4AFTA

Aplysia californica achbp in complex with varenicline
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
b'QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Characterization of Binding Mode of Smoking Cessation Drugs to Nicotinic Acetylcholine Receptors Through Study of Ligand Complexes with Acetylcholine-Binding Protein.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor protein
total genus 43
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4aftA00
2XQ7A 2BG9E 2Y58A 3JAFA 1I9BA 3EI0A 3RQUA 2PGZA 3WTIA 2BG9A 3UU6A 4AFHA 2WZYA 3IGQA 5CFBA 2XQ3A 3U8LA 4UM3A 5AFKA 4IL9A 4D01A 5IUXA 5AFHA 2X00A 5KZUA 5FJVA 2BYNA 4ILBA 4PIRA 3C79A 4QH1A 3WTNA 2BJ0A 4ILAA 3C84A 4TWDA 2Y54A 3EHZA 5J5HA 3ZDHA 3WTMA 2BR8A 2UZ6A 2XQ9A 2XQ4A 2XQ8A 4UY2A 3JAEA 3UQ4A 5JMEA 4HFBA 4X5TA 3UUBA 2XNUA 3WTKA 3TLUA 4LMJA 2XYSA 4BQTA 3RQWA 4A97A 2BYRA 2XQAA 3U8MA 2ZJUA 4B5DA 5HEOA 4ZK1A 2BG9C 4A98A 4HFCA 2XQ5A 5HEJA 4LMKA 3U8JA 4NZBA 2XNTA 4TNVA 4FRRA 2XZ6A 4ILCA 5J5GA 2BR7A 3SQ6A 2XQ6A 5J5IA 3SIOA 3RHWA 3WTLA 4F8HA 5LXBA 4QAAA 4UM3P 4XHEA 4IREA 2WNLA 3RIFA 2Y56A 1UW6A 3PMZA 2Y57A 5HEHA 5TVCA 3UU4A 4TWHA 4ZJTA 4UM3S 4BFQA 4HQPA 3WTOA 2WNCA 4ZR6A 2XYTA 4HFHA 5AFMB 3ZKRA 4TWFA 2YMDA 5HEUA 4AFGA 3GUAA 5KE4A 3JADA 4LMLA 4ZK4A 5J5FA 5AFNA 4TNWA 5AFLA 5AINA 4ALXA 3U8NA 4HFEA 4UXUA 3U8KA 2XNVA 2W8FA 2Y7YA 3SQ9A 3WIPA 4ZZCA 3TLSA 4QH5A 4COFA 3UU3A 4UM1A 2YOEA 2BYPA 2BYQA 3UU8A 2BG9B 1UV6A 5HCMA 3EAMA 3TLVA 2YMEA 3RI5A 4EZ1A 2C9TA 3LSVA 2QC1B 4QACA 2BYSA 2PH9A 5L47A 2YKSA 4IL4A 4QH4A 5CO5A 4Z90A 5HEGA 4WV9A 5HCJA 3TLTA 5SYOA 2WN9A 5BW2A 4ZRUA 5LG3A 3P4WA 4QABA 5L4HA 3WTHA 3ZDGA 5BRXA 4DBMA 2YN6A 4ZJSA 5J0ZA 4AFTA 5BP0A 2VL0A 4ZZBA 3P50A 5AFMA 2X00D 3UU5A 5AFJA 2ZJVA 3T4MA 4NPPA 3PEOA 3RIAA 5L4EA 3UQ7A 3TLWA 2XZ5A 3WTJA 4XK9A 4HFDA 4HFIA 2W8GA 1UX2A 4Z91A 3SH1A 2WNJA
chains in the Genus database with same CATH superfamily
