2XZ5A

Mmts-modified y53c mutant of aplysia achbp in complex with acetylcholine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
206
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Cysteine-Modified Mutant in Loop D of Acetylcholine Binding Protein
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 48
structure length 206
sequence length 207
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xz5A00
4X5TA 3JADA 3UU8A 2PGZA 2X00D 2YKSA 4QH4A 4UM3P 3SIOA 5LG3A 2Y57A 4TWHA 5KZUA 2X00A 3RQWA 4D01A 3WTNA 3WTJA 3P50A 4UY2A 2BR7A 2XQAA 3TLWA 2BG9A 4A97A 3SQ6A 5J5HA 4UM3A 3EHZA 4QAAA 4Z90A 5HEHA 4NPPA 4QH1A 5JMEA 4IL4A 2XQ7A 4UM3S 3GUAA 4UXUA 3EAMA 2XQ4A 4BFQA 2BJ0A 5HEJA 4QABA 2XZ5A 4ZZBA 5AFHA 4A98A 5CFBA 5AFMB 2YMEA 3WTLA 4ILBA 3P4WA 4B5DA 4WV9A 4HQPA 4F8HA 2YN6A 4XHEA 3UU4A 3WTMA 4AFTA 3WTOA 5J5FA 4EZ1A 4PIRA 3U8NA 1I9BA 4TNWA 3C84A 5L47A 4COFA 3C79A 3EI0A 5TVCA 3TLUA 4Z91A 4ALXA 3WTIA 2Y7YA 2W8FA 5L4HA 2Y56A 5LXBA 3U8KA 2W8GA 5L4EA 5SYOA 2BYRA 5KE4A 3JAFA 4HFEA 5CO5A 5BRXA 3UQ7A 4AFGA 4LMJA 5J0ZA 2XNTA 3PMZA 2ZJVA 3UU6A 2XQ6A 5AFLA 4TNVA 4LMLA 3SQ9A 2WNLA 2XQ9A 2BYNA 4ZR6A 3WIPA 5AFJA 3U8LA 5J5IA 4ZZCA 2WNJA 5FJVA 3JAEA 3TLTA 4HFCA 4ZJSA 4BQTA 5IUXA 4LMKA 1UV6A 3WTHA 4ZRUA 4UM1A 3TLVA 1UX2A 3UU5A 2UZ6A 4QH5A 3U8MA 3UU3A 5AINA 4ILAA 5BP0A 2XZ6A 3ZKRA 5AFMA 2ZJUA 2XQ8A 3UUBA 4HFIA 4ZJTA 2BYPA 2XYSA 2WN9A 4XK9A 2BG9B 3U8JA 3ZDHA 2XNUA 3SH1A 2Y58A 3PEOA 2BYSA 2YMDA 3RIAA 2XQ3A 5BW2A 4HFBA 3WTKA 4TWFA 2BYQA 4DBMA 4NZBA 1UW6A 2XNVA 5HEGA 5J5GA 2BR8A 2C9TA 2PH9A 3RQUA 2XQ5A 4AFHA 2BG9C 5AFNA 4ILCA 4QACA 4ZK1A 2VL0A 3TLSA 5HCJA 4ZK4A 3RI5A 2BG9E 3UQ4A 3IGQA 4FRRA 5HEOA 3ZDGA 4HFDA 3LSVA 5HEUA 3T4MA 5AFKA 2QC1B 2WZYA 2XYTA 4IREA 2YOEA 4IL9A 4HFHA 3RHWA 2Y54A 3RIFA 5HCMA 4TWDA 2WNCA
chains in the Genus database with same CATH superfamily
4X5TA 3JADA 3UU8A 2PGZA 2X00D 2YKSA 4QH4A 4UM3P 3SIOA 5LG3A 2Y57A 4TWHA 5KZUA 2X00A 3RQWA 4D01A 3WTNA 3WTJA 3P50A 4UY2A 2BR7A 2XQAA 3TLWA 2BG9A 4A97A 3SQ6A 5J5HA 4UM3A 3EHZA 4QAAA 4Z90A 5HEHA 4NPPA 4QH1A 5JMEA 4IL4A 2XQ7A 4UM3S 3GUAA 4UXUA 3EAMA 2XQ4A 4BFQA 2BJ0A 5HEJA 4QABA 2XZ5A 4ZZBA 5AFHA 4A98A 5CFBA 5AFMB 2YMEA 3WTLA 