5CO5A

Crystal structure of ac-achbp in complex with conotoxin gic
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
207
structure length
207
Chain Sequence
SQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of Ac-AChBP in complex with conotoxin GIC
rcsb
source organism Aplysia californica
molecule tags Metal binding protein/toxin
total genus 47
structure length 207
sequence length 207
chains with identical sequence B, D, G, I
ec nomenclature
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5co5A00
4TNVA 1UX2A 2XQ4A 2ZJUA 4LMKA 4Z91A 1UV6A 4HFCA 3RIFA 2XQ9A 5AFLA 3UU6A 5HEJA 4AFHA 5SYOA 4QABA 3ZDHA 4AFTA 2X00D 5AFNA 4UM1A 5J5GA 4UY2A 4IREA 2QC1B 2WNJA 3GUAA 4UXUA 4ZRUA 4ZJSA 5BRXA 2Y54A 5AFMB 2ZJVA 3TLTA 4AFGA 2YMDA 4HFBA 4UM3P 4EZ1A 4TNWA 4IL9A 3WTKA 5L47A 3ZDGA 4QAAA 5HEHA 2WNCA 4TWFA 2BYQA 3WTOA 4A98A 5J5FA 3LSVA 3SH1A 3U8KA 2Y58A 2YMEA 4LMJA 3WTMA 4NPPA 5BP0A 4LMLA 2BR8A 2BG9E 4HFIA 3U8LA 4HQPA 4X5TA 3JAFA 3EAMA 3SQ6A 3WTIA 4B5DA 5LXBA 3TLWA 3UU3A 5BW2A 3RI5A 2XYTA 5KE4A 5HCJA 4XHEA 3TLSA 3UU4A 5HCMA 2XQ7A 3U8MA 2YN6A 5J5HA 2YOEA 4BQTA 4D01A 4FRRA 3JADA 2Y7YA 5LG3A 3ZKRA 3RIAA 2XZ5A 2PGZA 3JAEA 1UW6A 3U8JA 2Y57A 4DBMA 5L4EA 3WTNA 3UUBA 5JMEA 4ILBA 2PH9A 4NZBA 1I9BA 2W8GA 4TWDA 2XNUA 4ZZCA 4BFQA 4F8HA 3WIPA 4QACA 4XK9A 4ZK4A 4UM3A 3SIOA 3TLVA 4ZJTA 2BYNA 5IUXA 4Z90A 2XZ6A 3EI0A 4TWHA 3IGQA 2WN9A 5AFJA 3UU8A 5AINA 4QH1A 3RQUA 2BG9B 4HFEA 5CFBA 5L4HA 3P4WA 4ZZBA 5AFMA 5HEOA 5FJVA 5HEUA 3UQ4A 2XQ5A 4A97A 2WZYA 2VL0A 2XYSA 2WNLA 3UQ7A 5TVCA 2X00A 4ZR6A 3U8NA 4ILAA 3RHWA 2Y56A 3WTJA 2XQ6A 3PEOA 2C9TA 2BR7A 3RQWA 3PMZA 4QH5A 2W8FA 2XQ3A 3WTHA 4HFHA 4ILCA 5CO5A 3WTLA 5KZUA 3TLUA 2BYRA 5J5IA 5HEGA 2BJ0A 4UM3S 4COFA 5J0ZA 2XNVA 2XQ8A 2BYSA 2BYPA 3C79A 3SQ9A 3UU5A 5AFKA 3EHZA 2BG9C 4PIRA 2YKSA 4HFDA 4WV9A 4ZK1A 2XQAA 2UZ6A 4ALXA 5AFHA 3T4MA 4IL4A 2XNTA 3C84A 4QH4A 3P50A 2BG9A
chains in the Genus database with same CATH superfamily
