4BFQA

Assembly of a triple pi-stack of ligands in the binding site of aplysia californica acetylcholine binding protein (achbp)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly of a Pi-Pi Stack of Ligands in the Binding Site of an Acetylcholine Binding Protein
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4bfqA00
5AFMA 2WNJA 4QAAA 2W8FA 5HEUA 5AFHA 5CFBA 4TWFA 2BG9E 2ZJVA 4QABA 2WNCA 4IREA 2YN6A 3RQWA 3C84A 2XZ6A 4ZR6A 4B5DA 5HEGA 3UQ4A 2XQ3A 3P4WA 2XNTA 2X00D 2Y7YA 4NPPA 4IL9A 3UU8A 3WIPA 2WN9A 3WTJA 3RHWA 5AINA 4HQPA 3WTLA 4UXUA 3UU4A 2C9TA 3WTOA 3UU6A 3JAEA 3SQ9A 4QH4A 3EHZA 3TLWA 4BQTA 3U8JA 3EI0A 5L4HA 5J5IA 2X00A 4HFBA 5L47A 4ILCA 3U8LA 4ZZCA 2BYPA 4LMJA 3RI5A 2BYNA 4A97A 5HEHA 5J0ZA 4ZRUA 3IGQA 5SYOA 2VL0A 3RIAA 2YMEA 4TWHA 5LG3A 3WTHA 2ZJUA 4AFHA 4ZJTA 4ZJSA 2QC1B 1I9BA 1UW6A 4FRRA 5J5HA 4UM3A 2XQ8A 2BJ0A 4HFCA 3WTKA 3TLVA 4HFDA 4NZBA 3GUAA 3TLUA 5HEJA 2PH9A 4Z91A 3UQ7A 4TNVA 1UX2A 5CO5A 2Y57A 2XYTA 5HEOA 4Z90A 5KZUA 5TVCA 4ZK4A 3ZKRA 2BR7A 4ILAA 2XZ5A 3LSVA 3JADA 2W8GA 2WZYA 2YOEA 5BRXA 3ZDHA 2BYSA 2XNUA 3C79A 4X5TA 5FJVA 5AFLA 1UV6A 4AFTA 2PGZA 3JAFA 5KE4A 3ZDGA 2Y54A 2YMDA 5HCJA 4QACA 4ALXA 5AFJA 4ZK1A 4HFIA 4LMLA 5HCMA 2XNVA 2BG9C 2BYRA 4TWDA 4EZ1A 4AFGA 2XQ6A 4ILBA 3U8NA 5J5FA 4ZZBA 2XQ4A 4XK9A 4TNWA 4BFQA 3WTNA 4DBMA 4LMKA 3T4MA 2XQ9A 2UZ6A 3SH1A 4HFEA 2BG9A 3WTIA 2Y56A 4UM1A 2Y58A 4WV9A 4UM3S 4COFA 3UUBA 3UU5A 3WTMA 3RQUA 5BP0A 2YKSA 4A98A 3P50A 3PMZA 5AFMB 4QH1A 3RIFA 5LXBA 3U8MA 4UY2A 2BG9B 2XQ5A 3EAMA 3PEOA 3TLSA 5L4EA 2XYSA 3SQ6A 5AFKA 4QH5A 3SIOA 4UM3P 2BR8A 4HFHA 4PIRA 2WNLA 5AFNA 2XQAA 3U8KA 3TLTA 5J5GA 5JMEA 2XQ7A 4F8HA 4D01A 4IL4A 5BW2A 5IUXA 2BYQA 4XHEA 3UU3A
chains in the Genus database with same CATH superfamily
5AFMA 2WNJA 4QAAA 2W8FA 5HEUA 5AFHA 5CFBA 4TWFA 2BG9E 2ZJVA 4QABA 2WNCA 4IREA 2YN6A 3RQWA 3C84A 2XZ6A 4ZR6A 4B5DA 5HEGA 3UQ4A 2XQ3A 3P4WA 2XNTA 2X00D 2Y7YA 4NPPA 4IL9A 3UU8A 3WIPA 2WN9A 3WTJA 3RHWA 5AINA 4HQPA 3WTLA 4UXUA 3UU4A 2C9TA 3WTOA 3UU6A 3JAEA 3SQ9A 4QH4A 3EHZA 3TLWA 4BQTA 3U8JA 3EI0A 5L4HA 5J5IA 2X00A 4HFBA 5L47A 4ILCA 3U8LA 4ZZCA 2BYPA 4LMJA 3RI5A 2BYNA 4A97A 5HEHA 5J0ZA 4ZRUA 