2XQ7A 2BG9E 2Y58A 3JAFA 1I9BA 3EI0A 3RQUA 2PGZA 3WTIA 2BG9A 3UU6A 4AFHA 2WZYA 3IGQA 5CFBA 2XQ3A 3U8LA 4UM3A 5AFKA 4IL9A 4D01A 5IUXA 5AFHA 2X00A 5KZUA 5FJVA 2BYNA 4ILBA 4PIRA 3C79A 4QH1A 3WTNA 2BJ0A 4ILAA 3C84A 4TWDA 2Y54A 3EHZA 5J5HA 3ZDHA 3WTMA 2BR8A 2UZ6A 2XQ9A 2XQ4A 2XQ8A 4UY2A 3JAEA 3UQ4A 5JMEA 4HFBA 4X5TA 3UUBA 2XNUA 3WTKA 3TLUA 4LMJA 2XYSA 4BQTA 3RQWA 4A97A 2BYRA 2XQAA 3U8MA 2ZJUA 4B5DA 5HEOA 4ZK1A 2BG9C 4A98A 4HFCA 2XQ5A 5HEJA 4LMKA 3U8JA 4NZBA 2XNTA 4TNVA 4FRRA 2XZ6A 4ILCA 5J5GA 2BR7A 3SQ6A 2XQ6A 5J5IA 3SIOA 3RHWA 3WTLA 4F8HA 5LXBA 4QAAA 4UM3P 4XHEA 4IREA 2WNLA 3RIFA 2Y56A 1UW6A 3PMZA 2Y57A 5HEHA 5TVCA 3UU4A 4TWHA 4ZJTA 4UM3S 4BFQA 4HQPA 3WTOA 2WNCA 4ZR6A 2XYTA 4HFHA 5AFMB 3ZKRA 4TWFA 2YMDA 5HEUA 4AFGA 3GUAA 5KE4A 3JADA 4LMLA 4ZK4A 5J5FA 5AFNA 4TNWA 5AFLA 5AINA 4ALXA 3U8NA 4HFEA 4UXUA 3U8KA 2XNVA 2W8FA 2Y7YA 3SQ9A 3WIPA 4ZZCA 3TLSA 4QH5A 4COFA 3UU3A 4UM1A 2YOEA 2BYPA 2BYQA 3UU8A 2BG9B 1UV6A 5HCMA 3EAMA 3TLVA 2YMEA 3RI5A 4EZ1A 2C9TA 3LSVA 2QC1B 4QACA 2BYSA 2PH9A 5L47A 2YKSA 4IL4A 4QH4A 5CO5A 4Z90A 5HEGA 4WV9A 5HCJA 3TLTA 5SYOA 2WN9A 5BW2A 4ZRUA 5LG3A 3P4WA 4QABA 5L4HA 3WTHA 3ZDGA 5BRXA 4DBMA 2YN6A 4ZJSA 5J0ZA 4AFTA 5BP0A 2VL0A 4ZZBA 3P50A 5AFMA 2X00D 3UU5A 5AFJA 2ZJVA 3T4MA 4NPPA 3PEOA 3RIAA 5L4EA 3UQ7A 3TLWA 2XZ5A 3WTJA 4XK9A 4HFDA 4HFIA 2W8GA 1UX2A 4Z91A 3SH1A 2WNJA
chains in the Genus database with same CATH topology
2XQ7A 2BG9E 2Y58A 3JAFA 1I9BA 3EI0A 3RQUA 2PGZA 3WTIA 2BG9A 3UU6A 4AFHA 2WZYA 3IGQA 5CFBA 2XQ3A 3U8LA 4UM3A 5AFKA 4IL9A 4D01A 5IUXA 5AFHA 2X00A 5KZUA 5FJVA 2BYNA 4ILBA 4PIRA 3C79A 4QH1A 3WTNA 2BJ0A 4ILAA 3C84A 4TWDA 2Y54A 3EHZA 5J5HA 3ZDHA 3WTMA 2BR8A 2UZ6A 2XQ9A 2XQ4A 2XQ8A 4UY2A 3JAEA 3UQ4A 5JMEA 4HFBA 4X5TA 3UUBA 2XNUA 3WTKA 3TLUA 4LMJA 2XYSA 4BQTA 3RQWA 4A97A 2BYRA 2XQAA 3U8MA 2ZJUA 4B5DA 5HEOA 4ZK1A 2BG9C 4A98A 4HFCA 2XQ5A 5HEJA 4LMKA 3U8JA 4NZBA 2XNTA 4TNVA 4FRRA 2XZ6A 4ILCA 5J5GA 2BR7A 3SQ6A 2XQ6A 5J5IA 3SIOA 3RHWA 3WTLA 4F8HA 5LXBA 4QAAA 4UM3P 4XHEA 4IREA 2WNLA 3RIFA 2Y56A 1UW6A 3PMZA 2Y57A 5HEHA 5TVCA 3UU4A 4TWHA 4ZJTA 4UM3S 4BFQA 4HQPA 3WTOA 2WNCA 4ZR6A 2XYTA 4HFHA 5AFMB 3ZKRA 4TWFA 2YMDA 5HEUA 4AFGA 3GUAA 5KE4A 3JADA 4LMLA 4ZK4A 5J5FA 5AFNA 4TNWA 5AFLA 5AINA 4ALXA 3U8NA 4HFEA 4UXUA 3U8KA 2XNVA 2W8FA 2Y7YA 3SQ9A 3WIPA 4ZZCA 3TLSA 4QH5A 4COFA 3UU3A 4UM1A 2YOEA 2BYPA 2BYQA 3UU8A 2BG9B 1UV6A 5HCMA 3EAMA 3TLVA 2YMEA 3RI5A 4EZ1A 2C9TA 3LSVA 2QC1B 4QACA 2BYSA 2PH9A 5L47A 2YKSA 4IL4A 4QH4A 5CO5A 4Z90A 5HEGA 