5CO5A

Crystal structure of ac-achbp in complex with conotoxin gic
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
207
structure length
207
Chain Sequence
b'SQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of Ac-AChBP in complex with conotoxin GIC
rcsb
source organism Aplysia californica
molecule tags Metal binding protein/toxin
total genus 47
structure length 207
sequence length 207
chains with identical sequence B, D, G, I
ec nomenclature
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5co5A00
3U8LA 5J5GA 5AFMB 3SIOA 3ZDHA 4B5DA 3U8MA 2QC1B 3PEOA 2YOEA 4WV9A 2YMDA 5JMEA 5AFMA 4EZ1A 5AFKA 4A98A 4COFA 4QH5A 3RQWA 5FJVA 3ZKRA 4Z90A 2XNVA 2VL0A 4LMKA 3C79A 5CO5A 4AFGA 2YKSA 4LMLA 3GUAA 4ZRUA 5KZUA 2WNJA 4Z91A 2XQ3A 4TWHA 2WNCA 2W8FA 3JAEA 4ZJSA 4ILBA 4BFQA 5HCJA 4TWDA 5HEHA 3UU5A 2BYRA 4QAAA 3UU6A 4AFHA 4D01A 3C84A 5J0ZA 1UV6A 3EI0A 2WN9A 2X00D 4HFCA 2XQ7A 2PGZA 5SYOA 3UQ7A 2XNTA 3LSVA 4HFDA 3SQ6A 3PMZA 2XZ5A 4ZK4A 3U8JA 2YN6A 4ILAA 5L47A 5J5HA 5HEGA 2XQAA 3WTMA 3WTIA 2Y56A 2XZ6A 5KE4A 4HQPA 4XK9A 3JADA 4NZBA 2BJ0A 5IUXA 3TLTA 3WTJA 2W8GA 4QACA 5LG3A 4UM3A 3RIAA 3WTKA 4UXUA 5LXBA 2UZ6A 2BG9A 3RI5A 4UM1A 4ZK1A 2XYTA 4UM3P 3EAMA 3SQ9A 5BP0A 4UM3S 3RHWA 3WIPA 5J5FA 3U8NA 4TNWA 4F8HA 2BYQA 4ZZBA 4ZJTA 4HFIA 3JAFA 2XQ9A 4UY2A 3TLVA 4XHEA 4BQTA 4ZR6A 5HEOA 2BYSA 4ZZCA 5BW2A 5AFLA 3RIFA 5HCMA 2Y7YA 3T4MA 3UU3A 4IREA 3IGQA 3TLUA 3P50A 4QH1A 3WTHA 2BYNA 3P4WA 4ILCA 2BG9B 1UX2A 4LMJA 3UU4A 4PIRA 4X5TA 4TWFA 2ZJUA 4AFTA 3TLSA 4DBMA 2Y57A 4TNVA 5AFHA 2Y54A 2BG9C 3UU8A 3ZDGA 3UUBA 3WTLA 2XNUA 2BG9E 2XQ4A 1I9BA 4IL9A 2WNLA 4HFEA 2BR8A 2XQ5A 5J5IA 3RQUA 5HEJA 5TVCA 4QH4A 3TLWA 5CFBA 4NPPA 5HEUA 4IL4A 4FRRA 2Y58A 2X00A 4A97A 4HFHA 3WTNA 2PH9A 2ZJVA 5BRXA 3U8KA 5AINA 3EHZA 4ALXA 2BYPA 4HFBA 5AFJA 5AFNA 3WTOA 5L4HA 3SH1A 3UQ4A 2BR7A 4QABA 2XQ8A 1UW6A 2XQ6A 2C9TA 2XYSA 2YMEA 5L4EA 2WZYA
chains in the Genus database with same CATH superfamily
