1C23A

E. coli methionine aminopeptidase: methionine phosphonate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c23A00
4IPAA 3IU7A 2V3ZA 1WKMA 1CHMA 2EVMA 4A6VA 2BWYA 5CIKA 2GG7A 4S2RP 4IKTA 2BWXA 4RZYA 2G6PA 2BHBA 2Q96A 4IU6A 2BWWA 3FMRA 5JHUA 1B59A 1C22A 1N51A 3CB6A 5E5BA 1B6AA 3TAVA 1C23A 5CE6A 3L24A 1BOAA 4IF7A 2HOWA 4FLLA 2GA2A 4S00A 4ZWPA 3MATA 2BHAA 2GG2A 1XNZA 1YJ3A 1WBQA 4ZWOA 2EVCA 2OKNA 4U75A 4U69A 1QXZA 1JAWA 1QZYA 3BIPA 3CTZA 1XGSA 3CB5A 4IKSA 4U6CA 2EA4A 4FLJA 4U1BA 5CDVA 4U76A 5JFRA 2BWSA 1A16A 2MATA 1O0XA 1KQ0A 1WY2A 3L7GA 3PKCA 4A6WA 2P98A 3PKBA 4U6ZA 4U6WA 2BWTA 5CDEA 1WLRA 2ZSGA 5CNXA 1WL9A 3RVAA 3MR1A 3S6BA 4MATA 3IG4A 5D6EA 3PKDA 2BH3A 2Q8KA 4U71A 1XGOA 3FM3A 4R60A 3BITA 1QXYA 2GG8A 1YW9A 4Z7MA 1PV9A 3TB5A 1BN5A 3D27A 2GG0A 1Y1NA 2OAZA 1WL6A 2GU4A 3BIQA 2GU6A 4IDYA 2EVOA 2BN7A 3PKAA 2V6CA 4QR8A 4HXXA 4IECA 4U70A 1M35A 4S2TP 4FO8A 4FKCA 3MX6A 2DFIA 3FMQA 2GU7A 2V3XA 4U6JA 2GU5A 4EGEA 2GZ5A 4JUQA 1XGMA 2NQ7A 1XGNA 2IW2A 1R5GA 2V3YA 4IKRA 1KQ9A 4B28A 2Q92A 4RGZ1 1R5HA 2GG5A 2BWVA 5D6FA 4FO7A 4U6EA 2GTXA 1W2MA 2Q95A 2ADUA 1R58A 1MATA 1YVMA 5FCFA 5FCHA 1KP0A 2BHDA 4FLKA 5CDLA 4U73A 3RORA 2B3LA 2B3HA 4RZZA 2Q93A 3Q6DA 4S01A 5CLSA 1W7VA 2NQ6A 3IU9A 2P99A 2GGBA 2B3KA 1WN1A 1YW7A 1C24A 4FLIA 2GGCA 4ZWUA 3IU8A 5JI6A 2BB7A 2EA2A 2P9AA 2Q94A 4OOKA 1YW8A 4IKUA 2BWUA 3PKEA 1C27A 2GG3A 4PV4A 4KM3A 2GG9A 4PNCA 2BHCA 1QXWA 4ZNGA 1C21A 4FUKA
chains in the Genus database with same CATH superfamily
4IPAA 3IU7A 2V3ZA 1WKMA 1CHMA 2EVMA 4A6VA 2BWYA 5CIKA 2GG7A 4S2RP 4IKTA 2BWXA 4RZYA 2G6PA 2BHBA 2Q96A 4IU6A 2BWWA 3FMRA 5JHUA 1B59A 1C22A 1N51A 3CB6A 5E5BA 1B6AA 3TAVA 1C23A 5CE6A 3L24A 1BOAA 4IF7A 2HOWA 4FLLA 2GA2A 4S00A 4ZWPA 3MATA 2BHAA 2GG2A 1XNZA 1YJ3A 1WBQA 4ZWOA 2EVCA 2OKNA 4U75A 4U69A 1QXZA 1JAWA 1QZYA 3BIPA 3CTZA 1XGSA 3CB5A 4IKSA 4U6CA 2EA4A 4FLJA 4U1BA 5CDVA 4U76A 5JFRA 2BWSA 1A16A 2MATA 1O0XA 1KQ0A 1WY2A 3L7GA 3PKCA 4A6WA 2P98A 3PKBA 4U6ZA 4U6WA 2BWTA 5CDEA 1WLRA 2ZSGA 5CNXA 1WL9A 3RVAA 3MR1A 3S6BA 4MATA 3IG4A 5D6EA 