3IGQA 5SYOA 2VL0A 3RIAA 2YMEA 4TWHA 5LG3A 3WTHA 2ZJUA 4AFHA 4ZJTA 4ZJSA 2QC1B 1I9BA 1UW6A 4FRRA 5J5HA 4UM3A 2XQ8A 2BJ0A 4HFCA 3WTKA 3TLVA 4HFDA 4NZBA 3GUAA 3TLUA 5HEJA 2PH9A 4Z91A 3UQ7A 4TNVA 1UX2A 5CO5A 2Y57A 2XYTA 5HEOA 4Z90A 5KZUA 5TVCA 4ZK4A 3ZKRA 2BR7A 4ILAA 2XZ5A 3LSVA 3JADA 2W8GA 2WZYA 2YOEA 5BRXA 3ZDHA 2BYSA 2XNUA 3C79A 4X5TA 5FJVA 5AFLA 1UV6A 4AFTA 2PGZA 3JAFA 5KE4A 3ZDGA 2Y54A 2YMDA 5HCJA 4QACA 4ALXA 5AFJA 4ZK1A 4HFIA 4LMLA 5HCMA 2XNVA 2BG9C 2BYRA 4TWDA 4EZ1A 4AFGA 2XQ6A 4ILBA 3U8NA 5J5FA 4ZZBA 2XQ4A 4XK9A 4TNWA 4BFQA 3WTNA 4DBMA 4LMKA 3T4MA 2XQ9A 2UZ6A 3SH1A 4HFEA 2BG9A 3WTIA 2Y56A 4UM1A 2Y58A 4WV9A 4UM3S 4COFA 3UUBA 3UU5A 3WTMA 3RQUA 5BP0A 2YKSA 4A98A 3P50A 3PMZA 5AFMB 4QH1A 3RIFA 5LXBA 3U8MA 4UY2A 2BG9B 2XQ5A 3EAMA 3PEOA 3TLSA 5L4EA 2XYSA 3SQ6A 5AFKA 4QH5A 3SIOA 4UM3P 2BR8A 4HFHA 4PIRA 2WNLA 5AFNA 2XQAA 3U8KA 3TLTA 5J5GA 5JMEA 2XQ7A 4F8HA 4D01A 4IL4A 5BW2A 5IUXA 2BYQA 4XHEA 3UU3A
chains in the Genus database with same CATH topology
5AFMA 2WNJA 4QAAA 2W8FA 5HEUA 5AFHA 5CFBA 4TWFA 2BG9E 2ZJVA 4QABA 2WNCA 4IREA 2YN6A 3RQWA 3C84A 2XZ6A 4ZR6A 4B5DA 5HEGA 3UQ4A 2XQ3A 3P4WA 2XNTA 2X00D 2Y7YA 4NPPA 4IL9A 3UU8A 3WIPA 2WN9A 3WTJA 3RHWA 5AINA 4HQPA 3WTLA 4UXUA 3UU4A 2C9TA 3WTOA 3UU6A 3JAEA 3SQ9A 4QH4A 3EHZA 3TLWA 4BQTA 3U8JA 3EI0A 5L4HA 5J5IA 2X00A 4HFBA 5L47A 4ILCA 3U8LA 4ZZCA 2BYPA 4LMJA 3RI5A 2BYNA 4A97A 5HEHA 5J0ZA 4ZRUA 3IGQA 5SYOA 2VL0A 3RIAA 2YMEA 4TWHA 5LG3A 3WTHA 2ZJUA 4AFHA 4ZJTA 4ZJSA 2QC1B 1I9BA 1UW6A 4FRRA 5J5HA 4UM3A 2XQ8A 2BJ0A 4HFCA 3WTKA 3TLVA 4HFDA 4NZBA 3GUAA 3TLUA 5HEJA 2PH9A 4Z91A 3UQ7A 4TNVA 1UX2A 5CO5A 2Y57A 2XYTA 5HEOA 4Z90A 5KZUA 5TVCA 4ZK4A 3ZKRA 2BR7A 4ILAA 2XZ5A 3LSVA 3JADA 2W8GA 2WZYA 2YOEA 5BRXA 3ZDHA 2BYSA 2XNUA 3C79A 4X5TA 5FJVA 5AFLA 1UV6A 4AFTA 2PGZA 3JAFA 5KE4A 3ZDGA 2Y54A 2YMDA 5HCJA 4QACA 4ALXA 5AFJA 4ZK1A 4HFIA 4LMLA 5HCMA 2XNVA 2BG9C 2BYRA 4TWDA 4EZ1A 4AFGA 2XQ6A 4ILBA 3U8NA 5J5FA 4ZZBA 2XQ4A 4XK9A 4TNWA 4BFQA 3WTNA 4DBMA 4LMKA 3T4MA 2XQ9A 2UZ6A 3SH1A 4HFEA 2BG9A 3WTIA 2Y56A 4UM1A 2Y58A 4WV9A 4UM3S 4COFA 3UUBA 3UU5A 3WTMA 3RQUA 5BP0A 2YKSA 4A98A 3P50A 3PMZA 5AFMB 4QH1A 3RIFA 5LXBA 3U8MA 4UY2A 2BG9B 