2Y7YA

Aplysia californica achbp in apo state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
205
structure length
203
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X-Ray Analysis.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 50
structure length 203
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y7yA00
2YMDA 2BG9E 2WNCA 2XZ5A 2XQ3A 4XHEA 2PH9A 2XQ7A 2YMEA 3P50A 4AFHA 4EZ1A 4ILAA 1UV6A 3RI5A 4LMLA 4ZK1A 4ZJSA 5CFBA 1I9BA 5AFLA 3JAEA 3WTOA 5AFMA 4IL4A 3UQ4A 4UM1A 3U8LA 5TVCA 2Y57A 3PEOA 2QC1B 4TWFA 5AFJA 4TWDA 4DBMA 2YOEA 2X00D 3P4WA 4IL9A 5KE4A 5SYOA 4TNVA 3WTIA 3WTHA 2YN6A 5L4HA 3WTMA 5J0ZA 3WTJA 4A98A 3WTKA 4QACA 4UY2A 4HFIA 5J5FA 4BQTA 4HFDA 2BR7A 4ZRUA 3UQ7A 4BFQA 5HCMA 4ZZCA 4AFTA 4PIRA 4ALXA 4Z90A 2Y58A 5HEHA 2BYQA 2XQ5A 3LSVA 4FRRA 5L47A 5LG3A 4UXUA 3C84A 4HFCA 4HQPA 5L4EA 2XNVA 5J5GA 2XQAA 3RQWA 4QH1A 3U8MA 2BYSA 2XYTA 4ILCA 4QAAA 2W8FA 3SH1A 3UU4A 2BYNA 3EHZA 2WNJA 3RQUA 2VL0A 3UU8A 4QH5A 3UU5A 3JAFA 3T4MA 4HFBA 4QABA 3RIFA 5AINA 5LXBA 4TNWA 2XQ9A 2C9TA 2XZ6A 2XQ8A 4QH4A 2BR8A 2WN9A 5HEOA 4LMJA 4NZBA 2BG9B 5FJVA 3EI0A 1UX2A 3TLWA 3C79A 5HEUA 3EAMA 3TLSA 2Y7YA 4HFEA 5BRXA 2BG9C 3IGQA 4X5TA 3RHWA 3U8NA 3ZDGA 2XNTA 4ZZBA 2BYPA 2XQ4A 5AFHA 2Y54A 1UW6A 2YKSA 4Z91A 4ZR6A 3WTLA 2BJ0A 3SQ6A 3UU6A 2BG9A 4IREA 3U8JA 3PMZA 4F8HA 5J5HA 3TLTA 3RIAA 2XNUA 4ILBA 4UM3A 5KZUA 2XQ6A 2Y56A 5HCJA 5BP0A 5AFKA 2W8GA 3WIPA 4COFA 4WV9A 3WTNA 5JMEA 2WNLA 3GUAA 5HEGA 2PGZA 5CO5A 2BYRA 3TLUA 3UUBA 4XK9A 3UU3A 2WZYA 3JADA 3SIOA 2ZJVA 5BW2A 2XYSA 4TWHA 3U8KA 4ZJTA 3ZKRA 4UM3S 5HEJA 4AFGA 2X00A 4HFHA 4ZK4A 5AFMB 4A97A 4LMKA 2UZ6A 3SQ9A 3ZDHA 5IUXA 4UM3P 2ZJUA 4D01A 5J5IA 4B5DA 5AFNA 3TLVA 4NPPA
chains in the Genus database with same CATH superfamily
2YMDA 2BG9E 2WNCA 2XZ5A 2XQ3A 4XHEA 2PH9A 2XQ7A 2YMEA 3P50A 4AFHA 4EZ1A 4ILAA 1UV6A 3RI5A 4LMLA 4ZK1A 4ZJSA 5CFBA 1I9BA 5AFLA 3JAEA 3WTOA 5AFMA 4IL4A 3UQ4A 4UM1A 3U8LA 5TVCA 2Y57A 3PEOA 2QC1B 4TWFA 5AFJA 4TWDA 4DBMA 2YOEA 2X00D 3P4WA 4IL9A 5KE4A 5SYOA 4TNVA 3WTIA 3WTHA 2YN6A 5L4HA 3WTMA 5J0ZA 3WTJA 4A98A 3WTKA 4QACA 4UY2A 4HFIA 5J5FA 4BQTA 4HFDA 2BR7A 4ZRUA 3UQ7A 4BFQA 5HCMA 4ZZCA 4AFTA 