3PKDA 2BH3A 2Q8KA 4U71A 1XGOA 3FM3A 4R60A 3BITA 1QXYA 2GG8A 1YW9A 4Z7MA 1PV9A 3TB5A 1BN5A 3D27A 2GG0A 1Y1NA 2OAZA 1WL6A 2GU4A 3BIQA 2GU6A 4IDYA 2EVOA 2BN7A 3PKAA 2V6CA 4QR8A 4HXXA 4IECA 4U70A 1M35A 4S2TP 4FO8A 4FKCA 3MX6A 2DFIA 3FMQA 2GU7A 2V3XA 4U6JA 2GU5A 4EGEA 2GZ5A 4JUQA 1XGMA 2NQ7A 1XGNA 2IW2A 1R5GA 2V3YA 4IKRA 1KQ9A 4B28A 2Q92A 4RGZ1 1R5HA 2GG5A 2BWVA 5D6FA 4FO7A 4U6EA 2GTXA 1W2MA 2Q95A 2ADUA 1R58A 1MATA 1YVMA 5FCFA 5FCHA 1KP0A 2BHDA 4FLKA 5CDLA 4U73A 3RORA 2B3LA 2B3HA 4RZZA 2Q93A 3Q6DA 4S01A 5CLSA 1W7VA 2NQ6A 3IU9A 2P99A 2GGBA 2B3KA 1WN1A 1YW7A 1C24A 4FLIA 2GGCA 4ZWUA 3IU8A 5JI6A 2BB7A 2EA2A 2P9AA 2Q94A 4OOKA 1YW8A 4IKUA 2BWUA 3PKEA 1C27A 2GG3A 4PV4A 4KM3A 2GG9A 4PNCA 2BHCA 1QXWA 4ZNGA 1C21A 4FUKA
chains in the Genus database with same CATH topology
4IPAA 3IU7A 2V3ZA 1WKMA 1CHMA 2EVMA 4A6VA 2BWYA 5CIKA 2GG7A 4S2RP 4IKTA 2BWXA 4RZYA 2G6PA 2BHBA 2Q96A 4IU6A 2BWWA 3FMRA 5JHUA 1B59A 1C22A 1N51A 3CB6A 5E5BA 1B6AA 3TAVA 1C23A 5CE6A 3L24A 1BOAA 4IF7A 2HOWA 4FLLA 2GA2A 4S00A 4ZWPA 3MATA 2BHAA 2GG2A 1XNZA 1YJ3A 1WBQA 4ZWOA 2EVCA 2OKNA 4U75A 4U69A 1QXZA 1JAWA 1QZYA 3BIPA 3CTZA 1XGSA 3CB5A 4IKSA 4U6CA 2EA4A 4FLJA 4U1BA 5CDVA 4U76A 5JFRA 2BWSA 1A16A 2MATA 1O0XA 1KQ0A 1WY2A 3L7GA 3PKCA 4A6WA 2P98A 3PKBA 4U6ZA 4U6WA 2BWTA 5CDEA 1WLRA 2ZSGA 5CNXA 1WL9A 3RVAA 3MR1A 3S6BA 4MATA 3IG4A 5D6EA 3PKDA 2BH3A 2Q8KA 4U71A 1XGOA 3FM3A 4R60A 3BITA 1QXYA 2GG8A 1YW9A 4Z7MA 1PV9A 3TB5A 1BN5A 3D27A 2GG0A 1Y1NA 2OAZA 1WL6A 2GU4A 3BIQA 2GU6A 4IDYA 2EVOA 2BN7A 3PKAA 2V6CA 4QR8A 4HXXA 4IECA 4U70A 1M35A 4S2TP 4FO8A 4FKCA 3MX6A 2DFIA 3FMQA 2GU7A 2V3XA 4U6JA 2GU5A 4EGEA 2GZ5A 4JUQA 1XGMA 2NQ7A 1XGNA 2IW2A 1R5GA 2V3YA 4IKRA 1KQ9A 4B28A 2Q92A 4RGZ1 1R5HA 2GG5A 2BWVA 5D6FA 4FO7A 4U6EA 2GTXA 1W2MA 2Q95A 2ADUA 1R58A 1MATA 1YVMA 5FCFA 5FCHA 1KP0A 2BHDA 4FLKA 5CDLA 4U73A 3RORA 2B3LA 2B3HA 4RZZA 2Q93A 3Q6DA 4S01A 5CLSA 1W7VA 2NQ6A 3IU9A 2P99A 2GGBA 2B3KA 1WN1A 1YW7A 1C24A 4FLIA 2GGCA 4ZWUA 3IU8A 5JI6A 2BB7A 2EA2A 2P9AA 2Q94A 4OOKA 1YW8A 4IKUA 2BWUA 3PKEA 1C27A 2GG3A 