3U8LA 5J5GA 5AFMB 3SIOA 3ZDHA 4B5DA 3U8MA 2QC1B 3PEOA 2YOEA 4WV9A 2YMDA 5JMEA 5AFMA 4EZ1A 5AFKA 4A98A 4COFA 4QH5A 3RQWA 5FJVA 3ZKRA 4Z90A 2XNVA 2VL0A 4LMKA 3C79A 5CO5A 4AFGA 2YKSA 4LMLA 3GUAA 4ZRUA 5KZUA 2WNJA 4Z91A 2XQ3A 4TWHA 2WNCA 2W8FA 3JAEA 4ZJSA 4ILBA 4BFQA 5HCJA 4TWDA 5HEHA 3UU5A 2BYRA 4QAAA 3UU6A 4AFHA 4D01A 3C84A 5J0ZA 1UV6A 3EI0A 2WN9A 2X00D 4HFCA 2XQ7A 2PGZA 5SYOA 3UQ7A 2XNTA 3LSVA 4HFDA 3SQ6A 3PMZA 2XZ5A 4ZK4A 3U8JA 2YN6A 4ILAA 5L47A 5J5HA 5HEGA 2XQAA 3WTMA 3WTIA 2Y56A 2XZ6A 5KE4A 4HQPA 4XK9A 3JADA 4NZBA 2BJ0A 5IUXA 3TLTA 3WTJA 2W8GA 4QACA 5LG3A 4UM3A 3RIAA 3WTKA 4UXUA 5LXBA 2UZ6A 2BG9A 3RI5A 4UM1A 4ZK1A 2XYTA 4UM3P 3EAMA 3SQ9A 5BP0A 4UM3S 3RHWA 3WIPA 5J5FA 3U8NA 4TNWA 4F8HA 2BYQA 4ZZBA 4ZJTA 4HFIA 3JAFA 2XQ9A 4UY2A 3TLVA 4XHEA 4BQTA 4ZR6A 5HEOA 2BYSA 4ZZCA 5BW2A 5AFLA 3RIFA 5HCMA 2Y7YA 3T4MA 3UU3A 4IREA 3IGQA 3TLUA 3P50A 4QH1A 3WTHA 2BYNA 3P4WA 4ILCA 2BG9B 1UX2A 4LMJA 3UU4A 4PIRA 4X5TA 4TWFA 2ZJUA 4AFTA 3TLSA 4DBMA 2Y57A 4TNVA 5AFHA 2Y54A 2BG9C 3UU8A 3ZDGA 3UUBA 3WTLA 2XNUA 2BG9E 2XQ4A 1I9BA 4IL9A 2WNLA 4HFEA 2BR8A 2XQ5A 5J5IA 3RQUA 5HEJA 5TVCA 4QH4A 3TLWA 5CFBA 4NPPA 5HEUA 4IL4A 4FRRA 2Y58A 2X00A 4A97A 4HFHA 3WTNA 2PH9A 2ZJVA 5BRXA 3U8KA 5AINA 3EHZA 4ALXA 2BYPA 4HFBA 5AFJA 5AFNA 3WTOA 5L4HA 3SH1A 3UQ4A 2BR7A 4QABA 2XQ8A 1UW6A 2XQ6A 2C9TA 2XYSA 2YMEA 5L4EA 2WZYA
chains in the Genus database with same CATH topology
3U8LA 5J5GA 5AFMB 3SIOA 3ZDHA 4B5DA 3U8MA 2QC1B 3PEOA 2YOEA 4WV9A 2YMDA 5JMEA 5AFMA 4EZ1A 5AFKA 4A98A 4COFA 4QH5A 3RQWA 5FJVA 3ZKRA 4Z90A 2XNVA 2VL0A 4LMKA 3C79A 5CO5A 4AFGA 2YKSA 4LMLA 3GUAA 4ZRUA 5KZUA 2WNJA 4Z91A 2XQ3A 4TWHA 2WNCA 2W8FA 3JAEA 4ZJSA 4ILBA 4BFQA 5HCJA 4TWDA 5HEHA 3UU5A 2BYRA 4QAAA 3UU6A 4AFHA 4D01A 3C84A 5J0ZA 1UV6A 3EI0A 2WN9A 2X00D 4HFCA 2XQ7A 2PGZA 5SYOA 3UQ7A 2XNTA 3LSVA 4HFDA 3SQ6A 3PMZA 2XZ5A 4ZK4A 3U8JA 2YN6A 4ILAA 5L47A 5J5HA 5HEGA 2XQAA 3WTMA 3WTIA 2Y56A 2XZ6A 5KE4A 4HQPA 4XK9A 3JADA 4NZBA 2BJ0A 5IUXA 3TLTA 3WTJA 2W8GA 4QACA 5LG3A 4UM3A 3RIAA 3WTKA 4UXUA 5LXBA 2UZ6A 2BG9A 3RI5A 4UM1A 4ZK1A 2XYTA 4UM3P 3EAMA 3SQ9A 5BP0A 4UM3S 3RHWA 3WIPA 5J5FA 3U8NA 4TNWA 4F8HA 2BYQA 4ZZBA 4ZJTA 4HFIA 3JAFA 2XQ9A 4UY2A 3TLVA 4XHEA 4BQTA 4ZR6A 5HEOA 2BYSA 4ZZCA 5BW2A 5AFLA 3RIFA 5HCMA 2Y7YA 3T4MA 3UU3A 4IREA 3IGQA 3TLUA 3P50A 4QH1A 3WTHA 2BYNA 3P4WA 4ILCA 2BG9B 1UX2A 4LMJA 3UU4A 4PIRA 4X5TA 4TWFA 2ZJUA 4AFTA 3TLSA 4DBMA 2Y57A 4TNVA 5AFHA 2Y54A 2BG9C 3UU8A 3ZDGA 3UUBA 3WTLA 2XNUA 