4TNVA 1UX2A 2XQ4A 2ZJUA 4LMKA 4Z91A 1UV6A 4HFCA 3RIFA 2XQ9A 5AFLA 3UU6A 5HEJA 4AFHA 5SYOA 4QABA 3ZDHA 4AFTA 2X00D 5AFNA 4UM1A 5J5GA 4UY2A 4IREA 2QC1B 2WNJA 3GUAA 4UXUA 4ZRUA 4ZJSA 5BRXA 2Y54A 5AFMB 2ZJVA 3TLTA 4AFGA 2YMDA 4HFBA 4UM3P 4EZ1A 4TNWA 4IL9A 3WTKA 5L47A 3ZDGA 4QAAA 5HEHA 2WNCA 4TWFA 2BYQA 3WTOA 4A98A 5J5FA 3LSVA 3SH1A 3U8KA 2Y58A 2YMEA 4LMJA 3WTMA 4NPPA 5BP0A 4LMLA 2BR8A 2BG9E 4HFIA 3U8LA 4HQPA 4X5TA 3JAFA 3EAMA 3SQ6A 3WTIA 4B5DA 5LXBA 3TLWA 3UU3A 5BW2A 3RI5A 2XYTA 5KE4A 5HCJA 4XHEA 3TLSA 3UU4A 5HCMA 2XQ7A 3U8MA 2YN6A 5J5HA 2YOEA 4BQTA 4D01A 4FRRA 3JADA 2Y7YA 5LG3A 3ZKRA 3RIAA 2XZ5A 2PGZA 3JAEA 1UW6A 3U8JA 2Y57A 4DBMA 5L4EA 3WTNA 3UUBA 5JMEA 4ILBA 2PH9A 4NZBA 1I9BA 2W8GA 4TWDA 2XNUA 4ZZCA 4BFQA 4F8HA 3WIPA 4QACA 4XK9A 4ZK4A 4UM3A 3SIOA 3TLVA 4ZJTA 2BYNA 5IUXA 4Z90A 2XZ6A 3EI0A 4TWHA 3IGQA 2WN9A 5AFJA 3UU8A 5AINA 4QH1A 3RQUA 2BG9B 4HFEA 5CFBA 5L4HA 3P4WA 4ZZBA 5AFMA 5HEOA 5FJVA 5HEUA 3UQ4A 2XQ5A 4A97A 2WZYA 2VL0A 2XYSA 2WNLA 3UQ7A 5TVCA 2X00A 4ZR6A 3U8NA 4ILAA 3RHWA 2Y56A 3WTJA 2XQ6A 3PEOA 2C9TA 2BR7A 3RQWA 3PMZA 4QH5A 2W8FA 2XQ3A 3WTHA 4HFHA 4ILCA 5CO5A 3WTLA 5KZUA 3TLUA 2BYRA 5J5IA 5HEGA 2BJ0A 4UM3S 4COFA 5J0ZA 2XNVA 2XQ8A 2BYSA 2BYPA 3C79A 3SQ9A 3UU5A 5AFKA 3EHZA 2BG9C 4PIRA 2YKSA 4HFDA 4WV9A 4ZK1A 2XQAA 2UZ6A 4ALXA 5AFHA 3T4MA 4IL4A 2XNTA 3C84A 4QH4A 3P50A 2BG9A
chains in the Genus database with same CATH topology
4TNVA 1UX2A 2XQ4A 2ZJUA 4LMKA 4Z91A 1UV6A 4HFCA 3RIFA 2XQ9A 5AFLA 3UU6A 5HEJA 4AFHA 5SYOA 4QABA 3ZDHA 4AFTA 2X00D 5AFNA 4UM1A 5J5GA 4UY2A 4IREA 2QC1B 2WNJA 3GUAA 4UXUA 4ZRUA 4ZJSA 5BRXA 2Y54A 5AFMB 2ZJVA 3TLTA 4AFGA 2YMDA 4HFBA 4UM3P 4EZ1A 4TNWA 4IL9A 3WTKA 5L47A 3ZDGA 4QAAA 5HEHA 2WNCA 4TWFA 2BYQA 3WTOA 4A98A 5J5FA 3LSVA 3SH1A 3U8KA 2Y58A 2YMEA 4LMJA 3WTMA 4NPPA 5BP0A 4LMLA 2BR8A 2BG9E 4HFIA 3U8LA 4HQPA 4X5TA 3JAFA 3EAMA 3SQ6A 3WTIA 4B5DA 5LXBA 3TLWA 3UU3A 5BW2A 3RI5A 2XYTA 5KE4A 5HCJA 4XHEA 3TLSA 3UU4A 5HCMA 2XQ7A 3U8MA 2YN6A 5J5HA 2YOEA 4BQTA 4D01A 4FRRA 3JADA 2Y7YA 5LG3A 3ZKRA 3RIAA 2XZ5A 2PGZA 3JAEA 1UW6A 3U8JA 2Y57A 4DBMA 5L4EA 3WTNA 3UUBA 5JMEA 4ILBA 2PH9A 4NZBA 1I9BA 2W8GA 4TWDA 2XNUA 4ZZCA 4BFQA 4F8HA 3WIPA 4QACA 4XK9A 4ZK4A 4UM3A 3SIOA 3TLVA 4ZJTA 2BYNA 5IUXA 4Z90A 2XZ6A 3EI0A 4TWHA 3IGQA 2WN9A 5AFJA 3UU8A 5AINA 4QH1A 3RQUA 2BG9B 4HFEA 5CFBA 5L4HA 3P4WA 4ZZBA 5AFMA 5HEOA 5FJVA 5HEUA 3UQ4A 2XQ5A 4A97A 2WZYA 2VL0A 2XYSA 2WNLA 3UQ7A 5TVCA 2X00A 4ZR6A 3U8NA 4ILAA 3RHWA 2Y56A 3WTJA 