4PV4A 4KM3A 2GG9A 4PNCA 2BHCA 1QXWA 4ZNGA 1C21A 4FUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPA A;  3IU7 A;  2V3Z A;  1WKM A;  1CHM A;  2EVM A;  4A6V A;  2BWY A;  5CIK A;  2GG7 A;  4S2R P;  4IKT A;  2BWX A;  4RZY A;  2G6P A;  2BHB A;  2Q96 A;  4IU6 A;  2BWW A;  3FMR A;  5JHU A;  1B59 A;  1C22 A;  1N51 A;  3CB6 A;  5E5B A;  1B6A A;  3TAV A;  1C23 A;  5CE6 A;  3L24 A;  1BOA A;  4IF7 A;  2HOW A;  4FLL A;  2GA2 A;  4S00 A;  4ZWP A;  3MAT A;  2BHA A;  2GG2 A;  1XNZ A;  1YJ3 A;  1WBQ A;  4ZWO A;  2EVC A;  2OKN A;  4U75 A;  4U69 A;  1QXZ A;  1JAW A;  1QZY A;  3BIP A;  3CTZ A;  1XGS A;  3CB5 A;  4IKS A;  4U6C A;  2EA4 A;  4FLJ A;  4U1B A;  5CDV A;  4U76 A;  5JFR A;  2BWS A;  1A16 A;  2MAT A;  1O0X A;  1KQ0 A;  1WY2 A;  3L7G A;  3PKC A;  4A6W A;  2P98 A;  3PKB A;  4U6Z A;  4U6W A;  2BWT A;  5CDE A;  1WLR A;  2ZSG A;  5CNX A;  1WL9 A;  3RVA A;  3MR1 A;  3S6B A;  4MAT A;  3IG4 A;  5D6E A;  3PKD A;  2BH3 A;  2Q8K A;  4U71 A;  1XGO A;  3FM3 A;  4R60 A;  3BIT A;  1QXY A;  2GG8 A;  1YW9 A;  4Z7M A;  1PV9 A;  3TB5 A;  1BN5 A;  3D27 A;  2GG0 A;  1Y1N A;  2OAZ A;  1WL6 A;  2GU4 A;  3BIQ A;  2GU6 A;  4IDY A;  2EVO A;  2BN7 A;  3PKA A;  2V6C A;  4QR8 A;  4HXX A;  4IEC A;  4U70 A;  1M35 A;  4S2T P;  4FO8 A;  4FKC A;  3MX6 A;  2DFI A;  3FMQ A;  2GU7 A;  2V3X A;  4U6J A;  2GU5 A;  4EGE A;  2GZ5 A;  4JUQ A;  1XGM A;  2NQ7 A;  1XGN A;  2IW2 A;  1R5G A;  2V3Y A;  4IKR A;  1KQ9 A;  4B28 A;  2Q92 A;  4RGZ 1;  1R5H A;  2GG5 A;  2BWV A;  5D6F A;  4FO7 A;  4U6E A;  2GTX A;  1W2M A;  2Q95 A;  2ADU A;  1R58 A;  1MAT A;  1YVM A;  5FCF A;  5FCH A;  1KP0 A;  2BHD A;  4FLK A;  5CDL A;  4U73 A;  3ROR A;  2B3L A;  2B3H A;  4RZZ A;  2Q93 A;  3Q6D A;  4S01 A;  5CLS A;  1W7V A;  2NQ6 A;  3IU9 A;  2P99 A;  2GGB A;  2B3K A;  1WN1 A;  1YW7 A;  1C24 A;  4FLI A;  2GGC A;  4ZWU A;  3IU8 A;  5JI6 A;  2BB7 A;  2EA2 A;  2P9A A;  2Q94 A;  4OOK A;  1YW8 A;  4IKU A;  2BWU A;  3PKE A;  1C27 A;  2GG3 A;  4PV4 A;  4KM3 A;  2GG9 A;  4PNC A;  2BHC A;  1QXW A;  4ZNG A;  1C21 A;  4FUK A; 