4WV9A 5HCJA 3TLTA 5SYOA 2WN9A 5BW2A 4ZRUA 5LG3A 3P4WA 4QABA 5L4HA 3WTHA 3ZDGA 5BRXA 4DBMA 2YN6A 4ZJSA 5J0ZA 4AFTA 5BP0A 2VL0A 4ZZBA 3P50A 5AFMA 2X00D 3UU5A 5AFJA 2ZJVA 3T4MA 4NPPA 3PEOA 3RIAA 5L4EA 3UQ7A 3TLWA 2XZ5A 3WTJA 4XK9A 4HFDA 4HFIA 2W8GA 1UX2A 4Z91A 3SH1A 2WNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ7 A;  2BG9 E;  2Y58 A;  3JAF A;  1I9B A;  3EI0 A;  3RQU A;  2PGZ A;  3WTI A;  2BG9 A;  3UU6 A;  4AFH A;  2WZY A;  3IGQ A;  5CFB A;  2XQ3 A;  3U8L A;  4UM3 A;  5AFK A;  4IL9 A;  4D01 A;  5IUX A;  5AFH A;  2X00 A;  5KZU A;  5FJV A;  2BYN A;  4ILB A;  4PIR A;  3C79 A;  4QH1 A;  3WTN A;  2BJ0 A;  4ILA A;  3C84 A;  4TWD A;  2Y54 A;  3EHZ A;  5J5H A;  3ZDH A;  3WTM A;  2BR8 A;  2UZ6 A;  2XQ9 A;  2XQ4 A;  2XQ8 A;  4UY2 A;  3JAE A;  3UQ4 A;  5JME A;  4HFB A;  4X5T A;  3UUB A;  2XNU A;  3WTK A;  3TLU A;  4LMJ A;  2XYS A;  4BQT A;  3RQW A;  4A97 A;  2BYR A;  2XQA A;  3U8M A;  2ZJU A;  4B5D A;  5HEO A;  4ZK1 A;  2BG9 C;  4A98 A;  4HFC A;  2XQ5 A;  5HEJ A;  4LMK A;  3U8J A;  4NZB A;  2XNT A;  4TNV A;  4FRR A;  2XZ6 A;  4ILC A;  5J5G A;  2BR7 A;  3SQ6 A;  2XQ6 A;  5J5I A;  3SIO A;  3RHW A;  3WTL A;  4F8H A;  5LXB A;  4QAA A;  4UM3 P;  4XHE A;  4IRE A;  2WNL A;  3RIF A;  2Y56 A;  1UW6 A;  3PMZ A;  2Y57 A;  5HEH A;  5TVC A;  3UU4 A;  4TWH A;  4ZJT A;  4UM3 S;  4BFQ A;  4HQP A;  3WTO A;  2WNC A;  4ZR6 A;  2XYT A;  4HFH A;  5AFM B;  3ZKR A;  4TWF A;  2YMD A;  5HEU A;  4AFG A;  3GUA A;  5KE4 A;  3JAD A;  4LML A;  4ZK4 A;  5J5F A;  5AFN A;  4TNW A;  5AFL A;  5AIN A;  4ALX A;  3U8N A;  4HFE A;  4UXU A;  3U8K A;  2XNV A;  2W8F A;  2Y7Y A;  3SQ9 A;  3WIP A;  4ZZC A;  3TLS A;  4QH5 A;  4COF A;  3UU3 A;  4UM1 A;  2YOE A;  2BYP A;  2BYQ A;  3UU8 A;  2BG9 B;  1UV6 A;  5HCM A;  3EAM A;  3TLV A;  2YME A;  3RI5 A;  4EZ1 A;  2C9T A;  3LSV A;  2QC1 B;  4QAC A;  2BYS A;  2PH9 A;  5L47 A;  2YKS A;  4IL4 A;  4QH4 A;  5CO5 A;  4Z90 A;  5HEG A;  4WV9 A;  5HCJ A;  3TLT A;  5SYO A;  2WN9 A;  5BW2 A;  4ZRU A;  5LG3 A;  3P4W A;  4QAB A;  5L4H A;  3WTH A;  3ZDG A;  5BRX A;  4DBM A;  2YN6 A;  4ZJS A;  5J0Z A;  4AFT A;  5BP0 A;  2VL0 A;  4ZZB A;  3P50 A;  5AFM A;  2X00 D;  3UU5 A;  5AFJ A;  2ZJV A;  3T4M A;  4NPP A;  3PEO A;  3RIA A;  5L4E A;  3UQ7 A;  3TLW A;  2XZ5 A;  3WTJ A;  4XK9 A;  4HFD A;  4HFI A;  2W8G A;  1UX2 A;  4Z91 A;  3SH1 A;  2WNJ A; 
