2Y58A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (compound 6)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y58A00
2ZJUA 3UU4A 5KZUA 4A97A 1UV6A 4NZBA 4QH1A 4ZK1A 2YN6A 2XQ5A 5HCJA 4XK9A 3T4MA 4X5TA 2BR7A 2XQ7A 4BQTA 4QH5A 3TLSA 4LMKA 5SYOA 5J5FA 2BYRA 2QC1B 4UM3A 4DBMA 5J5HA 3JAEA 2XQ3A 5AFMB 4FRRA 3WTHA 4ILAA 2YOEA 5IUXA 4QH4A 1UX2A 4F8HA 2BYPA 4HFIA 2XNTA 3SQ6A 4ZJSA 3RQWA 2VL0A 5HEHA 4PIRA 4LMLA 4HFDA 3P4WA 4HFEA 4ZR6A 3LSVA 2W8GA 2YMEA 4IL9A 5HCMA 2WNCA 3EAMA 4COFA 2WZYA 2Y57A 3ZDGA 3TLTA 3WTMA 2BYSA 5J5GA 4QABA 2XYSA 3UU8A 4UM1A 3WTIA 5AFNA 2XNVA 4QACA 4TNWA 4ZRUA 3SIOA 3C79A 3U8KA 2BYQA 2PH9A 3PEOA 2BR8A 3U8JA 5BW2A 3IGQA 2XQ8A 2XZ5A 5KE4A 2WNJA 2PGZA 3WTNA 4HFBA 3U8MA 3WIPA 3EI0A 5TVCA 2XQ4A 2YKSA 4XHEA 3RIFA 2Y56A 2X00A 5HEOA 3UU3A 4HQPA 3WTKA 3U8NA 3UU6A 5AFKA 5BRXA 3GUAA 5J0ZA 3UUBA 4HFHA 3TLVA 5J5IA 4QAAA 4AFTA 5HEUA 2C9TA 4ALXA 4ZZBA 2XQ6A 5HEGA 3SH1A 3WTJA 4EZ1A 2BG9C 2UZ6A 2Y54A 5LXBA 3C84A 4BFQA 4ZZCA 3RQUA 2BG9B 5HEJA 4UM3S 2W8FA 2Y7YA 1UW6A 2BG9E 5AFHA 5AFMA 2WNLA 5L47A 2YMDA 5CO5A 4Z90A 4ILBA 4WV9A 3TLWA 4AFGA 2X00D 1I9BA 5AINA 4ILCA 3U8LA 2XZ6A 4ZK4A 4TWHA 5CFBA 3JAFA 4Z91A 5L4HA 5LG3A 4HFCA 2XNUA 3WTLA 3ZDHA 5BP0A 3JADA 3WTOA 2BG9A 4A98A 5L4EA 3UQ7A 4TNVA 2XYTA 3RHWA 4UM3P 3RI5A 3UQ4A 4IREA 4UXUA 3SQ9A 3ZKRA 4AFHA 4B5DA 4ZJTA 2BYNA 4TWDA 2ZJVA 5JMEA 2XQ9A 4LMJA 3EHZA 2BJ0A 2XQAA 5FJVA 2Y58A 4UY2A 3RIAA 2WN9A 5AFJA 3TLUA 4IL4A 5AFLA 4NPPA 3P50A 3PMZA 3UU5A 4TWFA 4D01A
chains in the Genus database with same CATH superfamily
2ZJUA 3UU4A 5KZUA 4A97A 1UV6A 4NZBA 4QH1A 4ZK1A 2YN6A 2XQ5A 5HCJA 4XK9A 3T4MA 4X5TA 2BR7A 2XQ7A 4BQTA 4QH5A 3TLSA 4LMKA 5SYOA 5J5FA 2BYRA 2QC1B 4UM3A 4DBMA 5J5HA 3JAEA 2XQ3A 5AFMB 4FRRA 3WTHA 4ILAA 2YOEA 5IUXA 4QH4A 1UX2A 4F8HA 2BYPA 4HFIA 2XNTA 3SQ6A 4ZJSA 3RQWA 2VL0A 5HEHA 4PIRA 4LMLA 4HFDA 3P4WA 4HFEA 4ZR6A 3LSVA 2W8GA 2YMEA 4IL9A 5HCMA 2WNCA 3EAMA 4COFA 2WZYA 2Y57A 3ZDGA 3TLTA 3WTMA 2BYSA 5J5GA 4QABA 2XYSA 3UU8A 4UM1A 3WTIA 5AFNA 2XNVA 4QACA 4TNWA 4ZRUA 3SIOA 3C79A 3U8KA 2BYQA 2PH9A 3PEOA 2BR8A 3U8JA 5BW2A 3IGQA 2XQ8A 2XZ5A 5KE4A 2WNJA 2PGZA 