4PIRA 4ALXA 4Z90A 2Y58A 5HEHA 2BYQA 2XQ5A 3LSVA 4FRRA 5L47A 5LG3A 4UXUA 3C84A 4HFCA 4HQPA 5L4EA 2XNVA 5J5GA 2XQAA 3RQWA 4QH1A 3U8MA 2BYSA 2XYTA 4ILCA 4QAAA 2W8FA 3SH1A 3UU4A 2BYNA 3EHZA 2WNJA 3RQUA 2VL0A 3UU8A 4QH5A 3UU5A 3JAFA 3T4MA 4HFBA 4QABA 3RIFA 5AINA 5LXBA 4TNWA 2XQ9A 2C9TA 2XZ6A 2XQ8A 4QH4A 2BR8A 2WN9A 5HEOA 4LMJA 4NZBA 2BG9B 5FJVA 3EI0A 1UX2A 3TLWA 3C79A 5HEUA 3EAMA 3TLSA 2Y7YA 4HFEA 5BRXA 2BG9C 3IGQA 4X5TA 3RHWA 3U8NA 3ZDGA 2XNTA 4ZZBA 2BYPA 2XQ4A 5AFHA 2Y54A 1UW6A 2YKSA 4Z91A 4ZR6A 3WTLA 2BJ0A 3SQ6A 3UU6A 2BG9A 4IREA 3U8JA 3PMZA 4F8HA 5J5HA 3TLTA 3RIAA 2XNUA 4ILBA 4UM3A 5KZUA 2XQ6A 2Y56A 5HCJA 5BP0A 5AFKA 2W8GA 3WIPA 4COFA 4WV9A 3WTNA 5JMEA 2WNLA 3GUAA 5HEGA 2PGZA 5CO5A 2BYRA 3TLUA 3UUBA 4XK9A 3UU3A 2WZYA 3JADA 3SIOA 2ZJVA 5BW2A 2XYSA 4TWHA 3U8KA 4ZJTA 3ZKRA 4UM3S 5HEJA 4AFGA 2X00A 4HFHA 4ZK4A 5AFMB 4A97A 4LMKA 2UZ6A 3SQ9A 3ZDHA 5IUXA 4UM3P 2ZJUA 4D01A 5J5IA 4B5DA 5AFNA 3TLVA 4NPPA
chains in the Genus database with same CATH topology
2YMDA 2BG9E 2WNCA 2XZ5A 2XQ3A 4XHEA 2PH9A 2XQ7A 2YMEA 3P50A 4AFHA 4EZ1A 4ILAA 1UV6A 3RI5A 4LMLA 4ZK1A 4ZJSA 5CFBA 1I9BA 5AFLA 3JAEA 3WTOA 5AFMA 4IL4A 3UQ4A 4UM1A 3U8LA 5TVCA 2Y57A 3PEOA 2QC1B 4TWFA 5AFJA 4TWDA 4DBMA 2YOEA 2X00D 3P4WA 4IL9A 5KE4A 5SYOA 4TNVA 3WTIA 3WTHA 2YN6A 5L4HA 3WTMA 5J0ZA 3WTJA 4A98A 3WTKA 4QACA 4UY2A 4HFIA 5J5FA 4BQTA 4HFDA 2BR7A 4ZRUA 3UQ7A 4BFQA 5HCMA 4ZZCA 4AFTA 4PIRA 4ALXA 4Z90A 2Y58A 5HEHA 2BYQA 2XQ5A 3LSVA 4FRRA 5L47A 5LG3A 4UXUA 3C84A 4HFCA 4HQPA 5L4EA 2XNVA 5J5GA 2XQAA 3RQWA 4QH1A 3U8MA 2BYSA 2XYTA 4ILCA 4QAAA 2W8FA 3SH1A 3UU4A 2BYNA 3EHZA 2WNJA 3RQUA 2VL0A 3UU8A 4QH5A 3UU5A 3JAFA 3T4MA 4HFBA 4QABA 3RIFA 5AINA 5LXBA 4TNWA 2XQ9A 2C9TA 2XZ6A 2XQ8A 4QH4A 2BR8A 2WN9A 5HEOA 4LMJA 4NZBA 2BG9B 5FJVA 3EI0A 1UX2A 3TLWA 3C79A 5HEUA 3EAMA 3TLSA 2Y7YA 4HFEA 5BRXA 2BG9C 3IGQA 4X5TA 3RHWA 3U8NA 3ZDGA 2XNTA 4ZZBA 2BYPA 2XQ4A 5AFHA 2Y54A 1UW6A 2YKSA 4Z91A 4ZR6A 3WTLA 2BJ0A 3SQ6A 3UU6A 2BG9A 4IREA 3U8JA 3PMZA 4F8HA 5J5HA 3TLTA 3RIAA 2XNUA 4ILBA 4UM3A 5KZUA 2XQ6A 2Y56A 5HCJA 5BP0A 5AFKA 2W8GA 3WIPA 4COFA 4WV9A 3WTNA 5JMEA 2WNLA 3GUAA 5HEGA 2PGZA 5CO5A 2BYRA 3TLUA 3UUBA 4XK9A 3UU3A 2WZYA 