#chains in the Genus database with same CATH topology
 4IPA A;  3IU7 A;  2V3Z A;  1WKM A;  1CHM A;  2EVM A;  4A6V A;  2BWY A;  5CIK A;  2GG7 A;  4S2R P;  4IKT A;  2BWX A;  4RZY A;  2G6P A;  2BHB A;  2Q96 A;  4IU6 A;  2BWW A;  3FMR A;  5JHU A;  1B59 A;  1C22 A;  1N51 A;  3CB6 A;  5E5B A;  1B6A A;  3TAV A;  1C23 A;  5CE6 A;  3L24 A;  1BOA A;  4IF7 A;  2HOW A;  4FLL A;  2GA2 A;  4S00 A;  4ZWP A;  3MAT A;  2BHA A;  2GG2 A;  1XNZ A;  1YJ3 A;  1WBQ A;  4ZWO A;  2EVC A;  2OKN A;  4U75 A;  4U69 A;  1QXZ A;  1JAW A;  1QZY A;  3BIP A;  3CTZ A;  1XGS A;  3CB5 A;  4IKS A;  4U6C A;  2EA4 A;  4FLJ A;  4U1B A;  5CDV A;  4U76 A;  5JFR A;  2BWS A;  1A16 A;  2MAT A;  1O0X A;  1KQ0 A;  1WY2 A;  3L7G A;  3PKC A;  4A6W A;  2P98 A;  3PKB A;  4U6Z A;  4U6W A;  2BWT A;  5CDE A;  1WLR A;  2ZSG A;  5CNX A;  1WL9 A;  3RVA A;  3MR1 A;  3S6B A;  4MAT A;  3IG4 A;  5D6E A;  3PKD A;  2BH3 A;  2Q8K A;  4U71 A;  1XGO A;  3FM3 A;  4R60 A;  3BIT A;  1QXY A;  2GG8 A;  1YW9 A;  4Z7M A;  1PV9 A;  3TB5 A;  1BN5 A;  3D27 A;  2GG0 A;  1Y1N A;  2OAZ A;  1WL6 A;  2GU4 A;  3BIQ A;  2GU6 A;  4IDY A;  2EVO A;  2BN7 A;  3PKA A;  2V6C A;  4QR8 A;  4HXX A;  4IEC A;  4U70 A;  1M35 A;  4S2T P;  4FO8 A;  4FKC A;  3MX6 A;  2DFI A;  3FMQ A;  2GU7 A;  2V3X A;  4U6J A;  2GU5 A;  4EGE A;  2GZ5 A;  4JUQ A;  1XGM A;  2NQ7 A;  1XGN A;  2IW2 A;  1R5G A;  2V3Y A;  4IKR A;  1KQ9 A;  4B28 A;  2Q92 A;  4RGZ 1;  1R5H A;  2GG5 A;  2BWV A;  5D6F A;  4FO7 A;  4U6E A;  2GTX A;  1W2M A;  2Q95 A;  2ADU A;  1R58 A;  1MAT A;  1YVM A;  5FCF A;  5FCH A;  1KP0 A;  2BHD A;  4FLK A;  5CDL A;  4U73 A;  3ROR A;  2B3L A;  2B3H A;  4RZZ A;  2Q93 A;  3Q6D A;  4S01 A;  5CLS A;  1W7V A;  2NQ6 A;  3IU9 A;  2P99 A;  2GGB A;  2B3K A;  1WN1 A;  1YW7 A;  1C24 A;  4FLI A;  2GGC A;  4ZWU A;  3IU8 A;  5JI6 A;  2BB7 A;  2EA2 A;  2P9A A;  2Q94 A;  4OOK A;  1YW8 A;  4IKU A;  2BWU A;  3PKE A;  1C27 A;  2GG3 A;  4PV4 A;  4KM3 A;  2GG9 A;  4PNC A;  2BHC A;  1QXW A;  4ZNG A;  1C21 A;  4FUK A; 