4ILBA 3P4WA 4B5DA 4WV9A 4HQPA 4F8HA 2YN6A 4XHEA 3UU4A 3WTMA 4AFTA 3WTOA 5J5FA 4EZ1A 4PIRA 3U8NA 1I9BA 4TNWA 3C84A 5L47A 4COFA 3C79A 3EI0A 5TVCA 3TLUA 4Z91A 4ALXA 3WTIA 2Y7YA 2W8FA 5L4HA 2Y56A 5LXBA 3U8KA 2W8GA 5L4EA 5SYOA 2BYRA 5KE4A 3JAFA 4HFEA 5CO5A 5BRXA 3UQ7A 4AFGA 4LMJA 5J0ZA 2XNTA 3PMZA 2ZJVA 3UU6A 2XQ6A 5AFLA 4TNVA 4LMLA 3SQ9A 2WNLA 2XQ9A 2BYNA 4ZR6A 3WIPA 5AFJA 3U8LA 5J5IA 4ZZCA 2WNJA 5FJVA 3JAEA 3TLTA 4HFCA 4ZJSA 4BQTA 5IUXA 4LMKA 1UV6A 3WTHA 4ZRUA 4UM1A 3TLVA 1UX2A 3UU5A 2UZ6A 4QH5A 3U8MA 3UU3A 5AINA 4ILAA 5BP0A 2XZ6A 3ZKRA 5AFMA 2ZJUA 2XQ8A 3UUBA 4HFIA 4ZJTA 2BYPA 2XYSA 2WN9A 4XK9A 2BG9B 3U8JA 3ZDHA 2XNUA 3SH1A 2Y58A 3PEOA 2BYSA 2YMDA 3RIAA 2XQ3A 5BW2A 4HFBA 3WTKA 4TWFA 2BYQA 4DBMA 4NZBA 1UW6A 2XNVA 5HEGA 5J5GA 2BR8A 2C9TA 2PH9A 3RQUA 2XQ5A 4AFHA 2BG9C 5AFNA 4ILCA 4QACA 4ZK1A 2VL0A 3TLSA 5HCJA 4ZK4A 3RI5A 2BG9E 3UQ4A 3IGQA 4FRRA 5HEOA 3ZDGA 4HFDA 3LSVA 5HEUA 3T4MA 5AFKA 2QC1B 2WZYA 2XYTA 4IREA 2YOEA 4IL9A 4HFHA 3RHWA 2Y54A 3RIFA 5HCMA 4TWDA 2WNCA
chains in the Genus database with same CATH topology
4X5TA 3JADA 3UU8A 2PGZA 2X00D 2YKSA 4QH4A 4UM3P 3SIOA 5LG3A 2Y57A 4TWHA 5KZUA 2X00A 3RQWA 4D01A 3WTNA 3WTJA 3P50A 4UY2A 2BR7A 2XQAA 3TLWA 2BG9A 4A97A 3SQ6A 5J5HA 4UM3A 3EHZA 4QAAA 4Z90A 5HEHA 4NPPA 4QH1A 5JMEA 4IL4A 2XQ7A 4UM3S 3GUAA 4UXUA 3EAMA 2XQ4A 4BFQA 2BJ0A 5HEJA 4QABA 2XZ5A 4ZZBA 5AFHA 4A98A 5CFBA 5AFMB 2YMEA 3WTLA 4ILBA 3P4WA 4B5DA 4WV9A 4HQPA 4F8HA 2YN6A 4XHEA 3UU4A 3WTMA 4AFTA 3WTOA 5J5FA 4EZ1A 4PIRA 3U8NA 1I9BA 4TNWA 3C84A 5L47A 4COFA 3C79A 3EI0A 5TVCA 3TLUA 4Z91A 4ALXA 3WTIA 2Y7YA 2W8FA 5L4HA 2Y56A 5LXBA 3U8KA 2W8GA 5L4EA 5SYOA 2BYRA 5KE4A 3JAFA 4HFEA 5CO5A 5BRXA 3UQ7A 4AFGA 4LMJA 5J0ZA 2XNTA 3PMZA 2ZJVA 3UU6A 2XQ6A 5AFLA 4TNVA 4LMLA 3SQ9A 2WNLA 2XQ9A 2BYNA 4ZR6A 3WIPA 5AFJA 3U8LA 5J5IA 4ZZCA 2WNJA 5FJVA 3JAEA 3TLTA 4HFCA 4ZJSA 4BQTA 5IUXA 4LMKA 1UV6A 3WTHA 4ZRUA 4UM1A 3TLVA 1UX2A 3UU5A 2UZ6A 4QH5A 3U8MA 3UU3A 5AINA 4ILAA 5BP0A 2XZ6A 3ZKRA 5AFMA 2ZJUA 2XQ8A 3UUBA 4HFIA 4ZJTA 2BYPA 2XYSA 2WN9A 4XK9A 2BG9B 3U8JA 3ZDHA 2XNUA 3SH1A 2Y58A 3PEOA 2BYSA 2YMDA 3RIAA 2XQ3A 5BW2A 4HFBA 3WTKA 4TWFA 2BYQA 4DBMA 4NZBA 1UW6A 2XNVA 5HEGA 5J5GA 2BR8A 