4BFQA

Assembly of a triple pi-stack of ligands in the binding site of aplysia californica acetylcholine binding protein (achbp)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
b'QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Assembly of a Pi-Pi Stack of Ligands in the Binding Site of an Acetylcholine Binding Protein
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4bfqA00
4ILCA 4TNWA 4B5DA 2WNLA 5BW2A 5KE4A 2Y54A 2PH9A 3C84A 4UXUA 3ZKRA 4QAAA 4D01A 3WTKA 5HEJA 4AFHA 5J5HA 2WN9A 5HCMA 4QABA 4A97A 2WNCA 4UM3S 3P4WA 5J0ZA 4ILAA 3T4MA 5TVCA 2XYTA 3U8JA 2Y7YA 4HFEA 3UQ7A 4ZR6A 3RIFA 3P50A 4IREA 4ZRUA 1UX2A 2XZ6A 2YMDA 4UM3P 5HEGA 4QH4A 4EZ1A 2BYSA 3WTNA 4AFGA 4ILBA 4NPPA 5BRXA 4HQPA 4TWFA 2XNTA 2BYQA 4QACA 4TWDA 2ZJUA 4UY2A 5HEUA 3SIOA 2UZ6A 2BG9E 3IGQA 3SQ6A 3UU4A 3RQUA 3WTJA 4HFIA 5J5FA 4ZK1A 3JAFA 1UW6A 2XYSA 4ZJTA 5HEOA 4IL9A 2WZYA 2W8GA 3U8NA 3ZDGA 5IUXA 2XQ7A 4ZZBA 4QH5A 4BQTA 4F8HA 3EI0A 3U8KA 5LXBA 3UQ4A 3RI5A 2XNVA 4COFA 4AFTA 2XQ5A 2XQ3A 5L47A 2XQAA 4QH1A 3SQ9A 2QC1B 3UUBA 4LMLA 4ZZCA 5LG3A 4IL4A 3WTLA 3SH1A 2BJ0A 2XQ9A 4ZK4A 4UM3A 4XHEA 5L4HA 3WIPA 4LMJA 3WTOA 2WNJA 3TLWA 2BR8A 2Y58A 5AFJA 2Y56A 3TLTA 5AINA 3U8LA 3U8MA 3UU5A 3WTIA 3ZDHA 3PEOA 4NZBA 5L4EA 5AFLA 5SYOA 3GUAA 4Z90A 1UV6A 2Y57A 3TLVA 4HFHA 4XK9A 4HFBA 3TLUA 4DBMA 4FRRA 5HEHA 3TLSA 2XQ4A 2BYNA 2YN6A 5AFMA 2ZJVA 5AFKA 2BYPA 4PIRA 3LSVA 2C9TA 3UU8A 4LMKA 4HFCA 4TWHA 5AFHA 5KZUA 3RHWA 2VL0A 5CO5A 3EHZA 2XZ5A 3RQWA 2XNUA 5FJVA 5BP0A 5J5GA 5JMEA 5AFNA 4X5TA 4ALXA 3UU6A 2X00A 2BG9A 3UU3A 3C79A 3WTMA 5CFBA 3JADA 4WV9A 2YMEA 2YOEA 5AFMB 2XQ8A 4BFQA 2PGZA 2BYRA 4HFDA 3PMZA 2YKSA 2BG9C 3EAMA 3WTHA 4A98A 2W8FA 3JAEA 4UM1A 2X00D 5HCJA 5J5IA 4ZJSA 2BR7A 1I9BA 3RIAA 4TNVA 2XQ6A 2BG9B 4Z91A
chains in the Genus database with same CATH superfamily
4ILCA 4TNWA 4B5DA 2WNLA 5BW2A 5KE4A 2Y54A 2PH9A 3C84A 4UXUA 3ZKRA 4QAAA 4D01A 3WTKA 5HEJA 4AFHA 5J5HA 2WN9A 5HCMA 4QABA 4A97A 2WNCA 4UM3S 3P4WA 5J0ZA 4ILAA 3T4MA 5TVCA 2XYTA 3U8JA 2Y7YA 4HFEA 3UQ7A 4ZR6A 3RIFA 3P50A 4IREA 4ZRUA 1UX2A 2XZ6A 2YMDA 4UM3P 5HEGA 4QH4A 4EZ1A 2BYSA 3WTNA 4AFGA 4ILBA 4NPPA 5BRXA 4HQPA 4TWFA 2XNTA 2BYQA 4QACA 4TWDA 