3WTNA 4HFBA 3U8MA 3WIPA 3EI0A 5TVCA 2XQ4A 2YKSA 4XHEA 3RIFA 2Y56A 2X00A 5HEOA 3UU3A 4HQPA 3WTKA 3U8NA 3UU6A 5AFKA 5BRXA 3GUAA 5J0ZA 3UUBA 4HFHA 3TLVA 5J5IA 4QAAA 4AFTA 5HEUA 2C9TA 4ALXA 4ZZBA 2XQ6A 5HEGA 3SH1A 3WTJA 4EZ1A 2BG9C 2UZ6A 2Y54A 5LXBA 3C84A 4BFQA 4ZZCA 3RQUA 2BG9B 5HEJA 4UM3S 2W8FA 2Y7YA 1UW6A 2BG9E 5AFHA 5AFMA 2WNLA 5L47A 2YMDA 5CO5A 4Z90A 4ILBA 4WV9A 3TLWA 4AFGA 2X00D 1I9BA 5AINA 4ILCA 3U8LA 2XZ6A 4ZK4A 4TWHA 5CFBA 3JAFA 4Z91A 5L4HA 5LG3A 4HFCA 2XNUA 3WTLA 3ZDHA 5BP0A 3JADA 3WTOA 2BG9A 4A98A 5L4EA 3UQ7A 4TNVA 2XYTA 3RHWA 4UM3P 3RI5A 3UQ4A 4IREA 4UXUA 3SQ9A 3ZKRA 4AFHA 4B5DA 4ZJTA 2BYNA 4TWDA 2ZJVA 5JMEA 2XQ9A 4LMJA 3EHZA 2BJ0A 2XQAA 5FJVA 2Y58A 4UY2A 3RIAA 2WN9A 5AFJA 3TLUA 4IL4A 5AFLA 4NPPA 3P50A 3PMZA 3UU5A 4TWFA 4D01A
chains in the Genus database with same CATH topology
2ZJUA 3UU4A 5KZUA 4A97A 1UV6A 4NZBA 4QH1A 4ZK1A 2YN6A 2XQ5A 5HCJA 4XK9A 3T4MA 4X5TA 2BR7A 2XQ7A 4BQTA 4QH5A 3TLSA 4LMKA 5SYOA 5J5FA 2BYRA 2QC1B 4UM3A 4DBMA 5J5HA 3JAEA 2XQ3A 5AFMB 4FRRA 3WTHA 4ILAA 2YOEA 5IUXA 4QH4A 1UX2A 4F8HA 2BYPA 4HFIA 2XNTA 3SQ6A 4ZJSA 3RQWA 2VL0A 5HEHA 4PIRA 4LMLA 4HFDA 3P4WA 4HFEA 4ZR6A 3LSVA 2W8GA 2YMEA 4IL9A 5HCMA 2WNCA 3EAMA 4COFA 2WZYA 2Y57A 3ZDGA 3TLTA 3WTMA 2BYSA 5J5GA 4QABA 2XYSA 3UU8A 4UM1A 3WTIA 5AFNA 2XNVA 4QACA 4TNWA 4ZRUA 3SIOA 3C79A 3U8KA 2BYQA 2PH9A 3PEOA 2BR8A 3U8JA 5BW2A 3IGQA 2XQ8A 2XZ5A 5KE4A 2WNJA 2PGZA 3WTNA 4HFBA 3U8MA 3WIPA 3EI0A 5TVCA 2XQ4A 2YKSA 4XHEA 3RIFA 2Y56A 2X00A 5HEOA 3UU3A 4HQPA 3WTKA 3U8NA 3UU6A 5AFKA 5BRXA 3GUAA 5J0ZA 3UUBA 4HFHA 3TLVA 5J5IA 4QAAA 4AFTA 5HEUA 2C9TA 4ALXA 4ZZBA 2XQ6A 5HEGA 3SH1A 3WTJA 4EZ1A 2BG9C 2UZ6A 2Y54A 5LXBA 3C84A 4BFQA 4ZZCA 3RQUA 2BG9B 5HEJA 4UM3S 2W8FA 2Y7YA 1UW6A 2BG9E 5AFHA 5AFMA 2WNLA 5L47A 2YMDA 5CO5A 4Z90A 4ILBA 4WV9A 3TLWA 4AFGA 2X00D 1I9BA 5AINA 4ILCA 3U8LA 2XZ6A 4ZK4A 4TWHA 5CFBA 3JAFA 4Z91A 5L4HA 5LG3A 4HFCA 2XNUA 3WTLA 3ZDHA 5BP0A 3JADA 3WTOA 2BG9A 4A98A 5L4EA 3UQ7A 4TNVA 2XYTA 3RHWA 4UM3P 3RI5A 3UQ4A 4IREA 4UXUA 3SQ9A 3ZKRA 4AFHA 4B5DA 4ZJTA 2BYNA 4TWDA 2ZJVA 5JMEA 2XQ9A 4LMJA 3EHZA 2BJ0A 2XQAA 5FJVA 2Y58A 4UY2A 3RIAA 2WN9A 