2XQ5A 3EAMA 3PEOA 3TLSA 5L4EA 2XYSA 3SQ6A 5AFKA 4QH5A 3SIOA 4UM3P 2BR8A 4HFHA 4PIRA 2WNLA 5AFNA 2XQAA 3U8KA 3TLTA 5J5GA 5JMEA 2XQ7A 4F8HA 4D01A 4IL4A 5BW2A 5IUXA 2BYQA 4XHEA 3UU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFM A;  2WNJ A;  4QAA A;  2W8F A;  5HEU A;  5AFH A;  5CFB A;  4TWF A;  2BG9 E;  2ZJV A;  4QAB A;  2WNC A;  4IRE A;  2YN6 A;  3RQW A;  3C84 A;  2XZ6 A;  4ZR6 A;  4B5D A;  5HEG A;  3UQ4 A;  2XQ3 A;  3P4W A;  2XNT A;  2X00 D;  2Y7Y A;  4NPP A;  4IL9 A;  3UU8 A;  3WIP A;  2WN9 A;  3WTJ A;  3RHW A;  5AIN A;  4HQP A;  3WTL A;  4UXU A;  3UU4 A;  2C9T A;  3WTO A;  3UU6 A;  3JAE A;  3SQ9 A;  4QH4 A;  3EHZ A;  3TLW A;  4BQT A;  3U8J A;  3EI0 A;  5L4H A;  5J5I A;  2X00 A;  4HFB A;  5L47 A;  4ILC A;  3U8L A;  4ZZC A;  2BYP A;  4LMJ A;  3RI5 A;  2BYN A;  4A97 A;  5HEH A;  5J0Z A;  4ZRU A;  3IGQ A;  5SYO A;  2VL0 A;  3RIA A;  2YME A;  4TWH A;  5LG3 A;  3WTH A;  2ZJU A;  4AFH A;  4ZJT A;  4ZJS A;  2QC1 B;  1I9B A;  1UW6 A;  4FRR A;  5J5H A;  4UM3 A;  2XQ8 A;  2BJ0 A;  4HFC A;  3WTK A;  3TLV A;  4HFD A;  4NZB A;  3GUA A;  3TLU A;  5HEJ A;  2PH9 A;  4Z91 A;  3UQ7 A;  4TNV A;  1UX2 A;  5CO5 A;  2Y57 A;  2XYT A;  5HEO A;  4Z90 A;  5KZU A;  5TVC A;  4ZK4 A;  3ZKR A;  2BR7 A;  4ILA A;  2XZ5 A;  3LSV A;  3JAD A;  2W8G A;  2WZY A;  2YOE A;  5BRX A;  3ZDH A;  2BYS A;  2XNU A;  3C79 A;  4X5T A;  5FJV A;  5AFL A;  1UV6 A;  4AFT A;  2PGZ A;  3JAF A;  5KE4 A;  3ZDG A;  2Y54 A;  2YMD A;  5HCJ A;  4QAC A;  4ALX A;  5AFJ A;  4ZK1 A;  4HFI A;  4LML A;  5HCM A;  2XNV A;  2BG9 C;  2BYR A;  4TWD A;  4EZ1 A;  4AFG A;  2XQ6 A;  4ILB A;  3U8N A;  5J5F A;  4ZZB A;  2XQ4 A;  4XK9 A;  4TNW A;  4BFQ A;  3WTN A;  4DBM A;  4LMK A;  3T4M A;  2XQ9 A;  2UZ6 A;  3SH1 A;  4HFE A;  2BG9 A;  3WTI A;  2Y56 A;  4UM1 A;  2Y58 A;  4WV9 A;  4UM3 S;  4COF A;  3UUB A;  3UU5 A;  3WTM A;  3RQU A;  5BP0 A;  2YKS A;  4A98 A;  3P50 A;  3PMZ A;  5AFM B;  4QH1 A;  3RIF A;  5LXB A;  3U8M A;  4UY2 A;  2BG9 B;  2XQ5 A;  3EAM A;  3PEO A;  3TLS A;  5L4E A;  2XYS A;  3SQ6 A;  5AFK A;  4QH5 A;  3SIO A;  4UM3 P;  2BR8 A;  4HFH A;  4PIR A;  2WNL A;  5AFN A;  2XQA A;  3U8K A;  3TLT A;  5J5G A;  5JME A;  2XQ7 A;  4F8H A;  4D01 A;  4IL4 A;  5BW2 A;  5IUX A;  2BYQ A;  4XHE A;  3UU3 A; 