2ZJUA 4UY2A 5HEUA 3SIOA 2UZ6A 2BG9E 3IGQA 3SQ6A 3UU4A 3RQUA 3WTJA 4HFIA 5J5FA 4ZK1A 3JAFA 1UW6A 2XYSA 4ZJTA 5HEOA 4IL9A 2WZYA 2W8GA 3U8NA 3ZDGA 5IUXA 2XQ7A 4ZZBA 4QH5A 4BQTA 4F8HA 3EI0A 3U8KA 5LXBA 3UQ4A 3RI5A 2XNVA 4COFA 4AFTA 2XQ5A 2XQ3A 5L47A 2XQAA 4QH1A 3SQ9A 2QC1B 3UUBA 4LMLA 4ZZCA 5LG3A 4IL4A 3WTLA 3SH1A 2BJ0A 2XQ9A 4ZK4A 4UM3A 4XHEA 5L4HA 3WIPA 4LMJA 3WTOA 2WNJA 3TLWA 2BR8A 2Y58A 5AFJA 2Y56A 3TLTA 5AINA 3U8LA 3U8MA 3UU5A 3WTIA 3ZDHA 3PEOA 4NZBA 5L4EA 5AFLA 5SYOA 3GUAA 4Z90A 1UV6A 2Y57A 3TLVA 4HFHA 4XK9A 4HFBA 3TLUA 4DBMA 4FRRA 5HEHA 3TLSA 2XQ4A 2BYNA 2YN6A 5AFMA 2ZJVA 5AFKA 2BYPA 4PIRA 3LSVA 2C9TA 3UU8A 4LMKA 4HFCA 4TWHA 5AFHA 5KZUA 3RHWA 2VL0A 5CO5A 3EHZA 2XZ5A 3RQWA 2XNUA 5FJVA 5BP0A 5J5GA 5JMEA 5AFNA 4X5TA 4ALXA 3UU6A 2X00A 2BG9A 3UU3A 3C79A 3WTMA 5CFBA 3JADA 4WV9A 2YMEA 2YOEA 5AFMB 2XQ8A 4BFQA 2PGZA 2BYRA 4HFDA 3PMZA 2YKSA 2BG9C 3EAMA 3WTHA 4A98A 2W8FA 3JAEA 4UM1A 2X00D 5HCJA 5J5IA 4ZJSA 2BR7A 1I9BA 3RIAA 4TNVA 2XQ6A 2BG9B 4Z91A
chains in the Genus database with same CATH topology
4ILCA 4TNWA 4B5DA 2WNLA 5BW2A 5KE4A 2Y54A 2PH9A 3C84A 4UXUA 3ZKRA 4QAAA 4D01A 3WTKA 5HEJA 4AFHA 5J5HA 2WN9A 5HCMA 4QABA 4A97A 2WNCA 4UM3S 3P4WA 5J0ZA 4ILAA 3T4MA 5TVCA 2XYTA 3U8JA 2Y7YA 4HFEA 3UQ7A 4ZR6A 3RIFA 3P50A 4IREA 4ZRUA 1UX2A 2XZ6A 2YMDA 4UM3P 5HEGA 4QH4A 4EZ1A 2BYSA 3WTNA 4AFGA 4ILBA 4NPPA 5BRXA 4HQPA 4TWFA 2XNTA 2BYQA 4QACA 4TWDA 2ZJUA 4UY2A 5HEUA 3SIOA 2UZ6A 2BG9E 3IGQA 3SQ6A 3UU4A 3RQUA 3WTJA 4HFIA 5J5FA 4ZK1A 3JAFA 1UW6A 2XYSA 4ZJTA 5HEOA 4IL9A 2WZYA 2W8GA 3U8NA 3ZDGA 5IUXA 2XQ7A 4ZZBA 4QH5A 4BQTA 4F8HA 3EI0A 3U8KA 5LXBA 3UQ4A 3RI5A 2XNVA 4COFA 4AFTA 2XQ5A 2XQ3A 5L47A 2XQAA 4QH1A 3SQ9A 2QC1B 3UUBA 4LMLA 4ZZCA 5LG3A 4IL4A 3WTLA 3SH1A 2BJ0A 2XQ9A 4ZK4A 4UM3A 4XHEA 5L4HA 3WIPA 4LMJA 3WTOA 2WNJA 3TLWA 2BR8A 2Y58A 5AFJA 2Y56A 3TLTA 5AINA 3U8LA 3U8MA 3UU5A 3WTIA 3ZDHA 3PEOA 4NZBA 5L4EA 5AFLA 5SYOA 3GUAA 4Z90A 1UV6A 2Y57A 3TLVA 4HFHA 4XK9A 4HFBA 3TLUA 4DBMA 4FRRA 5HEHA 3TLSA 2XQ4A 2BYNA 2YN6A 5AFMA 2ZJVA 5AFKA 2BYPA 4PIRA 3LSVA 2C9TA 3UU8A 4LMKA 4HFCA 4TWHA 5AFHA 5KZUA 3RHWA 2VL0A 5CO5A 3EHZA 2XZ5A 3RQWA 2XNUA 5FJVA 5BP0A 5J5GA 5JMEA 5AFNA 4X5TA 4ALXA 3UU6A 