#chains in the Genus database with same CATH homology
 4IPA A;  3IU7 A;  2V3Z A;  1WKM A;  1CHM A;  2EVM A;  4A6V A;  2BWY A;  5CIK A;  2GG7 A;  4S2R P;  4IKT A;  2BWX A;  4RZY A;  2G6P A;  2BHB A;  2Q96 A;  4IU6 A;  2BWW A;  3FMR A;  5JHU A;  1B59 A;  1C22 A;  1N51 A;  3CB6 A;  5E5B A;  1B6A A;  3TAV A;  1C23 A;  5CE6 A;  3L24 A;  1BOA A;  4IF7 A;  2HOW A;  4FLL A;  2GA2 A;  4S00 A;  4ZWP A;  3MAT A;  2BHA A;  2GG2 A;  1XNZ A;  1YJ3 A;  1WBQ A;  4ZWO A;  2EVC A;  2OKN A;  4U75 A;  4U69 A;  1QXZ A;  1JAW A;  1QZY A;  3BIP A;  3CTZ A;  1XGS A;  3CB5 A;  4IKS A;  4U6C A;  2EA4 A;  4FLJ A;  4U1B A;  5CDV A;  4U76 A;  5JFR A;  2BWS A;  1A16 A;  2MAT A;  1O0X A;  1KQ0 A;  1WY2 A;  3L7G A;  3PKC A;  4A6W A;  2P98 A;  3PKB A;  4U6Z A;  4U6W A;  2BWT A;  5CDE A;  1WLR A;  2ZSG A;  5CNX A;  1WL9 A;  3RVA A;  3MR1 A;  3S6B A;  4MAT A;  3IG4 A;  5D6E A;  3PKD A;  2BH3 A;  2Q8K A;  4U71 A;  1XGO A;  3FM3 A;  4R60 A;  3BIT A;  1QXY A;  2GG8 A;  1YW9 A;  4Z7M A;  1PV9 A;  3TB5 A;  1BN5 A;  3D27 A;  2GG0 A;  1Y1N A;  2OAZ A;  1WL6 A;  2GU4 A;  3BIQ A;  2GU6 A;  4IDY A;  2EVO A;  2BN7 A;  3PKA A;  2V6C A;  4QR8 A;  4HXX A;  4IEC A;  4U70 A;  1M35 A;  4S2T P;  4FO8 A;  4FKC A;  3MX6 A;  2DFI A;  3FMQ A;  2GU7 A;  2V3X A;  4U6J A;  2GU5 A;  4EGE A;  2GZ5 A;  4JUQ A;  1XGM A;  2NQ7 A;  1XGN A;  2IW2 A;  1R5G A;  2V3Y A;  4IKR A;  1KQ9 A;  4B28 A;  2Q92 A;  4RGZ 1;  1R5H A;  2GG5 A;  2BWV A;  5D6F A;  4FO7 A;  4U6E A;  2GTX A;  1W2M A;  2Q95 A;  2ADU A;  1R58 A;  1MAT A;  1YVM A;  5FCF A;  5FCH A;  1KP0 A;  2BHD A;  4FLK A;  5CDL A;  4U73 A;  3ROR A;  2B3L A;  2B3H A;  4RZZ A;  2Q93 A;  3Q6D A;  4S01 A;  5CLS A;  1W7V A;  2NQ6 A;  3IU9 A;  2P99 A;  2GGB A;  2B3K A;  1WN1 A;  1YW7 A;  1C24 A;  4FLI A;  2GGC A;  4ZWU A;  3IU8 A;  5JI6 A;  2BB7 A;  2EA2 A;  2P9A A;  2Q94 A;  4OOK A;  1YW8 A;  4IKU A;  2BWU A;  3PKE A;  1C27 A;  2GG3 A;  4PV4 A;  4KM3 A;  2GG9 A;  4PNC A;  2BHC A;  1QXW A;  4ZNG A;  1C21 A;  4FUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...