3JADA 3SIOA 2ZJVA 5BW2A 2XYSA 4TWHA 3U8KA 4ZJTA 3ZKRA 4UM3S 5HEJA 4AFGA 2X00A 4HFHA 4ZK4A 5AFMB 4A97A 4LMKA 2UZ6A 3SQ9A 3ZDHA 5IUXA 4UM3P 2ZJUA 4D01A 5J5IA 4B5DA 5AFNA 3TLVA 4NPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMD A;  2BG9 E;  2WNC A;  2XZ5 A;  2XQ3 A;  4XHE A;  2PH9 A;  2XQ7 A;  2YME A;  3P50 A;  4AFH A;  4EZ1 A;  4ILA A;  1UV6 A;  3RI5 A;  4LML A;  4ZK1 A;  4ZJS A;  5CFB A;  1I9B A;  5AFL A;  3JAE A;  3WTO A;  5AFM A;  4IL4 A;  3UQ4 A;  4UM1 A;  3U8L A;  5TVC A;  2Y57 A;  3PEO A;  2QC1 B;  4TWF A;  5AFJ A;  4TWD A;  4DBM A;  2YOE A;  2X00 D;  3P4W A;  4IL9 A;  5KE4 A;  5SYO A;  4TNV A;  3WTI A;  3WTH A;  2YN6 A;  5L4H A;  3WTM A;  5J0Z A;  3WTJ A;  4A98 A;  3WTK A;  4QAC A;  4UY2 A;  4HFI A;  5J5F A;  4BQT A;  4HFD A;  2BR7 A;  4ZRU A;  3UQ7 A;  4BFQ A;  5HCM A;  4ZZC A;  4AFT A;  4PIR A;  4ALX A;  4Z90 A;  2Y58 A;  5HEH A;  2BYQ A;  2XQ5 A;  3LSV A;  4FRR A;  5L47 A;  5LG3 A;  4UXU A;  3C84 A;  4HFC A;  4HQP A;  5L4E A;  2XNV A;  5J5G A;  2XQA A;  3RQW A;  4QH1 A;  3U8M A;  2BYS A;  2XYT A;  4ILC A;  4QAA A;  2W8F A;  3SH1 A;  3UU4 A;  2BYN A;  3EHZ A;  2WNJ A;  3RQU A;  2VL0 A;  3UU8 A;  4QH5 A;  3UU5 A;  3JAF A;  3T4M A;  4HFB A;  4QAB A;  3RIF A;  5AIN A;  5LXB A;  4TNW A;  2XQ9 A;  2C9T A;  2XZ6 A;  2XQ8 A;  4QH4 A;  2BR8 A;  2WN9 A;  5HEO A;  4LMJ A;  4NZB A;  2BG9 B;  5FJV A;  3EI0 A;  1UX2 A;  3TLW A;  3C79 A;  5HEU A;  3EAM A;  3TLS A;  2Y7Y A;  4HFE A;  5BRX A;  2BG9 C;  3IGQ A;  4X5T A;  3RHW A;  3U8N A;  3ZDG A;  2XNT A;  4ZZB A;  2BYP A;  2XQ4 A;  5AFH A;  2Y54 A;  1UW6 A;  2YKS A;  4Z91 A;  4ZR6 A;  3WTL A;  2BJ0 A;  3SQ6 A;  3UU6 A;  2BG9 A;  4IRE A;  3U8J A;  3PMZ A;  4F8H A;  5J5H A;  3TLT A;  3RIA A;  2XNU A;  4ILB A;  4UM3 A;  5KZU A;  2XQ6 A;  2Y56 A;  5HCJ A;  5BP0 A;  5AFK A;  2W8G A;  3WIP A;  4COF A;  4WV9 A;  3WTN A;  5JME A;  2WNL A;  3GUA A;  5HEG A;  2PGZ A;  5CO5 A;  2BYR A;  3TLU A;  3UUB A;  4XK9 A;  3UU3 A;  2WZY A;  3JAD A;  3SIO A;  2ZJV A;  5BW2 A;  2XYS A;  4TWH A;  3U8K A;  4ZJT A;  3ZKR A;  4UM3 S;  5HEJ A;  4AFG A;  2X00 A;  4HFH A;  4ZK4 A;  5AFM B;  4A97 A;  4LMK A;  2UZ6 A;  3SQ9 A;  3ZDH A;  5IUX A;  4UM3 P;  2ZJU A;  4D01 A;  5J5I A;  4B5D A;  5AFN A;  3TLV A;  4NPP A; 