2X00A 2BG9A 3UU3A 3C79A 3WTMA 5CFBA 3JADA 4WV9A 2YMEA 2YOEA 5AFMB 2XQ8A 4BFQA 2PGZA 2BYRA 4HFDA 3PMZA 2YKSA 2BG9C 3EAMA 3WTHA 4A98A 2W8FA 3JAEA 4UM1A 2X00D 5HCJA 5J5IA 4ZJSA 2BR7A 1I9BA 3RIAA 4TNVA 2XQ6A 2BG9B 4Z91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILC A;  4TNW A;  4B5D A;  2WNL A;  5BW2 A;  5KE4 A;  2Y54 A;  2PH9 A;  3C84 A;  4UXU A;  3ZKR A;  4QAA A;  4D01 A;  3WTK A;  5HEJ A;  4AFH A;  5J5H A;  2WN9 A;  5HCM A;  4QAB A;  4A97 A;  2WNC A;  4UM3 S;  3P4W A;  5J0Z A;  4ILA A;  3T4M A;  5TVC A;  2XYT A;  3U8J A;  2Y7Y A;  4HFE A;  3UQ7 A;  4ZR6 A;  3RIF A;  3P50 A;  4IRE A;  4ZRU A;  1UX2 A;  2XZ6 A;  2YMD A;  4UM3 P;  5HEG A;  4QH4 A;  4EZ1 A;  2BYS A;  3WTN A;  4AFG A;  4ILB A;  4NPP A;  5BRX A;  4HQP A;  4TWF A;  2XNT A;  2BYQ A;  4QAC A;  4TWD A;  2ZJU A;  4UY2 A;  5HEU A;  3SIO A;  2UZ6 A;  2BG9 E;  3IGQ A;  3SQ6 A;  3UU4 A;  3RQU A;  3WTJ A;  4HFI A;  5J5F A;  4ZK1 A;  3JAF A;  1UW6 A;  2XYS A;  4ZJT A;  5HEO A;  4IL9 A;  2WZY A;  2W8G A;  3U8N A;  3ZDG A;  5IUX A;  2XQ7 A;  4ZZB A;  4QH5 A;  4BQT A;  4F8H A;  3EI0 A;  3U8K A;  5LXB A;  3UQ4 A;  3RI5 A;  2XNV A;  4COF A;  4AFT A;  2XQ5 A;  2XQ3 A;  5L47 A;  2XQA A;  4QH1 A;  3SQ9 A;  2QC1 B;  3UUB A;  4LML A;  4ZZC A;  5LG3 A;  4IL4 A;  3WTL A;  3SH1 A;  2BJ0 A;  2XQ9 A;  4ZK4 A;  4UM3 A;  4XHE A;  5L4H A;  3WIP A;  4LMJ A;  3WTO A;  2WNJ A;  3TLW A;  2BR8 A;  2Y58 A;  5AFJ A;  2Y56 A;  3TLT A;  5AIN A;  3U8L A;  3U8M A;  3UU5 A;  3WTI A;  3ZDH A;  3PEO A;  4NZB A;  5L4E A;  5AFL A;  5SYO A;  3GUA A;  4Z90 A;  1UV6 A;  2Y57 A;  3TLV A;  4HFH A;  4XK9 A;  4HFB A;  3TLU A;  4DBM A;  4FRR A;  5HEH A;  3TLS A;  2XQ4 A;  2BYN A;  2YN6 A;  5AFM A;  2ZJV A;  5AFK A;  2BYP A;  4PIR A;  3LSV A;  2C9T A;  3UU8 A;  4LMK A;  4HFC A;  4TWH A;  5AFH A;  5KZU A;  3RHW A;  2VL0 A;  5CO5 A;  3EHZ A;  2XZ5 A;  3RQW A;  2XNU A;  5FJV A;  5BP0 A;  5J5G A;  5JME A;  5AFN A;  4X5T A;  4ALX A;  3UU6 A;  2X00 A;  2BG9 A;  3UU3 A;  3C79 A;  3WTM A;  5CFB A;  3JAD A;  4WV9 A;  2YME A;  2YOE A;  5AFM B;  2XQ8 A;  4BFQ A;  2PGZ A;  2BYR A;  4HFD A;  3PMZ A;  2YKS A;  2BG9 C;  3EAM A;  3WTH A;  4A98 A;  2W8F A;  3JAE A;  4UM1 A;  2X00 D;  5HCJ A;  5J5I A;  4ZJS A;  2BR7 A;  1I9B A;  3RIA A;  4TNV A;  2XQ6 A;  2BG9 B;  4Z91 A; 
