5CO5A

Crystal structure of ac-achbp in complex with conotoxin gic
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
207
structure length
207
Chain Sequence
SQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/toxin
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of Ac-AChBP in complex with conotoxin GIC
rcsb
source organism Aplysia californica
total genus 47
structure length 207
sequence length 207
chains with identical sequence B, D, G, I
ec nomenclature
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5co5A00
4QH4A 2Y58A 3SIOA 2BR8A 2YN6A 4Z91A 5HEGA 3TLWA 4ZK1A 1UV6A 5J5HA 5AFNA 2X00A 2Y56A 3JAFA 3TLUA 3ZKRA 5AFMB 1UW6A 4UM3P 4HFDA 4UXUA 4UM1A 3UQ4A 2XYSA 3C84A 2XNTA 3UUBA 4PIRA 4HFIA 3U8JA 3T4MA 2XQAA 4TWHA 3TLTA 5KZUA 4QACA 5L4EA 2BG9C 4ALXA 4HQPA 4WV9A 4F8HA 3ZDHA 4LMJA 5IUXA 5HEHA 3SQ9A 3WIPA 4BQTA 4ZZCA 2XQ7A 5J0ZA 5CO5A 4ILBA 3PMZA 5TVCA 2PGZA 4TWDA 5J5IA 2WN9A 3UQ7A 2WZYA 4ZJSA 4XHEA 5J5FA 5BRXA 4HFEA 2Y7YA 4AFGA 4TNVA 5HCMA 4ILAA 2YKSA 2BJ0A 4LMLA 2XQ4A 2QC1B 2PH9A 2W8FA 4HFBA 2XNVA 3RI5A 5BP0A 2XQ3A 5LXBA 3WTNA 2Y57A 3WTIA 4UM3A 2ZJVA 3RIFA 2BYPA 5HEOA 2X00D 3JAEA 1UX2A 4NZBA 5SYOA 4TNWA 3TLSA 3UU3A 2BG9E 5J5GA 4IL9A 4EZ1A 4ZJTA 3P4WA 3UU8A 5FJVA 4LMKA 4B5DA 4TWFA 5HCJA 3WTKA 2BYSA 2WNJA 3EHZA 4QABA 5AFHA 4HFHA 4AFHA 2XZ5A 3C79A 2XZ6A 4ZRUA 4ILCA 4UY2A 3RQWA 3SH1A 2BYRA 2BG9A 4NPPA 4ZK4A 2YMDA 2XQ5A 3WTJA 4D01A 3UU6A 5JMEA 3ZDGA 4IL4A 3RIAA 4DBMA 5AFKA 2BYQA 1I9BA 2W8GA 5BW2A 2UZ6A 2YMEA 4QH1A 4QAAA 2WNLA 3U8LA 2XYTA 4IREA 5KE4A 2BR7A 3WTOA 5HEUA 3WTHA 5AFLA 3IGQA 3U8NA 3EAMA 4ZR6A 3U8MA 4COFA 3TLVA 4UM3S 5CFBA 3P50A 4HFCA 5HEJA 2XQ6A 3GUAA 4QH5A 3JADA 4A97A 4ZZBA 4Z90A 2BG9B 4AFTA 4X5TA 5AFMA 3UU5A 2XQ9A 3UU4A 2XNUA 3PEOA 2C9TA 3WTMA 4A98A 5AFJA 3LSVA 2Y54A 5L4HA 4FRRA 5L47A 3RHWA 2XQ8A 3RQUA 4XK9A 5AINA 2WNCA 2VL0A 5LG3A 2BYNA 3SQ6A 3EI0A 4BFQA 3U8KA 2YOEA 3WTLA 2ZJUA
chains in the Genus database with same CATH superfamily