#chains in the Genus database with same CATH topology
 2YMD A;  2BG9 E;  2WNC A;  2XZ5 A;  2XQ3 A;  4XHE A;  2PH9 A;  2XQ7 A;  2YME A;  3P50 A;  4AFH A;  4EZ1 A;  4ILA A;  1UV6 A;  3RI5 A;  4LML A;  4ZK1 A;  4ZJS A;  5CFB A;  1I9B A;  5AFL A;  3JAE A;  3WTO A;  5AFM A;  4IL4 A;  3UQ4 A;  4UM1 A;  3U8L A;  5TVC A;  2Y57 A;  3PEO A;  2QC1 B;  4TWF A;  5AFJ A;  4TWD A;  4DBM A;  2YOE A;  2X00 D;  3P4W A;  4IL9 A;  5KE4 A;  5SYO A;  4TNV A;  3WTI A;  3WTH A;  2YN6 A;  5L4H A;  3WTM A;  5J0Z A;  3WTJ A;  4A98 A;  3WTK A;  4QAC A;  4UY2 A;  4HFI A;  5J5F A;  4BQT A;  4HFD A;  2BR7 A;  4ZRU A;  3UQ7 A;  4BFQ A;  5HCM A;  4ZZC A;  4AFT A;  4PIR A;  4ALX A;  4Z90 A;  2Y58 A;  5HEH A;  2BYQ A;  2XQ5 A;  3LSV A;  4FRR A;  5L47 A;  5LG3 A;  4UXU A;  3C84 A;  4HFC A;  4HQP A;  5L4E A;  2XNV A;  5J5G A;  2XQA A;  3RQW A;  4QH1 A;  3U8M A;  2BYS A;  2XYT A;  4ILC A;  4QAA A;  2W8F A;  3SH1 A;  3UU4 A;  2BYN A;  3EHZ A;  2WNJ A;  3RQU A;  2VL0 A;  3UU8 A;  4QH5 A;  3UU5 A;  3JAF A;  3T4M A;  4HFB A;  4QAB A;  3RIF A;  5AIN A;  5LXB A;  4TNW A;  2XQ9 A;  2C9T A;  2XZ6 A;  2XQ8 A;  4QH4 A;  2BR8 A;  2WN9 A;  5HEO A;  4LMJ A;  4NZB A;  2BG9 B;  5FJV A;  3EI0 A;  1UX2 A;  3TLW A;  3C79 A;  5HEU A;  3EAM A;  3TLS A;  2Y7Y A;  4HFE A;  5BRX A;  2BG9 C;  3IGQ A;  4X5T A;  3RHW A;  3U8N A;  3ZDG A;  2XNT A;  4ZZB A;  2BYP A;  2XQ4 A;  5AFH A;  2Y54 A;  1UW6 A;  2YKS A;  4Z91 A;  4ZR6 A;  3WTL A;  2BJ0 A;  3SQ6 A;  3UU6 A;  2BG9 A;  4IRE A;  3U8J A;  3PMZ A;  4F8H A;  5J5H A;  3TLT A;  3RIA A;  2XNU A;  4ILB A;  4UM3 A;  5KZU A;  2XQ6 A;  2Y56 A;  5HCJ A;  5BP0 A;  5AFK A;  2W8G A;  3WIP A;  4COF A;  4WV9 A;  3WTN A;  5JME A;  2WNL A;  3GUA A;  5HEG A;  2PGZ A;  5CO5 A;  2BYR A;  3TLU A;  3UUB A;  4XK9 A;  3UU3 A;  2WZY A;  3JAD A;  3SIO A;  2ZJV A;  5BW2 A;  2XYS A;  4TWH A;  3U8K A;  4ZJT A;  3ZKR A;  4UM3 S;  5HEJ A;  4AFG A;  2X00 A;  4HFH A;  4ZK4 A;  5AFM B;  4A97 A;  4LMK A;  2UZ6 A;  3SQ9 A;  3ZDH A;  5IUX A;  4UM3 P;  2ZJU A;  4D01 A;  5J5I A;  4B5D A;  5AFN A;  3TLV A;  4NPP A; 