5AFJA 3TLUA 4IL4A 5AFLA 4NPPA 3P50A 3PMZA 3UU5A 4TWFA 4D01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJU A;  3UU4 A;  5KZU A;  4A97 A;  1UV6 A;  4NZB A;  4QH1 A;  4ZK1 A;  2YN6 A;  2XQ5 A;  5HCJ A;  4XK9 A;  3T4M A;  4X5T A;  2BR7 A;  2XQ7 A;  4BQT A;  4QH5 A;  3TLS A;  4LMK A;  5SYO A;  5J5F A;  2BYR A;  2QC1 B;  4UM3 A;  4DBM A;  5J5H A;  3JAE A;  2XQ3 A;  5AFM B;  4FRR A;  3WTH A;  4ILA A;  2YOE A;  5IUX A;  4QH4 A;  1UX2 A;  4F8H A;  2BYP A;  4HFI A;  2XNT A;  3SQ6 A;  4ZJS A;  3RQW A;  2VL0 A;  5HEH A;  4PIR A;  4LML A;  4HFD A;  3P4W A;  4HFE A;  4ZR6 A;  3LSV A;  2W8G A;  2YME A;  4IL9 A;  5HCM A;  2WNC A;  3EAM A;  4COF A;  2WZY A;  2Y57 A;  3ZDG A;  3TLT A;  3WTM A;  2BYS A;  5J5G A;  4QAB A;  2XYS A;  3UU8 A;  4UM1 A;  3WTI A;  5AFN A;  2XNV A;  4QAC A;  4TNW A;  4ZRU A;  3SIO A;  3C79 A;  3U8K A;  2BYQ A;  2PH9 A;  3PEO A;  2BR8 A;  3U8J A;  5BW2 A;  3IGQ A;  2XQ8 A;  2XZ5 A;  5KE4 A;  2WNJ A;  2PGZ A;  3WTN A;  4HFB A;  3U8M A;  3WIP A;  3EI0 A;  5TVC A;  2XQ4 A;  2YKS A;  4XHE A;  3RIF A;  2Y56 A;  2X00 A;  5HEO A;  3UU3 A;  4HQP A;  3WTK A;  3U8N A;  3UU6 A;  5AFK A;  5BRX A;  3GUA A;  5J0Z A;  3UUB A;  4HFH A;  3TLV A;  5J5I A;  4QAA A;  4AFT A;  5HEU A;  2C9T A;  4ALX A;  4ZZB A;  2XQ6 A;  5HEG A;  3SH1 A;  3WTJ A;  4EZ1 A;  2BG9 C;  2UZ6 A;  2Y54 A;  5LXB A;  3C84 A;  4BFQ A;  4ZZC A;  3RQU A;  2BG9 B;  5HEJ A;  4UM3 S;  2W8F A;  2Y7Y A;  1UW6 A;  2BG9 E;  5AFH A;  5AFM A;  2WNL A;  5L47 A;  2YMD A;  5CO5 A;  4Z90 A;  4ILB A;  4WV9 A;  3TLW A;  4AFG A;  2X00 D;  1I9B A;  5AIN A;  4ILC A;  3U8L A;  2XZ6 A;  4ZK4 A;  4TWH A;  5CFB A;  3JAF A;  4Z91 A;  5L4H A;  5LG3 A;  4HFC A;  2XNU A;  3WTL A;  3ZDH A;  5BP0 A;  3JAD A;  3WTO A;  2BG9 A;  4A98 A;  5L4E A;  3UQ7 A;  4TNV A;  2XYT A;  3RHW A;  4UM3 P;  3RI5 A;  3UQ4 A;  4IRE A;  4UXU A;  3SQ9 A;  3ZKR A;  4AFH A;  4B5D A;  4ZJT A;  2BYN A;  4TWD A;  2ZJV A;  5JME A;  2XQ9 A;  4LMJ A;  3EHZ A;  2BJ0 A;  2XQA A;  5FJV A;  2Y58 A;  4UY2 A;  3RIA A;  2WN9 A;  5AFJ A;  3TLU A;  4IL4 A;  5AFL A;  4NPP A;  3P50 A;  3PMZ A;  3UU5 A;  4TWF A;  4D01 A; 