4QH4A 2Y58A 3SIOA 2BR8A 2YN6A 4Z91A 5HEGA 3TLWA 4ZK1A 1UV6A 5J5HA 5AFNA 2X00A 2Y56A 3JAFA 3TLUA 3ZKRA 5AFMB 1UW6A 4UM3P 4HFDA 4UXUA 4UM1A 3UQ4A 2XYSA 3C84A 2XNTA 3UUBA 4PIRA 4HFIA 3U8JA 3T4MA 2XQAA 4TWHA 3TLTA 5KZUA 4QACA 5L4EA 2BG9C 4ALXA 4HQPA 4WV9A 4F8HA 3ZDHA 4LMJA 5IUXA 5HEHA 3SQ9A 3WIPA 4BQTA 4ZZCA 2XQ7A 5J0ZA 5CO5A 4ILBA 3PMZA 5TVCA 2PGZA 4TWDA 5J5IA 2WN9A 3UQ7A 2WZYA 4ZJSA 4XHEA 5J5FA 5BRXA 4HFEA 2Y7YA 4AFGA 4TNVA 5HCMA 4ILAA 2YKSA 2BJ0A 4LMLA 2XQ4A 2QC1B 2PH9A 2W8FA 4HFBA 2XNVA 3RI5A 5BP0A 2XQ3A 5LXBA 3WTNA 2Y57A 3WTIA 4UM3A 2ZJVA 3RIFA 2BYPA 5HEOA 2X00D 3JAEA 1UX2A 4NZBA 5SYOA 4TNWA 3TLSA 3UU3A 2BG9E 5J5GA 4IL9A 4EZ1A 4ZJTA 3P4WA 3UU8A 5FJVA 4LMKA 4B5DA 4TWFA 5HCJA 3WTKA 2BYSA 2WNJA 3EHZA 4QABA 5AFHA 4HFHA 4AFHA 2XZ5A 3C79A 2XZ6A 4ZRUA 4ILCA 4UY2A 3RQWA 3SH1A 2BYRA 2BG9A 4NPPA 4ZK4A 2YMDA 2XQ5A 3WTJA 4D01A 3UU6A 5JMEA 3ZDGA 4IL4A 3RIAA 4DBMA 5AFKA 2BYQA 1I9BA 2W8GA 5BW2A 2UZ6A 2YMEA 4QH1A 4QAAA 2WNLA 3U8LA 2XYTA 4IREA 5KE4A 2BR7A 3WTOA 5HEUA 3WTHA 5AFLA 3IGQA 3U8NA 3EAMA 4ZR6A 3U8MA 4COFA 3TLVA 4UM3S 5CFBA 3P50A 4HFCA 5HEJA 2XQ6A 3GUAA 4QH5A 3JADA 4A97A 4ZZBA 4Z90A 2BG9B 4AFTA 4X5TA 5AFMA 3UU5A 2XQ9A 3UU4A 2XNUA 3PEOA 2C9TA 3WTMA 4A98A 5AFJA 3LSVA 2Y54A 5L4HA 4FRRA 5L47A 3RHWA 2XQ8A 3RQUA 4XK9A 5AINA 2WNCA 2VL0A 5LG3A 2BYNA 3SQ6A 3EI0A 4BFQA 3U8KA 2YOEA 3WTLA 2ZJUA
chains in the Genus database with same CATH topology
4QH4A 2Y58A 3SIOA 2BR8A 2YN6A 4Z91A 5HEGA 3TLWA 4ZK1A 1UV6A 5J5HA 5AFNA 2X00A 2Y56A 3JAFA 3TLUA 3ZKRA 5AFMB 1UW6A 4UM3P 4HFDA 4UXUA 4UM1A 3UQ4A 2XYSA 3C84A 2XNTA 3UUBA 4PIRA 4HFIA 3U8JA 3T4MA 2XQAA 4TWHA 3TLTA 5KZUA 4QACA 5L4EA 2BG9C 4ALXA 4HQPA 4WV9A 4F8HA 3ZDHA 4LMJA 5IUXA 5HEHA 3SQ9A 3WIPA 4BQTA 4ZZCA 2XQ7A 5J0ZA 5CO5A 4ILBA 3PMZA 5TVCA 2PGZA 4TWDA 5J5IA 2WN9A 3UQ7A 2WZYA 4ZJSA 4XHEA 5J5FA 5BRXA 4HFEA 2Y7YA 4AFGA 4TNVA 5HCMA 4ILAA 2YKSA 2BJ0A 4LMLA 2XQ4A 2QC1B 2PH9A 2W8FA 4HFBA 2XNVA 3RI5A 5BP0A 2XQ3A 5LXBA 3WTNA 2Y57A 3WTIA 4UM3A 2ZJVA 3RIFA 2BYPA 5HEOA 2X00D 3JAEA 1UX2A 4NZBA 5SYOA 4TNWA 3TLSA 3UU3A 2BG9E 5J5GA 4IL9A 4EZ1A 4ZJTA 3P4WA 3UU8A 5FJVA 4LMKA 4B5DA 4TWFA 5HCJA 3WTKA 2BYSA 2WNJA 3EHZA 4QABA 5AFHA 4HFHA 4AFHA 2XZ5A 3C79A 2XZ6A 4ZRUA 4ILCA 4UY2A 3RQWA 3SH1A 2BYRA 2BG9A 4NPPA 4ZK4A 2YMDA 2XQ5A 3WTJA 4D01A 3UU6A 5JMEA 3ZDGA 4IL4A 3RIAA 4DBMA 5AFKA 2BYQA 1I9BA 2W8GA 5BW2A 2UZ6A 2YMEA 4QH1A 4QAAA 2WNLA 3U8LA 2XYTA 4IREA 5KE4A 2BR7A 3WTOA 5HEUA 3WTHA 5AFLA 3IGQA 3U8NA 