#chains in the Genus database with same CATH homology
 2YMD A;  2BG9 E;  2WNC A;  2XZ5 A;  2XQ3 A;  4XHE A;  2PH9 A;  2XQ7 A;  2YME A;  3P50 A;  4AFH A;  4EZ1 A;  4ILA A;  1UV6 A;  3RI5 A;  4LML A;  4ZK1 A;  4ZJS A;  5CFB A;  1I9B A;  5AFL A;  3JAE A;  3WTO A;  5AFM A;  4IL4 A;  3UQ4 A;  4UM1 A;  3U8L A;  5TVC A;  2Y57 A;  3PEO A;  2QC1 B;  4TWF A;  5AFJ A;  4TWD A;  4DBM A;  2YOE A;  2X00 D;  3P4W A;  4IL9 A;  5KE4 A;  5SYO A;  4TNV A;  3WTI A;  3WTH A;  2YN6 A;  5L4H A;  3WTM A;  5J0Z A;  3WTJ A;  4A98 A;  3WTK A;  4QAC A;  4UY2 A;  4HFI A;  5J5F A;  4BQT A;  4HFD A;  2BR7 A;  4ZRU A;  3UQ7 A;  4BFQ A;  5HCM A;  4ZZC A;  4AFT A;  4PIR A;  4ALX A;  4Z90 A;  2Y58 A;  5HEH A;  2BYQ A;  2XQ5 A;  3LSV A;  4FRR A;  5L47 A;  5LG3 A;  4UXU A;  3C84 A;  4HFC A;  4HQP A;  5L4E A;  2XNV A;  5J5G A;  2XQA A;  3RQW A;  4QH1 A;  3U8M A;  2BYS A;  2XYT A;  4ILC A;  4QAA A;  2W8F A;  3SH1 A;  3UU4 A;  2BYN A;  3EHZ A;  2WNJ A;  3RQU A;  2VL0 A;  3UU8 A;  4QH5 A;  3UU5 A;  3JAF A;  3T4M A;  4HFB A;  4QAB A;  3RIF A;  5AIN A;  5LXB A;  4TNW A;  2XQ9 A;  2C9T A;  2XZ6 A;  2XQ8 A;  4QH4 A;  2BR8 A;  2WN9 A;  5HEO A;  4LMJ A;  4NZB A;  2BG9 B;  5FJV A;  3EI0 A;  1UX2 A;  3TLW A;  3C79 A;  5HEU A;  3EAM A;  3TLS A;  2Y7Y A;  4HFE A;  5BRX A;  2BG9 C;  3IGQ A;  4X5T A;  3RHW A;  3U8N A;  3ZDG A;  2XNT A;  4ZZB A;  2BYP A;  2XQ4 A;  5AFH A;  2Y54 A;  1UW6 A;  2YKS A;  4Z91 A;  4ZR6 A;  3WTL A;  2BJ0 A;  3SQ6 A;  3UU6 A;  2BG9 A;  4IRE A;  3U8J A;  3PMZ A;  4F8H A;  5J5H A;  3TLT A;  3RIA A;  2XNU A;  4ILB A;  4UM3 A;  5KZU A;  2XQ6 A;  2Y56 A;  5HCJ A;  5BP0 A;  5AFK A;  2W8G A;  3WIP A;  4COF A;  4WV9 A;  3WTN A;  5JME A;  2WNL A;  3GUA A;  5HEG A;  2PGZ A;  5CO5 A;  2BYR A;  3TLU A;  3UUB A;  4XK9 A;  3UU3 A;  2WZY A;  3JAD A;  3SIO A;  2ZJV A;  5BW2 A;  2XYS A;  4TWH A;  3U8K A;  4ZJT A;  3ZKR A;  4UM3 S;  5HEJ A;  4AFG A;  2X00 A;  4HFH A;  4ZK4 A;  5AFM B;  4A97 A;  4LMK A;  2UZ6 A;  3SQ9 A;  3ZDH A;  5IUX A;  4UM3 P;  2ZJU A;  4D01 A;  5J5I A;  4B5D A;  5AFN A;  3TLV A;  4NPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...