#chains in the Genus database with same CATH topology
 5AFM A;  2WNJ A;  4QAA A;  2W8F A;  5HEU A;  5AFH A;  5CFB A;  4TWF A;  2BG9 E;  2ZJV A;  4QAB A;  2WNC A;  4IRE A;  2YN6 A;  3RQW A;  3C84 A;  2XZ6 A;  4ZR6 A;  4B5D A;  5HEG A;  3UQ4 A;  2XQ3 A;  3P4W A;  2XNT A;  2X00 D;  2Y7Y A;  4NPP A;  4IL9 A;  3UU8 A;  3WIP A;  2WN9 A;  3WTJ A;  3RHW A;  5AIN A;  4HQP A;  3WTL A;  4UXU A;  3UU4 A;  2C9T A;  3WTO A;  3UU6 A;  3JAE A;  3SQ9 A;  4QH4 A;  3EHZ A;  3TLW A;  4BQT A;  3U8J A;  3EI0 A;  5L4H A;  5J5I A;  2X00 A;  4HFB A;  5L47 A;  4ILC A;  3U8L A;  4ZZC A;  2BYP A;  4LMJ A;  3RI5 A;  2BYN A;  4A97 A;  5HEH A;  5J0Z A;  4ZRU A;  3IGQ A;  5SYO A;  2VL0 A;  3RIA A;  2YME A;  4TWH A;  5LG3 A;  3WTH A;  2ZJU A;  4AFH A;  4ZJT A;  4ZJS A;  2QC1 B;  1I9B A;  1UW6 A;  4FRR A;  5J5H A;  4UM3 A;  2XQ8 A;  2BJ0 A;  4HFC A;  3WTK A;  3TLV A;  4HFD A;  4NZB A;  3GUA A;  3TLU A;  5HEJ A;  2PH9 A;  4Z91 A;  3UQ7 A;  4TNV A;  1UX2 A;  5CO5 A;  2Y57 A;  2XYT A;  5HEO A;  4Z90 A;  5KZU A;  5TVC A;  4ZK4 A;  3ZKR A;  2BR7 A;  4ILA A;  2XZ5 A;  3LSV A;  3JAD A;  2W8G A;  2WZY A;  2YOE A;  5BRX A;  3ZDH A;  2BYS A;  2XNU A;  3C79 A;  4X5T A;  5FJV A;  5AFL A;  1UV6 A;  4AFT A;  2PGZ A;  3JAF A;  5KE4 A;  3ZDG A;  2Y54 A;  2YMD A;  5HCJ A;  4QAC A;  4ALX A;  5AFJ A;  4ZK1 A;  4HFI A;  4LML A;  5HCM A;  2XNV A;  2BG9 C;  2BYR A;  4TWD A;  4EZ1 A;  4AFG A;  2XQ6 A;  4ILB A;  3U8N A;  5J5F A;  4ZZB A;  2XQ4 A;  4XK9 A;  4TNW A;  4BFQ A;  3WTN A;  4DBM A;  4LMK A;  3T4M A;  2XQ9 A;  2UZ6 A;  3SH1 A;  4HFE A;  2BG9 A;  3WTI A;  2Y56 A;  4UM1 A;  2Y58 A;  4WV9 A;  4UM3 S;  4COF A;  3UUB A;  3UU5 A;  3WTM A;  3RQU A;  5BP0 A;  2YKS A;  4A98 A;  3P50 A;  3PMZ A;  5AFM B;  4QH1 A;  3RIF A;  5LXB A;  3U8M A;  4UY2 A;  2BG9 B;  2XQ5 A;  3EAM A;  3PEO A;  3TLS A;  5L4E A;  2XYS A;  3SQ6 A;  5AFK A;  4QH5 A;  3SIO A;  4UM3 P;  2BR8 A;  4HFH A;  4PIR A;  2WNL A;  5AFN A;  2XQA A;  3U8K A;  3TLT A;  5J5G A;  5JME A;  2XQ7 A;  4F8H A;  4D01 A;  4IL4 A;  5BW2 A;  5IUX A;  2BYQ A;  4XHE A;  3UU3 A; 