2BG9E 2XQ4A 1I9BA 4IL9A 2WNLA 4HFEA 2BR8A 2XQ5A 5J5IA 3RQUA 5HEJA 5TVCA 4QH4A 3TLWA 5CFBA 4NPPA 5HEUA 4IL4A 4FRRA 2Y58A 2X00A 4A97A 4HFHA 3WTNA 2PH9A 2ZJVA 5BRXA 3U8KA 5AINA 3EHZA 4ALXA 2BYPA 4HFBA 5AFJA 5AFNA 3WTOA 5L4HA 3SH1A 3UQ4A 2BR7A 4QABA 2XQ8A 1UW6A 2XQ6A 2C9TA 2XYSA 2YMEA 5L4EA 2WZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8L A;  5J5G A;  5AFM B;  3SIO A;  3ZDH A;  4B5D A;  3U8M A;  2QC1 B;  3PEO A;  2YOE A;  4WV9 A;  2YMD A;  5JME A;  5AFM A;  4EZ1 A;  5AFK A;  4A98 A;  4COF A;  4QH5 A;  3RQW A;  5FJV A;  3ZKR A;  4Z90 A;  2XNV A;  2VL0 A;  4LMK A;  3C79 A;  5CO5 A;  4AFG A;  2YKS A;  4LML A;  3GUA A;  4ZRU A;  5KZU A;  2WNJ A;  4Z91 A;  2XQ3 A;  4TWH A;  2WNC A;  2W8F A;  3JAE A;  4ZJS A;  4ILB A;  4BFQ A;  5HCJ A;  4TWD A;  5HEH A;  3UU5 A;  2BYR A;  4QAA A;  3UU6 A;  4AFH A;  4D01 A;  3C84 A;  5J0Z A;  1UV6 A;  3EI0 A;  2WN9 A;  2X00 D;  4HFC A;  2XQ7 A;  2PGZ A;  5SYO A;  3UQ7 A;  2XNT A;  3LSV A;  4HFD A;  3SQ6 A;  3PMZ A;  2XZ5 A;  4ZK4 A;  3U8J A;  2YN6 A;  4ILA A;  5L47 A;  5J5H A;  5HEG A;  2XQA A;  3WTM A;  3WTI A;  2Y56 A;  2XZ6 A;  5KE4 A;  4HQP A;  4XK9 A;  3JAD A;  4NZB A;  2BJ0 A;  5IUX A;  3TLT A;  3WTJ A;  2W8G A;  4QAC A;  5LG3 A;  4UM3 A;  3RIA A;  3WTK A;  4UXU A;  5LXB A;  2UZ6 A;  2BG9 A;  3RI5 A;  4UM1 A;  4ZK1 A;  2XYT A;  4UM3 P;  3EAM A;  3SQ9 A;  5BP0 A;  4UM3 S;  3RHW A;  3WIP A;  5J5F A;  3U8N A;  4TNW A;  4F8H A;  2BYQ A;  4ZZB A;  4ZJT A;  4HFI A;  3JAF A;  2XQ9 A;  4UY2 A;  3TLV A;  4XHE A;  4BQT A;  4ZR6 A;  5HEO A;  2BYS A;  4ZZC A;  5BW2 A;  5AFL A;  3RIF A;  5HCM A;  2Y7Y A;  3T4M A;  3UU3 A;  4IRE A;  3IGQ A;  3TLU A;  3P50 A;  4QH1 A;  3WTH A;  2BYN A;  3P4W A;  4ILC A;  2BG9 B;  1UX2 A;  4LMJ A;  3UU4 A;  4PIR A;  4X5T A;  4TWF A;  2ZJU A;  4AFT A;  3TLS A;  4DBM A;  2Y57 A;  4TNV A;  5AFH A;  2Y54 A;  2BG9 C;  3UU8 A;  3ZDG A;  3UUB A;  3WTL A;  2XNU A;  2BG9 E;  2XQ4 A;  1I9B A;  4IL9 A;  2WNL A;  4HFE A;  2BR8 A;  2XQ5 A;  5J5I A;  3RQU A;  5HEJ A;  5TVC A;  4QH4 A;  3TLW A;  5CFB A;  4NPP A;  5HEU A;  4IL4 A;  4FRR A;  2Y58 A;  2X00 A;  4A97 A;  4HFH A;  3WTN A;  2PH9 A;  2ZJV A;  5BRX A;  3U8K A;  5AIN A;  3EHZ A;  4ALX A;  2BYP A;  4HFB A;  5AFJ A;  5AFN A;  3WTO A;  5L4H A;  3SH1 A;  3UQ4 A;  2BR7 A;  4QAB A;  2XQ8 A;  1UW6 A;  2XQ6 A;  2C9T A;  2XYS A;  2YME A;  5L4E A;  2WZY A; 