3EAMA 4ZR6A 3U8MA 4COFA 3TLVA 4UM3S 5CFBA 3P50A 4HFCA 5HEJA 2XQ6A 3GUAA 4QH5A 3JADA 4A97A 4ZZBA 4Z90A 2BG9B 4AFTA 4X5TA 5AFMA 3UU5A 2XQ9A 3UU4A 2XNUA 3PEOA 2C9TA 3WTMA 4A98A 5AFJA 3LSVA 2Y54A 5L4HA 4FRRA 5L47A 3RHWA 2XQ8A 3RQUA 4XK9A 5AINA 2WNCA 2VL0A 5LG3A 2BYNA 3SQ6A 3EI0A 4BFQA 3U8KA 2YOEA 3WTLA 2ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH4 A;  2Y58 A;  3SIO A;  2BR8 A;  2YN6 A;  4Z91 A;  5HEG A;  3TLW A;  4ZK1 A;  1UV6 A;  5J5H A;  5AFN A;  2X00 A;  2Y56 A;  3JAF A;  3TLU A;  3ZKR A;  5AFM B;  1UW6 A;  4UM3 P;  4HFD A;  4UXU A;  4UM1 A;  3UQ4 A;  2XYS A;  3C84 A;  2XNT A;  3UUB A;  4PIR A;  4HFI A;  3U8J A;  3T4M A;  2XQA A;  4TWH A;  3TLT A;  5KZU A;  4QAC A;  5L4E A;  2BG9 C;  4ALX A;  4HQP A;  4WV9 A;  4F8H A;  3ZDH A;  4LMJ A;  5IUX A;  5HEH A;  3SQ9 A;  3WIP A;  4BQT A;  4ZZC A;  2XQ7 A;  5J0Z A;  5CO5 A;  4ILB A;  3PMZ A;  5TVC A;  2PGZ A;  4TWD A;  5J5I A;  2WN9 A;  3UQ7 A;  2WZY A;  4ZJS A;  4XHE A;  5J5F A;  5BRX A;  4HFE A;  2Y7Y A;  4AFG A;  4TNV A;  5HCM A;  4ILA A;  2YKS A;  2BJ0 A;  4LML A;  2XQ4 A;  2QC1 B;  2PH9 A;  2W8F A;  4HFB A;  2XNV A;  3RI5 A;  5BP0 A;  2XQ3 A;  5LXB A;  3WTN A;  2Y57 A;  3WTI A;  4UM3 A;  2ZJV A;  3RIF A;  2BYP A;  5HEO A;  2X00 D;  3JAE A;  1UX2 A;  4NZB A;  5SYO A;  4TNW A;  3TLS A;  3UU3 A;  2BG9 E;  5J5G A;  4IL9 A;  4EZ1 A;  4ZJT A;  3P4W A;  3UU8 A;  5FJV A;  4LMK A;  4B5D A;  4TWF A;  5HCJ A;  3WTK A;  2BYS A;  2WNJ A;  3EHZ A;  4QAB A;  5AFH A;  4HFH A;  4AFH A;  2XZ5 A;  3C79 A;  2XZ6 A;  4ZRU A;  4ILC A;  4UY2 A;  3RQW A;  3SH1 A;  2BYR A;  2BG9 A;  4NPP A;  4ZK4 A;  2YMD A;  2XQ5 A;  3WTJ A;  4D01 A;  3UU6 A;  5JME A;  3ZDG A;  4IL4 A;  3RIA A;  4DBM A;  5AFK A;  2BYQ A;  1I9B A;  2W8G A;  5BW2 A;  2UZ6 A;  2YME A;  4QH1 A;  4QAA A;  2WNL A;  3U8L A;  2XYT A;  4IRE A;  5KE4 A;  2BR7 A;  3WTO A;  5HEU A;  3WTH A;  5AFL A;  3IGQ A;  3U8N A;  3EAM A;  4ZR6 A;  3U8M A;  4COF A;  3TLV A;  4UM3 S;  5CFB A;  3P50 A;  4HFC A;  5HEJ A;  2XQ6 A;  3GUA A;  4QH5 A;  3JAD A;  4A97 A;  4ZZB A;  4Z90 A;  2BG9 B;  4AFT A;  4X5T A;  5AFM A;  3UU5 A;  2XQ9 A;  3UU4 A;  2XNU A;  3PEO A;  2C9T A;  3WTM A;  4A98 A;  5AFJ A;  3LSV A;  2Y54 A;  5L4H A;  4FRR A;  5L47 A;  3RHW A;  2XQ8 A;  3RQU A;  4XK9 A;  5AIN A;  2WNC A;  2VL0 A;  5LG3 A;  2BYN A;  3SQ6 A;  3EI0 A;  4BFQ A;  3U8K A;  2YOE A;  3WTL A;  2ZJU A; 