#chains in the Genus database with same CATH homology
 5AFM A;  2WNJ A;  4QAA A;  2W8F A;  5HEU A;  5AFH A;  5CFB A;  4TWF A;  2BG9 E;  2ZJV A;  4QAB A;  2WNC A;  4IRE A;  2YN6 A;  3RQW A;  3C84 A;  2XZ6 A;  4ZR6 A;  4B5D A;  5HEG A;  3UQ4 A;  2XQ3 A;  3P4W A;  2XNT A;  2X00 D;  2Y7Y A;  4NPP A;  4IL9 A;  3UU8 A;  3WIP A;  2WN9 A;  3WTJ A;  3RHW A;  5AIN A;  4HQP A;  3WTL A;  4UXU A;  3UU4 A;  2C9T A;  3WTO A;  3UU6 A;  3JAE A;  3SQ9 A;  4QH4 A;  3EHZ A;  3TLW A;  4BQT A;  3U8J A;  3EI0 A;  5L4H A;  5J5I A;  2X00 A;  4HFB A;  5L47 A;  4ILC A;  3U8L A;  4ZZC A;  2BYP A;  4LMJ A;  3RI5 A;  2BYN A;  4A97 A;  5HEH A;  5J0Z A;  4ZRU A;  3IGQ A;  5SYO A;  2VL0 A;  3RIA A;  2YME A;  4TWH A;  5LG3 A;  3WTH A;  2ZJU A;  4AFH A;  4ZJT A;  4ZJS A;  2QC1 B;  1I9B A;  1UW6 A;  4FRR A;  5J5H A;  4UM3 A;  2XQ8 A;  2BJ0 A;  4HFC A;  3WTK A;  3TLV A;  4HFD A;  4NZB A;  3GUA A;  3TLU A;  5HEJ A;  2PH9 A;  4Z91 A;  3UQ7 A;  4TNV A;  1UX2 A;  5CO5 A;  2Y57 A;  2XYT A;  5HEO A;  4Z90 A;  5KZU A;  5TVC A;  4ZK4 A;  3ZKR A;  2BR7 A;  4ILA A;  2XZ5 A;  3LSV A;  3JAD A;  2W8G A;  2WZY A;  2YOE A;  5BRX A;  3ZDH A;  2BYS A;  2XNU A;  3C79 A;  4X5T A;  5FJV A;  5AFL A;  1UV6 A;  4AFT A;  2PGZ A;  3JAF A;  5KE4 A;  3ZDG A;  2Y54 A;  2YMD A;  5HCJ A;  4QAC A;  4ALX A;  5AFJ A;  4ZK1 A;  4HFI A;  4LML A;  5HCM A;  2XNV A;  2BG9 C;  2BYR A;  4TWD A;  4EZ1 A;  4AFG A;  2XQ6 A;  4ILB A;  3U8N A;  5J5F A;  4ZZB A;  2XQ4 A;  4XK9 A;  4TNW A;  4BFQ A;  3WTN A;  4DBM A;  4LMK A;  3T4M A;  2XQ9 A;  2UZ6 A;  3SH1 A;  4HFE A;  2BG9 A;  3WTI A;  2Y56 A;  4UM1 A;  2Y58 A;  4WV9 A;  4UM3 S;  4COF A;  3UUB A;  3UU5 A;  3WTM A;  3RQU A;  5BP0 A;  2YKS A;  4A98 A;  3P50 A;  3PMZ A;  5AFM B;  4QH1 A;  3RIF A;  5LXB A;  3U8M A;  4UY2 A;  2BG9 B;  2XQ5 A;  3EAM A;  3PEO A;  3TLS A;  5L4E A;  2XYS A;  3SQ6 A;  5AFK A;  4QH5 A;  3SIO A;  4UM3 P;  2BR8 A;  4HFH A;  4PIR A;  2WNL A;  5AFN A;  2XQA A;  3U8K A;  3TLT A;  5J5G A;  5JME A;  2XQ7 A;  4F8H A;  4D01 A;  4IL4 A;  5BW2 A;  5IUX A;  2BYQ A;  4XHE A;  3UU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...