2C9TA 2PH9A 3RQUA 2XQ5A 4AFHA 2BG9C 5AFNA 4ILCA 4QACA 4ZK1A 2VL0A 3TLSA 5HCJA 4ZK4A 3RI5A 2BG9E 3UQ4A 3IGQA 4FRRA 5HEOA 3ZDGA 4HFDA 3LSVA 5HEUA 3T4MA 5AFKA 2QC1B 2WZYA 2XYTA 4IREA 2YOEA 4IL9A 4HFHA 3RHWA 2Y54A 3RIFA 5HCMA 4TWDA 2WNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5T A;  3JAD A;  3UU8 A;  2PGZ A;  2X00 D;  2YKS A;  4QH4 A;  4UM3 P;  3SIO A;  5LG3 A;  2Y57 A;  4TWH A;  5KZU A;  2X00 A;  3RQW A;  4D01 A;  3WTN A;  3WTJ A;  3P50 A;  4UY2 A;  2BR7 A;  2XQA A;  3TLW A;  2BG9 A;  4A97 A;  3SQ6 A;  5J5H A;  4UM3 A;  3EHZ A;  4QAA A;  4Z90 A;  5HEH A;  4NPP A;  4QH1 A;  5JME A;  4IL4 A;  2XQ7 A;  4UM3 S;  3GUA A;  4UXU A;  3EAM A;  2XQ4 A;  4BFQ A;  2BJ0 A;  5HEJ A;  4QAB A;  2XZ5 A;  4ZZB A;  5AFH A;  4A98 A;  5CFB A;  5AFM B;  2YME A;  3WTL A;  4ILB A;  3P4W A;  4B5D A;  4WV9 A;  4HQP A;  4F8H A;  2YN6 A;  4XHE A;  3UU4 A;  3WTM A;  4AFT A;  3WTO A;  5J5F A;  4EZ1 A;  4PIR A;  3U8N A;  1I9B A;  4TNW A;  3C84 A;  5L47 A;  4COF A;  3C79 A;  3EI0 A;  5TVC A;  3TLU A;  4Z91 A;  4ALX A;  3WTI A;  2Y7Y A;  2W8F A;  5L4H A;  2Y56 A;  5LXB A;  3U8K A;  2W8G A;  5L4E A;  5SYO A;  2BYR A;  5KE4 A;  3JAF A;  4HFE A;  5CO5 A;  5BRX A;  3UQ7 A;  4AFG A;  4LMJ A;  5J0Z A;  2XNT A;  3PMZ A;  2ZJV A;  3UU6 A;  2XQ6 A;  5AFL A;  4TNV A;  4LML A;  3SQ9 A;  2WNL A;  2XQ9 A;  2BYN A;  4ZR6 A;  3WIP A;  5AFJ A;  3U8L A;  5J5I A;  4ZZC A;  2WNJ A;  5FJV A;  3JAE A;  3TLT A;  4HFC A;  4ZJS A;  4BQT A;  5IUX A;  4LMK A;  1UV6 A;  3WTH A;  4ZRU A;  4UM1 A;  3TLV A;  1UX2 A;  3UU5 A;  2UZ6 A;  4QH5 A;  3U8M A;  3UU3 A;  5AIN A;  4ILA A;  5BP0 A;  2XZ6 A;  3ZKR A;  5AFM A;  2ZJU A;  2XQ8 A;  3UUB A;  4HFI A;  4ZJT A;  2BYP A;  2XYS A;  2WN9 A;  4XK9 A;  2BG9 B;  3U8J A;  3ZDH A;  2XNU A;  3SH1 A;  2Y58 A;  3PEO A;  2BYS A;  2YMD A;  3RIA A;  2XQ3 A;  5BW2 A;  4HFB A;  3WTK A;  4TWF A;  2BYQ A;  4DBM A;  4NZB A;  1UW6 A;  2XNV A;  5HEG A;  5J5G A;  2BR8 A;  2C9T A;  2PH9 A;  3RQU A;  2XQ5 A;  4AFH A;  2BG9 C;  5AFN A;  4ILC A;  4QAC A;  4ZK1 A;  2VL0 A;  3TLS A;  5HCJ A;  4ZK4 A;  3RI5 A;  2BG9 E;  3UQ4 A;  3IGQ A;  4FRR A;  5HEO A;  3ZDG A;  4HFD A;  3LSV A;  5HEU A;  3T4M A;  5AFK A;  2QC1 B;  2WZY A;  2XYT A;  4IRE A;  2YOE A;  4IL9 A;  4HFH A;  3RHW A;  2Y54 A;  3RIF A;  5HCM A;  4TWD A;  2WNC A; 