2XQ6A 3PEOA 2C9TA 2BR7A 3RQWA 3PMZA 4QH5A 2W8FA 2XQ3A 3WTHA 4HFHA 4ILCA 5CO5A 3WTLA 5KZUA 3TLUA 2BYRA 5J5IA 5HEGA 2BJ0A 4UM3S 4COFA 5J0ZA 2XNVA 2XQ8A 2BYSA 2BYPA 3C79A 3SQ9A 3UU5A 5AFKA 3EHZA 2BG9C 4PIRA 2YKSA 4HFDA 4WV9A 4ZK1A 2XQAA 2UZ6A 4ALXA 5AFHA 3T4MA 4IL4A 2XNTA 3C84A 4QH4A 3P50A 2BG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TNV A;  1UX2 A;  2XQ4 A;  2ZJU A;  4LMK A;  4Z91 A;  1UV6 A;  4HFC A;  3RIF A;  2XQ9 A;  5AFL A;  3UU6 A;  5HEJ A;  4AFH A;  5SYO A;  4QAB A;  3ZDH A;  4AFT A;  2X00 D;  5AFN A;  4UM1 A;  5J5G A;  4UY2 A;  4IRE A;  2QC1 B;  2WNJ A;  3GUA A;  4UXU A;  4ZRU A;  4ZJS A;  5BRX A;  2Y54 A;  5AFM B;  2ZJV A;  3TLT A;  4AFG A;  2YMD A;  4HFB A;  4UM3 P;  4EZ1 A;  4TNW A;  4IL9 A;  3WTK A;  5L47 A;  3ZDG A;  4QAA A;  5HEH A;  2WNC A;  4TWF A;  2BYQ A;  3WTO A;  4A98 A;  5J5F A;  3LSV A;  3SH1 A;  3U8K A;  2Y58 A;  2YME A;  4LMJ A;  3WTM A;  4NPP A;  5BP0 A;  4LML A;  2BR8 A;  2BG9 E;  4HFI A;  3U8L A;  4HQP A;  4X5T A;  3JAF A;  3EAM A;  3SQ6 A;  3WTI A;  4B5D A;  5LXB A;  3TLW A;  3UU3 A;  5BW2 A;  3RI5 A;  2XYT A;  5KE4 A;  5HCJ A;  4XHE A;  3TLS A;  3UU4 A;  5HCM A;  2XQ7 A;  3U8M A;  2YN6 A;  5J5H A;  2YOE A;  4BQT A;  4D01 A;  4FRR A;  3JAD A;  2Y7Y A;  5LG3 A;  3ZKR A;  3RIA A;  2XZ5 A;  2PGZ A;  3JAE A;  1UW6 A;  3U8J A;  2Y57 A;  4DBM A;  5L4E A;  3WTN A;  3UUB A;  5JME A;  4ILB A;  2PH9 A;  4NZB A;  1I9B A;  2W8G A;  4TWD A;  2XNU A;  4ZZC A;  4BFQ A;  4F8H A;  3WIP A;  4QAC A;  4XK9 A;  4ZK4 A;  4UM3 A;  3SIO A;  3TLV A;  4ZJT A;  2BYN A;  5IUX A;  4Z90 A;  2XZ6 A;  3EI0 A;  4TWH A;  3IGQ A;  2WN9 A;  5AFJ A;  3UU8 A;  5AIN A;  4QH1 A;  3RQU A;  2BG9 B;  4HFE A;  5CFB A;  5L4H A;  3P4W A;  4ZZB A;  5AFM A;  5HEO A;  5FJV A;  5HEU A;  3UQ4 A;  2XQ5 A;  4A97 A;  2WZY A;  2VL0 A;  2XYS A;  2WNL A;  3UQ7 A;  5TVC A;  2X00 A;  4ZR6 A;  3U8N A;  4ILA A;  3RHW A;  2Y56 A;  3WTJ A;  2XQ6 A;  3PEO A;  2C9T A;  2BR7 A;  3RQW A;  3PMZ A;  4QH5 A;  2W8F A;  2XQ3 A;  3WTH A;  4HFH A;  4ILC A;  5CO5 A;  3WTL A;  5KZU A;  3TLU A;  2BYR A;  5J5I A;  5HEG A;  2BJ0 A;  4UM3 S;  4COF A;  5J0Z A;  2XNV A;  2XQ8 A;  2BYS A;  2BYP A;  3C79 A;  3SQ9 A;  3UU5 A;  5AFK A;  3EHZ A;  2BG9 C;  4PIR A;  2YKS A;  4HFD A;  4WV9 A;  4ZK1 A;  2XQA A;  2UZ6 A;  4ALX A;  5AFH A;  3T4M A;  4IL4 A;  2XNT A;  3C84 A;  4QH4 A;  3P50 A;  2BG9 A; 