#chains in the Genus database with same CATH topology
 4QH4 A;  2Y58 A;  3SIO A;  2BR8 A;  2YN6 A;  4Z91 A;  5HEG A;  3TLW A;  4ZK1 A;  1UV6 A;  5J5H A;  5AFN A;  2X00 A;  2Y56 A;  3JAF A;  3TLU A;  3ZKR A;  5AFM B;  1UW6 A;  4UM3 P;  4HFD A;  4UXU A;  4UM1 A;  3UQ4 A;  2XYS A;  3C84 A;  2XNT A;  3UUB A;  4PIR A;  4HFI A;  3U8J A;  3T4M A;  2XQA A;  4TWH A;  3TLT A;  5KZU A;  4QAC A;  5L4E A;  2BG9 C;  4ALX A;  4HQP A;  4WV9 A;  4F8H A;  3ZDH A;  4LMJ A;  5IUX A;  5HEH A;  3SQ9 A;  3WIP A;  4BQT A;  4ZZC A;  2XQ7 A;  5J0Z A;  5CO5 A;  4ILB A;  3PMZ A;  5TVC A;  2PGZ A;  4TWD A;  5J5I A;  2WN9 A;  3UQ7 A;  2WZY A;  4ZJS A;  4XHE A;  5J5F A;  5BRX A;  4HFE A;  2Y7Y A;  4AFG A;  4TNV A;  5HCM A;  4ILA A;  2YKS A;  2BJ0 A;  4LML A;  2XQ4 A;  2QC1 B;  2PH9 A;  2W8F A;  4HFB A;  2XNV A;  3RI5 A;  5BP0 A;  2XQ3 A;  5LXB A;  3WTN A;  2Y57 A;  3WTI A;  4UM3 A;  2ZJV A;  3RIF A;  2BYP A;  5HEO A;  2X00 D;  3JAE A;  1UX2 A;  4NZB A;  5SYO A;  4TNW A;  3TLS A;  3UU3 A;  2BG9 E;  5J5G A;  4IL9 A;  4EZ1 A;  4ZJT A;  3P4W A;  3UU8 A;  5FJV A;  4LMK A;  4B5D A;  4TWF A;  5HCJ A;  3WTK A;  2BYS A;  2WNJ A;  3EHZ A;  4QAB A;  5AFH A;  4HFH A;  4AFH A;  2XZ5 A;  3C79 A;  2XZ6 A;  4ZRU A;  4ILC A;  4UY2 A;  3RQW A;  3SH1 A;  2BYR A;  2BG9 A;  4NPP A;  4ZK4 A;  2YMD A;  2XQ5 A;  3WTJ A;  4D01 A;  3UU6 A;  5JME A;  3ZDG A;  4IL4 A;  3RIA A;  4DBM A;  5AFK A;  2BYQ A;  1I9B A;  2W8G A;  5BW2 A;  2UZ6 A;  2YME A;  4QH1 A;  4QAA A;  2WNL A;  3U8L A;  2XYT A;  4IRE A;  5KE4 A;  2BR7 A;  3WTO A;  5HEU A;  3WTH A;  5AFL A;  3IGQ A;  3U8N A;  3EAM A;  4ZR6 A;  3U8M A;  4COF A;  3TLV A;  4UM3 S;  5CFB A;  3P50 A;  4HFC A;  5HEJ A;  2XQ6 A;  3GUA A;  4QH5 A;  3JAD A;  4A97 A;  4ZZB A;  4Z90 A;  2BG9 B;  4AFT A;  4X5T A;  5AFM A;  3UU5 A;  2XQ9 A;  3UU4 A;  2XNU A;  3PEO A;  2C9T A;  3WTM A;  4A98 A;  5AFJ A;  3LSV A;  2Y54 A;  5L4H A;  4FRR A;  5L47 A;  3RHW A;  2XQ8 A;  3RQU A;  4XK9 A;  5AIN A;  2WNC A;  2VL0 A;  5LG3 A;  2BYN A;  3SQ6 A;  3EI0 A;  4BFQ A;  3U8K A;  2YOE A;  3WTL A;  2ZJU A; 