#chains in the Genus database with same CATH topology
 2ZJU A;  3UU4 A;  5KZU A;  4A97 A;  1UV6 A;  4NZB A;  4QH1 A;  4ZK1 A;  2YN6 A;  2XQ5 A;  5HCJ A;  4XK9 A;  3T4M A;  4X5T A;  2BR7 A;  2XQ7 A;  4BQT A;  4QH5 A;  3TLS A;  4LMK A;  5SYO A;  5J5F A;  2BYR A;  2QC1 B;  4UM3 A;  4DBM A;  5J5H A;  3JAE A;  2XQ3 A;  5AFM B;  4FRR A;  3WTH A;  4ILA A;  2YOE A;  5IUX A;  4QH4 A;  1UX2 A;  4F8H A;  2BYP A;  4HFI A;  2XNT A;  3SQ6 A;  4ZJS A;  3RQW A;  2VL0 A;  5HEH A;  4PIR A;  4LML A;  4HFD A;  3P4W A;  4HFE A;  4ZR6 A;  3LSV A;  2W8G A;  2YME A;  4IL9 A;  5HCM A;  2WNC A;  3EAM A;  4COF A;  2WZY A;  2Y57 A;  3ZDG A;  3TLT A;  3WTM A;  2BYS A;  5J5G A;  4QAB A;  2XYS A;  3UU8 A;  4UM1 A;  3WTI A;  5AFN A;  2XNV A;  4QAC A;  4TNW A;  4ZRU A;  3SIO A;  3C79 A;  3U8K A;  2BYQ A;  2PH9 A;  3PEO A;  2BR8 A;  3U8J A;  5BW2 A;  3IGQ A;  2XQ8 A;  2XZ5 A;  5KE4 A;  2WNJ A;  2PGZ A;  3WTN A;  4HFB A;  3U8M A;  3WIP A;  3EI0 A;  5TVC A;  2XQ4 A;  2YKS A;  4XHE A;  3RIF A;  2Y56 A;  2X00 A;  5HEO A;  3UU3 A;  4HQP A;  3WTK A;  3U8N A;  3UU6 A;  5AFK A;  5BRX A;  3GUA A;  5J0Z A;  3UUB A;  4HFH A;  3TLV A;  5J5I A;  4QAA A;  4AFT A;  5HEU A;  2C9T A;  4ALX A;  4ZZB A;  2XQ6 A;  5HEG A;  3SH1 A;  3WTJ A;  4EZ1 A;  2BG9 C;  2UZ6 A;  2Y54 A;  5LXB A;  3C84 A;  4BFQ A;  4ZZC A;  3RQU A;  2BG9 B;  5HEJ A;  4UM3 S;  2W8F A;  2Y7Y A;  1UW6 A;  2BG9 E;  5AFH A;  5AFM A;  2WNL A;  5L47 A;  2YMD A;  5CO5 A;  4Z90 A;  4ILB A;  4WV9 A;  3TLW A;  4AFG A;  2X00 D;  1I9B A;  5AIN A;  4ILC A;  3U8L A;  2XZ6 A;  4ZK4 A;  4TWH A;  5CFB A;  3JAF A;  4Z91 A;  5L4H A;  5LG3 A;  4HFC A;  2XNU A;  3WTL A;  3ZDH A;  5BP0 A;  3JAD A;  3WTO A;  2BG9 A;  4A98 A;  5L4E A;  3UQ7 A;  4TNV A;  2XYT A;  3RHW A;  4UM3 P;  3RI5 A;  3UQ4 A;  4IRE A;  4UXU A;  3SQ9 A;  3ZKR A;  4AFH A;  4B5D A;  4ZJT A;  2BYN A;  4TWD A;  2ZJV A;  5JME A;  2XQ9 A;  4LMJ A;  3EHZ A;  2BJ0 A;  2XQA A;  5FJV A;  2Y58 A;  4UY2 A;  3RIA A;  2WN9 A;  5AFJ A;  3TLU A;  4IL4 A;  5AFL A;  4NPP A;  3P50 A;  3PMZ A;  3UU5 A;  4TWF A;  4D01 A; 