#chains in the Genus database with same CATH topology
 2XQ7 A;  2BG9 E;  2Y58 A;  3JAF A;  1I9B A;  3EI0 A;  3RQU A;  2PGZ A;  3WTI A;  2BG9 A;  3UU6 A;  4AFH A;  2WZY A;  3IGQ A;  5CFB A;  2XQ3 A;  3U8L A;  4UM3 A;  5AFK A;  4IL9 A;  4D01 A;  5IUX A;  5AFH A;  2X00 A;  5KZU A;  5FJV A;  2BYN A;  4ILB A;  4PIR A;  3C79 A;  4QH1 A;  3WTN A;  2BJ0 A;  4ILA A;  3C84 A;  4TWD A;  2Y54 A;  3EHZ A;  5J5H A;  3ZDH A;  3WTM A;  2BR8 A;  2UZ6 A;  2XQ9 A;  2XQ4 A;  2XQ8 A;  4UY2 A;  3JAE A;  3UQ4 A;  5JME A;  4HFB A;  4X5T A;  3UUB A;  2XNU A;  3WTK A;  3TLU A;  4LMJ A;  2XYS A;  4BQT A;  3RQW A;  4A97 A;  2BYR A;  2XQA A;  3U8M A;  2ZJU A;  4B5D A;  5HEO A;  4ZK1 A;  2BG9 C;  4A98 A;  4HFC A;  2XQ5 A;  5HEJ A;  4LMK A;  3U8J A;  4NZB A;  2XNT A;  4TNV A;  4FRR A;  2XZ6 A;  4ILC A;  5J5G A;  2BR7 A;  3SQ6 A;  2XQ6 A;  5J5I A;  3SIO A;  3RHW A;  3WTL A;  4F8H A;  5LXB A;  4QAA A;  4UM3 P;  4XHE A;  4IRE A;  2WNL A;  3RIF A;  2Y56 A;  1UW6 A;  3PMZ A;  2Y57 A;  5HEH A;  5TVC A;  3UU4 A;  4TWH A;  4ZJT A;  4UM3 S;  4BFQ A;  4HQP A;  3WTO A;  2WNC A;  4ZR6 A;  2XYT A;  4HFH A;  5AFM B;  3ZKR A;  4TWF A;  2YMD A;  5HEU A;  4AFG A;  3GUA A;  5KE4 A;  3JAD A;  4LML A;  4ZK4 A;  5J5F A;  5AFN A;  4TNW A;  5AFL A;  5AIN A;  4ALX A;  3U8N A;  4HFE A;  4UXU A;  3U8K A;  2XNV A;  2W8F A;  2Y7Y A;  3SQ9 A;  3WIP A;  4ZZC A;  3TLS A;  4QH5 A;  4COF A;  3UU3 A;  4UM1 A;  2YOE A;  2BYP A;  2BYQ A;  3UU8 A;  2BG9 B;  1UV6 A;  5HCM A;  3EAM A;  3TLV A;  2YME A;  3RI5 A;  4EZ1 A;  2C9T A;  3LSV A;  2QC1 B;  4QAC A;  2BYS A;  2PH9 A;  5L47 A;  2YKS A;  4IL4 A;  4QH4 A;  5CO5 A;  4Z90 A;  5HEG A;  4WV9 A;  5HCJ A;  3TLT A;  5SYO A;  2WN9 A;  5BW2 A;  4ZRU A;  5LG3 A;  3P4W A;  4QAB A;  5L4H A;  3WTH A;  3ZDG A;  5BRX A;  4DBM A;  2YN6 A;  4ZJS A;  5J0Z A;  4AFT A;  5BP0 A;  2VL0 A;  4ZZB A;  3P50 A;  5AFM A;  2X00 D;  3UU5 A;  5AFJ A;  2ZJV A;  3T4M A;  4NPP A;  3PEO A;  3RIA A;  5L4E A;  3UQ7 A;  3TLW A;  2XZ5 A;  3WTJ A;  4XK9 A;  4HFD A;  4HFI A;  2W8G A;  1UX2 A;  4Z91 A;  3SH1 A;  2WNJ A; 