#chains in the Genus database with same CATH topology
 4ILC A;  4TNW A;  4B5D A;  2WNL A;  5BW2 A;  5KE4 A;  2Y54 A;  2PH9 A;  3C84 A;  4UXU A;  3ZKR A;  4QAA A;  4D01 A;  3WTK A;  5HEJ A;  4AFH A;  5J5H A;  2WN9 A;  5HCM A;  4QAB A;  4A97 A;  2WNC A;  4UM3 S;  3P4W A;  5J0Z A;  4ILA A;  3T4M A;  5TVC A;  2XYT A;  3U8J A;  2Y7Y A;  4HFE A;  3UQ7 A;  4ZR6 A;  3RIF A;  3P50 A;  4IRE A;  4ZRU A;  1UX2 A;  2XZ6 A;  2YMD A;  4UM3 P;  5HEG A;  4QH4 A;  4EZ1 A;  2BYS A;  3WTN A;  4AFG A;  4ILB A;  4NPP A;  5BRX A;  4HQP A;  4TWF A;  2XNT A;  2BYQ A;  4QAC A;  4TWD A;  2ZJU A;  4UY2 A;  5HEU A;  3SIO A;  2UZ6 A;  2BG9 E;  3IGQ A;  3SQ6 A;  3UU4 A;  3RQU A;  3WTJ A;  4HFI A;  5J5F A;  4ZK1 A;  3JAF A;  1UW6 A;  2XYS A;  4ZJT A;  5HEO A;  4IL9 A;  2WZY A;  2W8G A;  3U8N A;  3ZDG A;  5IUX A;  2XQ7 A;  4ZZB A;  4QH5 A;  4BQT A;  4F8H A;  3EI0 A;  3U8K A;  5LXB A;  3UQ4 A;  3RI5 A;  2XNV A;  4COF A;  4AFT A;  2XQ5 A;  2XQ3 A;  5L47 A;  2XQA A;  4QH1 A;  3SQ9 A;  2QC1 B;  3UUB A;  4LML A;  4ZZC A;  5LG3 A;  4IL4 A;  3WTL A;  3SH1 A;  2BJ0 A;  2XQ9 A;  4ZK4 A;  4UM3 A;  4XHE A;  5L4H A;  3WIP A;  4LMJ A;  3WTO A;  2WNJ A;  3TLW A;  2BR8 A;  2Y58 A;  5AFJ A;  2Y56 A;  3TLT A;  5AIN A;  3U8L A;  3U8M A;  3UU5 A;  3WTI A;  3ZDH A;  3PEO A;  4NZB A;  5L4E A;  5AFL A;  5SYO A;  3GUA A;  4Z90 A;  1UV6 A;  2Y57 A;  3TLV A;  4HFH A;  4XK9 A;  4HFB A;  3TLU A;  4DBM A;  4FRR A;  5HEH A;  3TLS A;  2XQ4 A;  2BYN A;  2YN6 A;  5AFM A;  2ZJV A;  5AFK A;  2BYP A;  4PIR A;  3LSV A;  2C9T A;  3UU8 A;  4LMK A;  4HFC A;  4TWH A;  5AFH A;  5KZU A;  3RHW A;  2VL0 A;  5CO5 A;  3EHZ A;  2XZ5 A;  3RQW A;  2XNU A;  5FJV A;  5BP0 A;  5J5G A;  5JME A;  5AFN A;  4X5T A;  4ALX A;  3UU6 A;  2X00 A;  2BG9 A;  3UU3 A;  3C79 A;  3WTM A;  5CFB A;  3JAD A;  4WV9 A;  2YME A;  2YOE A;  5AFM B;  2XQ8 A;  4BFQ A;  2PGZ A;  2BYR A;  4HFD A;  3PMZ A;  2YKS A;  2BG9 C;  3EAM A;  3WTH A;  4A98 A;  2W8F A;  3JAE A;  4UM1 A;  2X00 D;  5HCJ A;  5J5I A;  4ZJS A;  2BR7 A;  1I9B A;  3RIA A;  4TNV A;  2XQ6 A;  2BG9 B;  4Z91 A; 