#chains in the Genus database with same CATH topology
 4TNV A;  1UX2 A;  2XQ4 A;  2ZJU A;  4LMK A;  4Z91 A;  1UV6 A;  4HFC A;  3RIF A;  2XQ9 A;  5AFL A;  3UU6 A;  5HEJ A;  4AFH A;  5SYO A;  4QAB A;  3ZDH A;  4AFT A;  2X00 D;  5AFN A;  4UM1 A;  5J5G A;  4UY2 A;  4IRE A;  2QC1 B;  2WNJ A;  3GUA A;  4UXU A;  4ZRU A;  4ZJS A;  5BRX A;  2Y54 A;  5AFM B;  2ZJV A;  3TLT A;  4AFG A;  2YMD A;  4HFB A;  4UM3 P;  4EZ1 A;  4TNW A;  4IL9 A;  3WTK A;  5L47 A;  3ZDG A;  4QAA A;  5HEH A;  2WNC A;  4TWF A;  2BYQ A;  3WTO A;  4A98 A;  5J5F A;  3LSV A;  3SH1 A;  3U8K A;  2Y58 A;  2YME A;  4LMJ A;  3WTM A;  4NPP A;  5BP0 A;  4LML A;  2BR8 A;  2BG9 E;  4HFI A;  3U8L A;  4HQP A;  4X5T A;  3JAF A;  3EAM A;  3SQ6 A;  3WTI A;  4B5D A;  5LXB A;  3TLW A;  3UU3 A;  5BW2 A;  3RI5 A;  2XYT A;  5KE4 A;  5HCJ A;  4XHE A;  3TLS A;  3UU4 A;  5HCM A;  2XQ7 A;  3U8M A;  2YN6 A;  5J5H A;  2YOE A;  4BQT A;  4D01 A;  4FRR A;  3JAD A;  2Y7Y A;  5LG3 A;  3ZKR A;  3RIA A;  2XZ5 A;  2PGZ A;  3JAE A;  1UW6 A;  3U8J A;  2Y57 A;  4DBM A;  5L4E A;  3WTN A;  3UUB A;  5JME A;  4ILB A;  2PH9 A;  4NZB A;  1I9B A;  2W8G A;  4TWD A;  2XNU A;  4ZZC A;  4BFQ A;  4F8H A;  3WIP A;  4QAC A;  4XK9 A;  4ZK4 A;  4UM3 A;  3SIO A;  3TLV A;  4ZJT A;  2BYN A;  5IUX A;  4Z90 A;  2XZ6 A;  3EI0 A;  4TWH A;  3IGQ A;  2WN9 A;  5AFJ A;  3UU8 A;  5AIN A;  4QH1 A;  3RQU A;  2BG9 B;  4HFE A;  5CFB A;  5L4H A;  3P4W A;  4ZZB A;  5AFM A;  5HEO A;  5FJV A;  5HEU A;  3UQ4 A;  2XQ5 A;  4A97 A;  2WZY A;  2VL0 A;  2XYS A;  2WNL A;  3UQ7 A;  5TVC A;  2X00 A;  4ZR6 A;  3U8N A;  4ILA A;  3RHW A;  2Y56 A;  3WTJ A;  2XQ6 A;  3PEO A;  2C9T A;  2BR7 A;  3RQW A;  3PMZ A;  4QH5 A;  2W8F A;  2XQ3 A;  3WTH A;  4HFH A;  4ILC A;  5CO5 A;  3WTL A;  5KZU A;  3TLU A;  2BYR A;  5J5I A;  5HEG A;  2BJ0 A;  4UM3 S;  4COF A;  5J0Z A;  2XNV A;  2XQ8 A;  2BYS A;  2BYP A;  3C79 A;  3SQ9 A;  3UU5 A;  5AFK A;  3EHZ A;  2BG9 C;  4PIR A;  2YKS A;  4HFD A;  4WV9 A;  4ZK1 A;  2XQA A;  2UZ6 A;  4ALX A;  5AFH A;  3T4M A;  4IL4 A;  2XNT A;  3C84 A;  4QH4 A;  3P50 A;  2BG9 A; 