#chains in the Genus database with same CATH topology
 3U8L A;  5J5G A;  5AFM B;  3SIO A;  3ZDH A;  4B5D A;  3U8M A;  2QC1 B;  3PEO A;  2YOE A;  4WV9 A;  2YMD A;  5JME A;  5AFM A;  4EZ1 A;  5AFK A;  4A98 A;  4COF A;  4QH5 A;  3RQW A;  5FJV A;  3ZKR A;  4Z90 A;  2XNV A;  2VL0 A;  4LMK A;  3C79 A;  5CO5 A;  4AFG A;  2YKS A;  4LML A;  3GUA A;  4ZRU A;  5KZU A;  2WNJ A;  4Z91 A;  2XQ3 A;  4TWH A;  2WNC A;  2W8F A;  3JAE A;  4ZJS A;  4ILB A;  4BFQ A;  5HCJ A;  4TWD A;  5HEH A;  3UU5 A;  2BYR A;  4QAA A;  3UU6 A;  4AFH A;  4D01 A;  3C84 A;  5J0Z A;  1UV6 A;  3EI0 A;  2WN9 A;  2X00 D;  4HFC A;  2XQ7 A;  2PGZ A;  5SYO A;  3UQ7 A;  2XNT A;  3LSV A;  4HFD A;  3SQ6 A;  3PMZ A;  2XZ5 A;  4ZK4 A;  3U8J A;  2YN6 A;  4ILA A;  5L47 A;  5J5H A;  5HEG A;  2XQA A;  3WTM A;  3WTI A;  2Y56 A;  2XZ6 A;  5KE4 A;  4HQP A;  4XK9 A;  3JAD A;  4NZB A;  2BJ0 A;  5IUX A;  3TLT A;  3WTJ A;  2W8G A;  4QAC A;  5LG3 A;  4UM3 A;  3RIA A;  3WTK A;  4UXU A;  5LXB A;  2UZ6 A;  2BG9 A;  3RI5 A;  4UM1 A;  4ZK1 A;  2XYT A;  4UM3 P;  3EAM A;  3SQ9 A;  5BP0 A;  4UM3 S;  3RHW A;  3WIP A;  5J5F A;  3U8N A;  4TNW A;  4F8H A;  2BYQ A;  4ZZB A;  4ZJT A;  4HFI A;  3JAF A;  2XQ9 A;  4UY2 A;  3TLV A;  4XHE A;  4BQT A;  4ZR6 A;  5HEO A;  2BYS A;  4ZZC A;  5BW2 A;  5AFL A;  3RIF A;  5HCM A;  2Y7Y A;  3T4M A;  3UU3 A;  4IRE A;  3IGQ A;  3TLU A;  3P50 A;  4QH1 A;  3WTH A;  2BYN A;  3P4W A;  4ILC A;  2BG9 B;  1UX2 A;  4LMJ A;  3UU4 A;  4PIR A;  4X5T A;  4TWF A;  2ZJU A;  4AFT A;  3TLS A;  4DBM A;  2Y57 A;  4TNV A;  5AFH A;  2Y54 A;  2BG9 C;  3UU8 A;  3ZDG A;  3UUB A;  3WTL A;  2XNU A;  2BG9 E;  2XQ4 A;  1I9B A;  4IL9 A;  2WNL A;  4HFE A;  2BR8 A;  2XQ5 A;  5J5I A;  3RQU A;  5HEJ A;  5TVC A;  4QH4 A;  3TLW A;  5CFB A;  4NPP A;  5HEU A;  4IL4 A;  4FRR A;  2Y58 A;  2X00 A;  4A97 A;  4HFH A;  3WTN A;  2PH9 A;  2ZJV A;  5BRX A;  3U8K A;  5AIN A;  3EHZ A;  4ALX A;  2BYP A;  4HFB A;  5AFJ A;  5AFN A;  3WTO A;  5L4H A;  3SH1 A;  3UQ4 A;  2BR7 A;  4QAB A;  2XQ8 A;  1UW6 A;  2XQ6 A;  2C9T A;  2XYS A;  2YME A;  5L4E A;  2WZY A; 
