2UXX B;  1MMN A;  5JRC A;  4MAL A;  2DWG A;  4GKK T;  3SH1 A;  3FB2 A;  3O1I A;  2IUB A;  1D0X A;  4YSX A;  3FBZ A;  1U5P A;  3IBP A;  2W8G A;  4F8H A;  4DV4 T;  4ADZ A;  2WWU A;  4UY2 A;  2QVA A;  2XQ3 A;  4ZZC A;  5AQJ B;  3VRB A;  3FZL B;  4U7I A;  4Z91 A;  1W0B A;  5JDM A;  4CXW A;  5AQP B;  3K1S A;  4QWN B;  2LM9 A;  4TWD A;  2JMK A;  2XHE B;  5J5H A;  3P4R A;  3ZMU B;  3TLS A;  2J47 A;  1UK5 A;  4CN1 A;  3G06 A;  1UV6 A;  3ZYL A;  2BG9 A;  4GOU A;  1E1H B;  1ZOY A;  4IHJ E;  3R84 B;  2WS3 A;  3ESL A;  2IW5 B;  2PTF A;  3ONJ A;  2X00 A;  2VK9 A;  1HNZ T;  4KMC A;  3UUX B;  2CCQ A;  3JC6 C;  4UM1 A;  2YIN A;  4DR2 T;  2DI4 A;  1JNR A;  3O1H A;  3H3A A;  4LMJ A;  4EED A;  3AEA A;  3I0Q A;  3D0T A;  4EXT A;  2XZ6 A;  2CM0 A;  3KFW X;  4A97 A;  4DR3 T;  2JJ9 A;  3KV5 A;  1YQ4 A;  3NRY A;  4N78 D;  3UU8 A;  1W9R A;  4JI6 T;  5BR8 T;  1MIV A;  4PK4 A;  1WCR A;  3JC6 D;  4PW8 A;  2VKD A;  2BYS A;  5L3F B;  4OYK A;  1LKX A;  2CBJ A;  4ZHQ E;  3SRZ A;  2HHH T;  1LRZ A;  5L3E B;  3M65 A;  1OXZ A;  4JI3 T;  3V5S A;  3S4U A;  2XAG B;  3PV0 F;  4TV9 E;  4IIJ E;  4ZJS A;  2X67 A;  1WLX A;  2W00 A;  3ANW B;  4ZR6 A;  4YFS A;  3N2O A;  2A9U A;  3N2K E;  3KBT A;  4V1A v;  3LK3 B;  4EZH A;  4H9S E;  5IHY A;  4YJ3 E;  4FRR A;  4HFV A;  5AQL B;  3SFD A;  2KT9 A;  3QC9 A;  1HF8 A;  4YJ2 E;  4HWC A;  4CXY A;  3Q9D A;  3ZMS B;  3SIO A;  1ZV4 X;  4UIG A;  2X0L B;  4NUV A;  2Y7Y A;  3ZCI A;  3CML A;  3AAI A;  3AE1 A;  1XMO T;  1OWA A; 
#chains in the Genus database with same CATH homology
 4IL4 A;  4ZJT A;  4B5D A;  4AFH A;  3UU6 A;  4TWH A;  4IRE A;  3WTK A;  2BG9 B;  3PMZ A;  5L4H A;  4ZZB A;  2X00 A;  3ZDG A;  2X00 D;  4UM3 A;  4COF A;  3UU3 A;  2KSR A;  2PH9 A;  5AFJ A;  4IL9 A;  5LG3 A;  2UZ6 A;  4XK9 A;  4ILB A;  4UM1 A;  2BYR A;  2LLY A;  4TWF A;  2BYP A;  4UM3 P;  1OED E;  4QH1 A;  2BYN A;  4QAA A;  3WTO A;  3U8M A;  2BJ0 A;  2BG9 C;  3RI5 A;  5L4E A;  3WTM A;  3RHW A;  3P50 A;  2XQ6 A;  2XYT A;  4LMJ A;  4ALX A;  4XHE A;  2W8F A;  3U8L A;  2XQ5 A;  4QAC A;  2YKS A;  3UQ7 A;  2YMD A;  5J5I A;  4LMK A;  3UU4 A;  4X5T A;  2XZ6 A;  5L47 A;  4A97 A;  4QH4 A;  2XNT A;  2YME A;  3WTI A;  3C79 A;  2BG9 E;  4AFT A;  4QAB A;  5SYO A;  5HCJ A;  4ILC A;  3RQW A;  3UU8 A;  2XQ8 A;  2PGZ A;  2WZY A;  3UQ4 A;  4HQP A;  2XQ7 A;  3ZKR A;  2WNL A;  3U8J A;  3TLU A;  3SQ6 A;  2LKG A;  2LM2 A;  4AFG A;  2ZJU A;  3EI0 A;  2WN9 A;  3U8N A;  5J0Z A;  5HCM A;  4DBM A;  3P4W A;  4HFI A;  2BYS A;  5AFN A;  4NPP A;  4EZ1 A;  1UW6 A;  2XQ9 A;  3JAD A;  4QH5 A;  5IUX A;  2XZ5 A;  5AFH A;  5AIN A;  3SH1 A;  3U8K A;  2XQA A;  3LSV A;  3WTH A;  5BW2 A;  2YN6 A;  1OED A;  2BR7 A;  4D01 A;  4ZRU A;  2BYQ A;  5CO5 A;  4ZJS A;  4HFC A;  4HFB A;  2M6I A;  1OED C;  4WV9 A;  5JME A;  5LXB A;  3WIP A;  4HFD A;  4ILA A;  2BR8 A;  3TLT A;  2W8G A;  2ZJV A;  4PIR A;  4F8H A;  5HEH A;  2XNU A;  4ZK4 A;  5BP0 A;  4TNV A;  2XNV A;  4UY2 A;  4HFE A;  2XQ3 A;  4ZZC A;  4Z90 A;  5AFM B;  5AFK A;  5AFM A;  3EAM A;  4ZR6 A;  3SQ9 A;  4Z91 A;  2Y58 A;  3UU5 A;  4BQT A;  3PEO A;  2XQ4 A;  3C84 A;  2Y56 A;  2Y54 A;  2WNC A;  2VL0 A;  5HEG A;  3RQU A;  5CFB A;  1OED B;  4FRR A;  4ZK1 A;  4TWD A;  2XYS A;  5J5H A;  4UM3 S;  5J5F A;  3RIF A;  3WTL A;  5KZU A;  1I9B A;  3GUA A;  4A98 A;  3WTN A;  3WTJ A;  5AFL A;  3JAF A;  3UUB A;  5FJV A;  3JAE A;  5KE4 A;  3TLS A;  2M6B A;  5BRX A;  5HEU A;  3SIO A;  2YOE A;  4HFH A;  5J5G A;  1UV6 A;  5TVC A;  3T4M A;  2Y57 A;  4TNW A;  2QC1 B;  2Y7Y A;  3IGQ A;  1UX2 A;  3TLV A;  5HEJ A;  2WNJ A;  3ZDH A;  2BG9 A;  3EHZ A;  3RIA A;  4BFQ A;  4NZB A;  2C9T A;  3TLW A;  2MAW A;  2LKH A;  5HEO A;  4UXU A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...