#chains in the Genus database with same CATH homology
 4QH4 A;  2Y58 A;  3SIO A;  2BR8 A;  2YN6 A;  4Z91 A;  5HEG A;  3TLW A;  4ZK1 A;  1UV6 A;  5J5H A;  5AFN A;  2X00 A;  2Y56 A;  3JAF A;  3TLU A;  3ZKR A;  5AFM B;  1UW6 A;  4UM3 P;  4HFD A;  4UXU A;  4UM1 A;  3UQ4 A;  2XYS A;  3C84 A;  2XNT A;  3UUB A;  4PIR A;  4HFI A;  3U8J A;  3T4M A;  2XQA A;  4TWH A;  3TLT A;  5KZU A;  4QAC A;  5L4E A;  2BG9 C;  4ALX A;  4HQP A;  4WV9 A;  4F8H A;  3ZDH A;  4LMJ A;  5IUX A;  5HEH A;  3SQ9 A;  3WIP A;  4BQT A;  4ZZC A;  2XQ7 A;  5J0Z A;  5CO5 A;  4ILB A;  3PMZ A;  5TVC A;  2PGZ A;  4TWD A;  5J5I A;  2WN9 A;  3UQ7 A;  2WZY A;  4ZJS A;  4XHE A;  5J5F A;  5BRX A;  4HFE A;  2Y7Y A;  4AFG A;  4TNV A;  5HCM A;  4ILA A;  2YKS A;  2BJ0 A;  4LML A;  2XQ4 A;  2QC1 B;  2PH9 A;  2W8F A;  4HFB A;  2XNV A;  3RI5 A;  5BP0 A;  2XQ3 A;  5LXB A;  3WTN A;  2Y57 A;  3WTI A;  4UM3 A;  2ZJV A;  3RIF A;  2BYP A;  5HEO A;  2X00 D;  3JAE A;  1UX2 A;  4NZB A;  5SYO A;  4TNW A;  3TLS A;  3UU3 A;  2BG9 E;  5J5G A;  4IL9 A;  4EZ1 A;  4ZJT A;  3P4W A;  3UU8 A;  5FJV A;  4LMK A;  4B5D A;  4TWF A;  5HCJ A;  3WTK A;  2BYS A;  2WNJ A;  3EHZ A;  4QAB A;  5AFH A;  4HFH A;  4AFH A;  2XZ5 A;  3C79 A;  2XZ6 A;  4ZRU A;  4ILC A;  4UY2 A;  3RQW A;  3SH1 A;  2BYR A;  2BG9 A;  4NPP A;  4ZK4 A;  2YMD A;  2XQ5 A;  3WTJ A;  4D01 A;  3UU6 A;  5JME A;  3ZDG A;  4IL4 A;  3RIA A;  4DBM A;  5AFK A;  2BYQ A;  1I9B A;  2W8G A;  5BW2 A;  2UZ6 A;  2YME A;  4QH1 A;  4QAA A;  2WNL A;  3U8L A;  2XYT A;  4IRE A;  5KE4 A;  2BR7 A;  3WTO A;  5HEU A;  3WTH A;  5AFL A;  3IGQ A;  3U8N A;  3EAM A;  4ZR6 A;  3U8M A;  4COF A;  3TLV A;  4UM3 S;  5CFB A;  3P50 A;  4HFC A;  5HEJ A;  2XQ6 A;  3GUA A;  4QH5 A;  3JAD A;  4A97 A;  4ZZB A;  4Z90 A;  2BG9 B;  4AFT A;  4X5T A;  5AFM A;  3UU5 A;  2XQ9 A;  3UU4 A;  2XNU A;  3PEO A;  2C9T A;  3WTM A;  4A98 A;  5AFJ A;  3LSV A;  2Y54 A;  5L4H A;  4FRR A;  5L47 A;  3RHW A;  2XQ8 A;  3RQU A;  4XK9 A;  5AIN A;  2WNC A;  2VL0 A;  5LG3 A;  2BYN A;  3SQ6 A;  3EI0 A;  4BFQ A;  3U8K A;  2YOE A;  3WTL A;  2ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...