#chains in the Genus database with same CATH topology
 4X5T A;  3JAD A;  3UU8 A;  2PGZ A;  2X00 D;  2YKS A;  4QH4 A;  4UM3 P;  3SIO A;  5LG3 A;  2Y57 A;  4TWH A;  5KZU A;  2X00 A;  3RQW A;  4D01 A;  3WTN A;  3WTJ A;  3P50 A;  4UY2 A;  2BR7 A;  2XQA A;  3TLW A;  2BG9 A;  4A97 A;  3SQ6 A;  5J5H A;  4UM3 A;  3EHZ A;  4QAA A;  4Z90 A;  5HEH A;  4NPP A;  4QH1 A;  5JME A;  4IL4 A;  2XQ7 A;  4UM3 S;  3GUA A;  4UXU A;  3EAM A;  2XQ4 A;  4BFQ A;  2BJ0 A;  5HEJ A;  4QAB A;  2XZ5 A;  4ZZB A;  5AFH A;  4A98 A;  5CFB A;  5AFM B;  2YME A;  3WTL A;  4ILB A;  3P4W A;  4B5D A;  4WV9 A;  4HQP A;  4F8H A;  2YN6 A;  4XHE A;  3UU4 A;  3WTM A;  4AFT A;  3WTO A;  5J5F A;  4EZ1 A;  4PIR A;  3U8N A;  1I9B A;  4TNW A;  3C84 A;  5L47 A;  4COF A;  3C79 A;  3EI0 A;  5TVC A;  3TLU A;  4Z91 A;  4ALX A;  3WTI A;  2Y7Y A;  2W8F A;  5L4H A;  2Y56 A;  5LXB A;  3U8K A;  2W8G A;  5L4E A;  5SYO A;  2BYR A;  5KE4 A;  3JAF A;  4HFE A;  5CO5 A;  5BRX A;  3UQ7 A;  4AFG A;  4LMJ A;  5J0Z A;  2XNT A;  3PMZ A;  2ZJV A;  3UU6 A;  2XQ6 A;  5AFL A;  4TNV A;  4LML A;  3SQ9 A;  2WNL A;  2XQ9 A;  2BYN A;  4ZR6 A;  3WIP A;  5AFJ A;  3U8L A;  5J5I A;  4ZZC A;  2WNJ A;  5FJV A;  3JAE A;  3TLT A;  4HFC A;  4ZJS A;  4BQT A;  5IUX A;  4LMK A;  1UV6 A;  3WTH A;  4ZRU A;  4UM1 A;  3TLV A;  1UX2 A;  3UU5 A;  2UZ6 A;  4QH5 A;  3U8M A;  3UU3 A;  5AIN A;  4ILA A;  5BP0 A;  2XZ6 A;  3ZKR A;  5AFM A;  2ZJU A;  2XQ8 A;  3UUB A;  4HFI A;  4ZJT A;  2BYP A;  2XYS A;  2WN9 A;  4XK9 A;  2BG9 B;  3U8J A;  3ZDH A;  2XNU A;  3SH1 A;  2Y58 A;  3PEO A;  2BYS A;  2YMD A;  3RIA A;  2XQ3 A;  5BW2 A;  4HFB A;  3WTK A;  4TWF A;  2BYQ A;  4DBM A;  4NZB A;  1UW6 A;  2XNV A;  5HEG A;  5J5G A;  2BR8 A;  2C9T A;  2PH9 A;  3RQU A;  2XQ5 A;  4AFH A;  2BG9 C;  5AFN A;  4ILC A;  4QAC A;  4ZK1 A;  2VL0 A;  3TLS A;  5HCJ A;  4ZK4 A;  3RI5 A;  2BG9 E;  3UQ4 A;  3IGQ A;  4FRR A;  5HEO A;  3ZDG A;  4HFD A;  3LSV A;  5HEU A;  3T4M A;  5AFK A;  2QC1 B;  2WZY A;  2XYT A;  4IRE A;  2YOE A;  4IL9 A;  4HFH A;  3RHW A;  2Y54 A;  3RIF A;  5HCM A;  4TWD A;  2WNC A; 