#chains in the Genus database with same CATH homology
 4TNV A;  1UX2 A;  2XQ4 A;  2ZJU A;  4LMK A;  4Z91 A;  1UV6 A;  4HFC A;  3RIF A;  2XQ9 A;  5AFL A;  3UU6 A;  5HEJ A;  4AFH A;  5SYO A;  4QAB A;  3ZDH A;  4AFT A;  2X00 D;  5AFN A;  4UM1 A;  5J5G A;  4UY2 A;  4IRE A;  2QC1 B;  2WNJ A;  3GUA A;  4UXU A;  4ZRU A;  4ZJS A;  5BRX A;  2Y54 A;  5AFM B;  2ZJV A;  3TLT A;  4AFG A;  2YMD A;  4HFB A;  4UM3 P;  4EZ1 A;  4TNW A;  4IL9 A;  3WTK A;  5L47 A;  3ZDG A;  4QAA A;  5HEH A;  2WNC A;  4TWF A;  2BYQ A;  3WTO A;  4A98 A;  5J5F A;  3LSV A;  3SH1 A;  3U8K A;  2Y58 A;  2YME A;  4LMJ A;  3WTM A;  4NPP A;  5BP0 A;  4LML A;  2BR8 A;  2BG9 E;  4HFI A;  3U8L A;  4HQP A;  4X5T A;  3JAF A;  3EAM A;  3SQ6 A;  3WTI A;  4B5D A;  5LXB A;  3TLW A;  3UU3 A;  5BW2 A;  3RI5 A;  2XYT A;  5KE4 A;  5HCJ A;  4XHE A;  3TLS A;  3UU4 A;  5HCM A;  2XQ7 A;  3U8M A;  2YN6 A;  5J5H A;  2YOE A;  4BQT A;  4D01 A;  4FRR A;  3JAD A;  2Y7Y A;  5LG3 A;  3ZKR A;  3RIA A;  2XZ5 A;  2PGZ A;  3JAE A;  1UW6 A;  3U8J A;  2Y57 A;  4DBM A;  5L4E A;  3WTN A;  3UUB A;  5JME A;  4ILB A;  2PH9 A;  4NZB A;  1I9B A;  2W8G A;  4TWD A;  2XNU A;  4ZZC A;  4BFQ A;  4F8H A;  3WIP A;  4QAC A;  4XK9 A;  4ZK4 A;  4UM3 A;  3SIO A;  3TLV A;  4ZJT A;  2BYN A;  5IUX A;  4Z90 A;  2XZ6 A;  3EI0 A;  4TWH A;  3IGQ A;  2WN9 A;  5AFJ A;  3UU8 A;  5AIN A;  4QH1 A;  3RQU A;  2BG9 B;  4HFE A;  5CFB A;  5L4H A;  3P4W A;  4ZZB A;  5AFM A;  5HEO A;  5FJV A;  5HEU A;  3UQ4 A;  2XQ5 A;  4A97 A;  2WZY A;  2VL0 A;  2XYS A;  2WNL A;  3UQ7 A;  5TVC A;  2X00 A;  4ZR6 A;  3U8N A;  4ILA A;  3RHW A;  2Y56 A;  3WTJ A;  2XQ6 A;  3PEO A;  2C9T A;  2BR7 A;  3RQW A;  3PMZ A;  4QH5 A;  2W8F A;  2XQ3 A;  3WTH A;  4HFH A;  4ILC A;  5CO5 A;  3WTL A;  5KZU A;  3TLU A;  2BYR A;  5J5I A;  5HEG A;  2BJ0 A;  4UM3 S;  4COF A;  5J0Z A;  2XNV A;  2XQ8 A;  2BYS A;  2BYP A;  3C79 A;  3SQ9 A;  3UU5 A;  5AFK A;  3EHZ A;  2BG9 C;  4PIR A;  2YKS A;  4HFD A;  4WV9 A;  4ZK1 A;  2XQA A;  2UZ6 A;  4ALX A;  5AFH A;  3T4M A;  4IL4 A;  2XNT A;  3C84 A;  4QH4 A;  3P50 A;  2BG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...