#chains in the Genus database with same CATH homology
 3U8L A;  5J5G A;  5AFM B;  3SIO A;  3ZDH A;  4B5D A;  3U8M A;  2QC1 B;  3PEO A;  2YOE A;  4WV9 A;  2YMD A;  5JME A;  5AFM A;  4EZ1 A;  5AFK A;  4A98 A;  4COF A;  4QH5 A;  3RQW A;  5FJV A;  3ZKR A;  4Z90 A;  2XNV A;  2VL0 A;  4LMK A;  3C79 A;  5CO5 A;  4AFG A;  2YKS A;  4LML A;  3GUA A;  4ZRU A;  5KZU A;  2WNJ A;  4Z91 A;  2XQ3 A;  4TWH A;  2WNC A;  2W8F A;  3JAE A;  4ZJS A;  4ILB A;  4BFQ A;  5HCJ A;  4TWD A;  5HEH A;  3UU5 A;  2BYR A;  4QAA A;  3UU6 A;  4AFH A;  4D01 A;  3C84 A;  5J0Z A;  1UV6 A;  3EI0 A;  2WN9 A;  2X00 D;  4HFC A;  2XQ7 A;  2PGZ A;  5SYO A;  3UQ7 A;  2XNT A;  3LSV A;  4HFD A;  3SQ6 A;  3PMZ A;  2XZ5 A;  4ZK4 A;  3U8J A;  2YN6 A;  4ILA A;  5L47 A;  5J5H A;  5HEG A;  2XQA A;  3WTM A;  3WTI A;  2Y56 A;  2XZ6 A;  5KE4 A;  4HQP A;  4XK9 A;  3JAD A;  4NZB A;  2BJ0 A;  5IUX A;  3TLT A;  3WTJ A;  2W8G A;  4QAC A;  5LG3 A;  4UM3 A;  3RIA A;  3WTK A;  4UXU A;  5LXB A;  2UZ6 A;  2BG9 A;  3RI5 A;  4UM1 A;  4ZK1 A;  2XYT A;  4UM3 P;  3EAM A;  3SQ9 A;  5BP0 A;  4UM3 S;  3RHW A;  3WIP A;  5J5F A;  3U8N A;  4TNW A;  4F8H A;  2BYQ A;  4ZZB A;  4ZJT A;  4HFI A;  3JAF A;  2XQ9 A;  4UY2 A;  3TLV A;  4XHE A;  4BQT A;  4ZR6 A;  5HEO A;  2BYS A;  4ZZC A;  5BW2 A;  5AFL A;  3RIF A;  5HCM A;  2Y7Y A;  3T4M A;  3UU3 A;  4IRE A;  3IGQ A;  3TLU A;  3P50 A;  4QH1 A;  3WTH A;  2BYN A;  3P4W A;  4ILC A;  2BG9 B;  1UX2 A;  4LMJ A;  3UU4 A;  4PIR A;  4X5T A;  4TWF A;  2ZJU A;  4AFT A;  3TLS A;  4DBM A;  2Y57 A;  4TNV A;  5AFH A;  2Y54 A;  2BG9 C;  3UU8 A;  3ZDG A;  3UUB A;  3WTL A;  2XNU A;  2BG9 E;  2XQ4 A;  1I9B A;  4IL9 A;  2WNL A;  4HFE A;  2BR8 A;  2XQ5 A;  5J5I A;  3RQU A;  5HEJ A;  5TVC A;  4QH4 A;  3TLW A;  5CFB A;  4NPP A;  5HEU A;  4IL4 A;  4FRR A;  2Y58 A;  2X00 A;  4A97 A;  4HFH A;  3WTN A;  2PH9 A;  2ZJV A;  5BRX A;  3U8K A;  5AIN A;  3EHZ A;  4ALX A;  2BYP A;  4HFB A;  5AFJ A;  5AFN A;  3WTO A;  5L4H A;  3SH1 A;  3UQ4 A;  2BR7 A;  4QAB A;  2XQ8 A;  1UW6 A;  2XQ6 A;  2C9T A;  2XYS A;  2YME A;  5L4E A;  2WZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...