#chains in the Genus database with same CATH homology
 4ILC A;  4TNW A;  4B5D A;  2WNL A;  5BW2 A;  5KE4 A;  2Y54 A;  2PH9 A;  3C84 A;  4UXU A;  3ZKR A;  4QAA A;  4D01 A;  3WTK A;  5HEJ A;  4AFH A;  5J5H A;  2WN9 A;  5HCM A;  4QAB A;  4A97 A;  2WNC A;  4UM3 S;  3P4W A;  5J0Z A;  4ILA A;  3T4M A;  5TVC A;  2XYT A;  3U8J A;  2Y7Y A;  4HFE A;  3UQ7 A;  4ZR6 A;  3RIF A;  3P50 A;  4IRE A;  4ZRU A;  1UX2 A;  2XZ6 A;  2YMD A;  4UM3 P;  5HEG A;  4QH4 A;  4EZ1 A;  2BYS A;  3WTN A;  4AFG A;  4ILB A;  4NPP A;  5BRX A;  4HQP A;  4TWF A;  2XNT A;  2BYQ A;  4QAC A;  4TWD A;  2ZJU A;  4UY2 A;  5HEU A;  3SIO A;  2UZ6 A;  2BG9 E;  3IGQ A;  3SQ6 A;  3UU4 A;  3RQU A;  3WTJ A;  4HFI A;  5J5F A;  4ZK1 A;  3JAF A;  1UW6 A;  2XYS A;  4ZJT A;  5HEO A;  4IL9 A;  2WZY A;  2W8G A;  3U8N A;  3ZDG A;  5IUX A;  2XQ7 A;  4ZZB A;  4QH5 A;  4BQT A;  4F8H A;  3EI0 A;  3U8K A;  5LXB A;  3UQ4 A;  3RI5 A;  2XNV A;  4COF A;  4AFT A;  2XQ5 A;  2XQ3 A;  5L47 A;  2XQA A;  4QH1 A;  3SQ9 A;  2QC1 B;  3UUB A;  4LML A;  4ZZC A;  5LG3 A;  4IL4 A;  3WTL A;  3SH1 A;  2BJ0 A;  2XQ9 A;  4ZK4 A;  4UM3 A;  4XHE A;  5L4H A;  3WIP A;  4LMJ A;  3WTO A;  2WNJ A;  3TLW A;  2BR8 A;  2Y58 A;  5AFJ A;  2Y56 A;  3TLT A;  5AIN A;  3U8L A;  3U8M A;  3UU5 A;  3WTI A;  3ZDH A;  3PEO A;  4NZB A;  5L4E A;  5AFL A;  5SYO A;  3GUA A;  4Z90 A;  1UV6 A;  2Y57 A;  3TLV A;  4HFH A;  4XK9 A;  4HFB A;  3TLU A;  4DBM A;  4FRR A;  5HEH A;  3TLS A;  2XQ4 A;  2BYN A;  2YN6 A;  5AFM A;  2ZJV A;  5AFK A;  2BYP A;  4PIR A;  3LSV A;  2C9T A;  3UU8 A;  4LMK A;  4HFC A;  4TWH A;  5AFH A;  5KZU A;  3RHW A;  2VL0 A;  5CO5 A;  3EHZ A;  2XZ5 A;  3RQW A;  2XNU A;  5FJV A;  5BP0 A;  5J5G A;  5JME A;  5AFN A;  4X5T A;  4ALX A;  3UU6 A;  2X00 A;  2BG9 A;  3UU3 A;  3C79 A;  3WTM A;  5CFB A;  3JAD A;  4WV9 A;  2YME A;  2YOE A;  5AFM B;  2XQ8 A;  4BFQ A;  2PGZ A;  2BYR A;  4HFD A;  3PMZ A;  2YKS A;  2BG9 C;  3EAM A;  3WTH A;  4A98 A;  2W8F A;  3JAE A;  4UM1 A;  2X00 D;  5HCJ A;  5J5I A;  4ZJS A;  2BR7 A;  1I9B A;  3RIA A;  4TNV A;  2XQ6 A;  2BG9 B;  4Z91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...