#chains in the Genus database with same CATH homology
 4X5T A;  3JAD A;  3UU8 A;  2PGZ A;  2X00 D;  2YKS A;  4QH4 A;  4UM3 P;  3SIO A;  5LG3 A;  2Y57 A;  4TWH A;  5KZU A;  2X00 A;  3RQW A;  4D01 A;  3WTN A;  3WTJ A;  3P50 A;  4UY2 A;  2BR7 A;  2XQA A;  3TLW A;  2BG9 A;  4A97 A;  3SQ6 A;  5J5H A;  4UM3 A;  3EHZ A;  4QAA A;  4Z90 A;  5HEH A;  4NPP A;  4QH1 A;  5JME A;  4IL4 A;  2XQ7 A;  4UM3 S;  3GUA A;  4UXU A;  3EAM A;  2XQ4 A;  4BFQ A;  2BJ0 A;  5HEJ A;  4QAB A;  2XZ5 A;  4ZZB A;  5AFH A;  4A98 A;  5CFB A;  5AFM B;  2YME A;  3WTL A;  4ILB A;  3P4W A;  4B5D A;  4WV9 A;  4HQP A;  4F8H A;  2YN6 A;  4XHE A;  3UU4 A;  3WTM A;  4AFT A;  3WTO A;  5J5F A;  4EZ1 A;  4PIR A;  3U8N A;  1I9B A;  4TNW A;  3C84 A;  5L47 A;  4COF A;  3C79 A;  3EI0 A;  5TVC A;  3TLU A;  4Z91 A;  4ALX A;  3WTI A;  2Y7Y A;  2W8F A;  5L4H A;  2Y56 A;  5LXB A;  3U8K A;  2W8G A;  5L4E A;  5SYO A;  2BYR A;  5KE4 A;  3JAF A;  4HFE A;  5CO5 A;  5BRX A;  3UQ7 A;  4AFG A;  4LMJ A;  5J0Z A;  2XNT A;  3PMZ A;  2ZJV A;  3UU6 A;  2XQ6 A;  5AFL A;  4TNV A;  4LML A;  3SQ9 A;  2WNL A;  2XQ9 A;  2BYN A;  4ZR6 A;  3WIP A;  5AFJ A;  3U8L A;  5J5I A;  4ZZC A;  2WNJ A;  5FJV A;  3JAE A;  3TLT A;  4HFC A;  4ZJS A;  4BQT A;  5IUX A;  4LMK A;  1UV6 A;  3WTH A;  4ZRU A;  4UM1 A;  3TLV A;  1UX2 A;  3UU5 A;  2UZ6 A;  4QH5 A;  3U8M A;  3UU3 A;  5AIN A;  4ILA A;  5BP0 A;  2XZ6 A;  3ZKR A;  5AFM A;  2ZJU A;  2XQ8 A;  3UUB A;  4HFI A;  4ZJT A;  2BYP A;  2XYS A;  2WN9 A;  4XK9 A;  2BG9 B;  3U8J A;  3ZDH A;  2XNU A;  3SH1 A;  2Y58 A;  3PEO A;  2BYS A;  2YMD A;  3RIA A;  2XQ3 A;  5BW2 A;  4HFB A;  3WTK A;  4TWF A;  2BYQ A;  4DBM A;  4NZB A;  1UW6 A;  2XNV A;  5HEG A;  5J5G A;  2BR8 A;  2C9T A;  2PH9 A;  3RQU A;  2XQ5 A;  4AFH A;  2BG9 C;  5AFN A;  4ILC A;  4QAC A;  4ZK1 A;  2VL0 A;  3TLS A;  5HCJ A;  4ZK4 A;  3RI5 A;  2BG9 E;  3UQ4 A;  3IGQ A;  4FRR A;  5HEO A;  3ZDG A;  4HFD A;  3LSV A;  5HEU A;  3T4M A;  5AFK A;  2QC1 B;  2WZY A;  2XYT A;  4IRE A;  2YOE A;  4IL9 A;  4HFH A;  3RHW A;  2Y54 A;  3RIF A;  5HCM A;  4TWD A;  2WNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...