#chains in the Genus database with same CATH homology
 2ZJU A;  3UU4 A;  5KZU A;  4A97 A;  1UV6 A;  4NZB A;  4QH1 A;  4ZK1 A;  2YN6 A;  2XQ5 A;  5HCJ A;  4XK9 A;  3T4M A;  4X5T A;  2BR7 A;  2XQ7 A;  4BQT A;  4QH5 A;  3TLS A;  4LMK A;  5SYO A;  5J5F A;  2BYR A;  2QC1 B;  4UM3 A;  4DBM A;  5J5H A;  3JAE A;  2XQ3 A;  5AFM B;  4FRR A;  3WTH A;  4ILA A;  2YOE A;  5IUX A;  4QH4 A;  1UX2 A;  4F8H A;  2BYP A;  4HFI A;  2XNT A;  3SQ6 A;  4ZJS A;  3RQW A;  2VL0 A;  5HEH A;  4PIR A;  4LML A;  4HFD A;  3P4W A;  4HFE A;  4ZR6 A;  3LSV A;  2W8G A;  2YME A;  4IL9 A;  5HCM A;  2WNC A;  3EAM A;  4COF A;  2WZY A;  2Y57 A;  3ZDG A;  3TLT A;  3WTM A;  2BYS A;  5J5G A;  4QAB A;  2XYS A;  3UU8 A;  4UM1 A;  3WTI A;  5AFN A;  2XNV A;  4QAC A;  4TNW A;  4ZRU A;  3SIO A;  3C79 A;  3U8K A;  2BYQ A;  2PH9 A;  3PEO A;  2BR8 A;  3U8J A;  5BW2 A;  3IGQ A;  2XQ8 A;  2XZ5 A;  5KE4 A;  2WNJ A;  2PGZ A;  3WTN A;  4HFB A;  3U8M A;  3WIP A;  3EI0 A;  5TVC A;  2XQ4 A;  2YKS A;  4XHE A;  3RIF A;  2Y56 A;  2X00 A;  5HEO A;  3UU3 A;  4HQP A;  3WTK A;  3U8N A;  3UU6 A;  5AFK A;  5BRX A;  3GUA A;  5J0Z A;  3UUB A;  4HFH A;  3TLV A;  5J5I A;  4QAA A;  4AFT A;  5HEU A;  2C9T A;  4ALX A;  4ZZB A;  2XQ6 A;  5HEG A;  3SH1 A;  3WTJ A;  4EZ1 A;  2BG9 C;  2UZ6 A;  2Y54 A;  5LXB A;  3C84 A;  4BFQ A;  4ZZC A;  3RQU A;  2BG9 B;  5HEJ A;  4UM3 S;  2W8F A;  2Y7Y A;  1UW6 A;  2BG9 E;  5AFH A;  5AFM A;  2WNL A;  5L47 A;  2YMD A;  5CO5 A;  4Z90 A;  4ILB A;  4WV9 A;  3TLW A;  4AFG A;  2X00 D;  1I9B A;  5AIN A;  4ILC A;  3U8L A;  2XZ6 A;  4ZK4 A;  4TWH A;  5CFB A;  3JAF A;  4Z91 A;  5L4H A;  5LG3 A;  4HFC A;  2XNU A;  3WTL A;  3ZDH A;  5BP0 A;  3JAD A;  3WTO A;  2BG9 A;  4A98 A;  5L4E A;  3UQ7 A;  4TNV A;  2XYT A;  3RHW A;  4UM3 P;  3RI5 A;  3UQ4 A;  4IRE A;  4UXU A;  3SQ9 A;  3ZKR A;  4AFH A;  4B5D A;  4ZJT A;  2BYN A;  4TWD A;  2ZJV A;  5JME A;  2XQ9 A;  4LMJ A;  3EHZ A;  2BJ0 A;  2XQA A;  5FJV A;  2Y58 A;  4UY2 A;  3RIA A;  2WN9 A;  5AFJ A;  3TLU A;  4IL4 A;  5AFL A;  4NPP A;  3P50 A;  3PMZ A;  3UU5 A;  4TWF A;  4D01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...