#chains in the Genus database with same CATH homology
 2XQ7 A;  2BG9 E;  2Y58 A;  3JAF A;  1I9B A;  3EI0 A;  3RQU A;  2PGZ A;  3WTI A;  2BG9 A;  3UU6 A;  4AFH A;  2WZY A;  3IGQ A;  5CFB A;  2XQ3 A;  3U8L A;  4UM3 A;  5AFK A;  4IL9 A;  4D01 A;  5IUX A;  5AFH A;  2X00 A;  5KZU A;  5FJV A;  2BYN A;  4ILB A;  4PIR A;  3C79 A;  4QH1 A;  3WTN A;  2BJ0 A;  4ILA A;  3C84 A;  4TWD A;  2Y54 A;  3EHZ A;  5J5H A;  3ZDH A;  3WTM A;  2BR8 A;  2UZ6 A;  2XQ9 A;  2XQ4 A;  2XQ8 A;  4UY2 A;  3JAE A;  3UQ4 A;  5JME A;  4HFB A;  4X5T A;  3UUB A;  2XNU A;  3WTK A;  3TLU A;  4LMJ A;  2XYS A;  4BQT A;  3RQW A;  4A97 A;  2BYR A;  2XQA A;  3U8M A;  2ZJU A;  4B5D A;  5HEO A;  4ZK1 A;  2BG9 C;  4A98 A;  4HFC A;  2XQ5 A;  5HEJ A;  4LMK A;  3U8J A;  4NZB A;  2XNT A;  4TNV A;  4FRR A;  2XZ6 A;  4ILC A;  5J5G A;  2BR7 A;  3SQ6 A;  2XQ6 A;  5J5I A;  3SIO A;  3RHW A;  3WTL A;  4F8H A;  5LXB A;  4QAA A;  4UM3 P;  4XHE A;  4IRE A;  2WNL A;  3RIF A;  2Y56 A;  1UW6 A;  3PMZ A;  2Y57 A;  5HEH A;  5TVC A;  3UU4 A;  4TWH A;  4ZJT A;  4UM3 S;  4BFQ A;  4HQP A;  3WTO A;  2WNC A;  4ZR6 A;  2XYT A;  4HFH A;  5AFM B;  3ZKR A;  4TWF A;  2YMD A;  5HEU A;  4AFG A;  3GUA A;  5KE4 A;  3JAD A;  4LML A;  4ZK4 A;  5J5F A;  5AFN A;  4TNW A;  5AFL A;  5AIN A;  4ALX A;  3U8N A;  4HFE A;  4UXU A;  3U8K A;  2XNV A;  2W8F A;  2Y7Y A;  3SQ9 A;  3WIP A;  4ZZC A;  3TLS A;  4QH5 A;  4COF A;  3UU3 A;  4UM1 A;  2YOE A;  2BYP A;  2BYQ A;  3UU8 A;  2BG9 B;  1UV6 A;  5HCM A;  3EAM A;  3TLV A;  2YME A;  3RI5 A;  4EZ1 A;  2C9T A;  3LSV A;  2QC1 B;  4QAC A;  2BYS A;  2PH9 A;  5L47 A;  2YKS A;  4IL4 A;  4QH4 A;  5CO5 A;  4Z90 A;  5HEG A;  4WV9 A;  5HCJ A;  3TLT A;  5SYO A;  2WN9 A;  5BW2 A;  4ZRU A;  5LG3 A;  3P4W A;  4QAB A;  5L4H A;  3WTH A;  3ZDG A;  5BRX A;  4DBM A;  2YN6 A;  4ZJS A;  5J0Z A;  4AFT A;  5BP0 A;  2VL0 A;  4ZZB A;  3P50 A;  5AFM A;  2X00 D;  3UU5 A;  5AFJ A;  2ZJV A;  3T4M A;  4NPP A;  3PEO A;  3RIA A;  5L4E A;  3UQ7 A;  3TLW A;  2XZ5 A;  3WTJ A;  4XK9 A;  4HFD A;  4HFI A;  2W8G A;  1UX2 A;  4Z91 A;  3SH1 A;  2WNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...