1C23A

E. coli methionine aminopeptidase: methionine phosphonate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c23A00
4Z7MA 2BB7A 1A16A 4IF7A 4U6ZA 5CIKA 4RGZ1 3IU9A 3BIPA 2GU6A 2DFIA 3RORA 1XGNA 4KM3A 2GG8A 5FCFA 2GGBA 3CB5A 5D6FA 2GU7A 2ZSGA 4MATA 4PNCA 2V3YA 1N51A 3D27A 5JFRA 2P98A 4QR8A 5FCHA 2P9AA 2EVCA 2EVMA 2NQ6A 1QXYA 2B3LA 1XGSA 3MX6A 1BN5A 4S01A 5JI6A 2BWTA 2B3KA 4ZWOA 4EGEA 2V3ZA 1B6AA 1WN1A 1KQ0A 2EA4A 4U1BA 1YW7A 5D6EA 2V3XA 3S6BA 5CE6A 4A6WA 2OKNA 2GG2A 4RZZA 1CHMA 2MATA 4FO7A 1O0XA 4FLJA 4FKCA 3L24A 3CTZA 4S2RP 2BHCA 4U71A 2BWXA 2Q8KA 3TB5A 5CDVA 1C23A 1XNZA 1WY2A 1C21A 2EVOA 4PV4A 1WKMA 2Q92A 2GU5A 1C27A 3FMQA 4FLKA 5CDLA 4U76A 4IKTA 2Q93A 3L7GA 4IKRA 1WLRA 2BWUA 2BWYA 4IDYA 5CDEA 1WL9A 1W2MA 3MATA 1R5HA 1YW9A 5E5BA 4FO8A 4IKSA 1JAWA 1BOAA 2Q94A 2IW2A 1QXWA 5CLSA 2GG9A 2P99A 5CNXA 4A6VA 1YW8A 2BWVA 4ZNGA 2V6CA 4HXXA 3TAVA 4U6JA 4U69A 2Q95A 3FM3A 2GZ5A 4ZWPA 3RVAA 2ADUA 2BWWA 2GG5A 3PKDA 1KP0A 3CB6A 4U6EA 1R58A 2GG0A 4S2TP 1C24A 2NQ7A 3FMRA 3PKCA 1M35A 2B3HA 3IU7A 4OOKA 4ZWUA 2GGCA 1YJ3A 4FLLA 2GTXA 3PKAA 3Q6DA 2GG7A 3BITA 3MR1A 4U6WA 4JUQA 1WL6A 2BHAA 2GU4A 4R60A 4U70A 4IKUA 1XGMA 2GG3A 3PKEA 4IPAA 1MATA 4FLIA 3PKBA 2BHDA 2HOWA 4U6CA 4U75A 4RZYA 2GA2A 1KQ9A 3IG4A 1QXZA 1PV9A 2EA2A 1W7VA 2BN7A 2G6PA 2BHBA 1WBQA 2OAZA 1C22A 5JHUA 4IECA 4B28A 1YVMA 3IU8A 1QZYA 3BIQA 4FUKA 2Q96A 1XGOA 1R5GA 1Y1NA 2BH3A 4S00A 4IU6A 4U73A 2BWSA 1B59A
chains in the Genus database with same CATH superfamily
4Z7MA 2BB7A 1A16A 4IF7A 4U6ZA 5CIKA 4RGZ1 3IU9A 3BIPA 2GU6A 2DFIA 3RORA 1XGNA 4KM3A 2GG8A 5FCFA 2GGBA 3CB5A 5D6FA 2GU7A 2ZSGA 4MATA 4PNCA 2V3YA 1N51A 3D27A 5JFRA 2P98A 4QR8A 5FCHA 2P9AA 2EVCA 2EVMA 2NQ6A 1QXYA 2B3LA 1XGSA 3MX6A 1BN5A 4S01A 5JI6A 2BWTA 2B3KA 4ZWOA 4EGEA 2V3ZA 1B6AA 1WN1A 1KQ0A 2EA4A 4U1BA 1YW7A 5D6EA 2V3XA 3S6BA 5CE6A 4A6WA 2OKNA 2GG2A 4RZZA 1CHMA 2MATA 4FO7A 1O0XA 4FLJA 4FKCA 3L24A 3CTZA 4S2RP 2BHCA 4U71A 2BWXA 2Q8KA 3TB5A 5CDVA 1C23A 1XNZA 1WY2A 1C21A 2EVOA 4PV4A 1WKMA 2Q92A 2GU5A 1C27A 3FMQA 4FLKA 5CDLA 4U76A 4IKTA 2Q93A 3L7GA 4IKRA 1WLRA 2BWUA 2BWYA 4IDYA 5CDEA 1WL9A 1W2MA 3MATA 1R5HA 1YW9A 5E5BA 4FO8A 4IKSA 1JAWA 1BOAA 2Q94A 2IW2A 1QXWA 5CLSA 2GG9A 2P99A 5CNXA 4A6VA 1YW8A 2BWVA 4ZNGA 2V6CA 4HXXA 3TAVA 4U6JA 4U69A 2Q95A 3FM3A 2GZ5A 4ZWPA 3RVAA 2ADUA 2BWWA 2GG5A 3PKDA 1KP0A 3CB6A 4U6EA 1R58A 2GG0A 4S2TP 1C24A 2NQ7A 3FMRA 3PKCA 1M35A 2B3HA 3IU7A 4OOKA 4ZWUA 2GGCA 1YJ3A 4FLLA 2GTXA 3PKAA 3Q6DA 2GG7A 3BITA 3MR1A 4U6WA 4JUQA 1WL6A 2BHAA 2GU4A 4R60A 4U70A 4IKUA 1XGMA 2GG3A 3PKEA 4IPAA 1MATA 4FLIA 3PKBA 2BHDA 2HOWA 4U6CA 4U75A 4RZYA 2GA2A 1KQ9A 3IG4A 1QXZA 1PV9A 2EA2A 1W7VA 2BN7A 2G6PA 2BHBA 1WBQA 2OAZA 1C22A 5JHUA 4IECA 4B28A 1YVMA 3IU8A 1QZYA 3BIQA 4FUKA 2Q96A 1XGOA 1R5GA 1Y1NA 2BH3A 4S00A 4IU6A 4U73A 2BWSA 1B59A
chains in the Genus database with same CATH topology
4Z7MA 2BB7A 1A16A 4IF7A 4U6ZA 5CIKA 4RGZ1 3IU9A 3BIPA 2GU6A 2DFIA 3RORA 1XGNA 4KM3A 2GG8A 5FCFA 2GGBA 3CB5A 5D6FA 2GU7A 2ZSGA 4MATA 4PNCA 2V3YA 1N51A 3D27A 5JFRA 2P98A 4QR8A 5FCHA 2P9AA 2EVCA 2EVMA 2NQ6A 1QXYA 2B3LA 1XGSA 3MX6A 1BN5A 4S01A 5JI6A 2BWTA 2B3KA 4ZWOA 4EGEA 2V3ZA 1B6AA 1WN1A 1KQ0A 2EA4A 4U1BA 1YW7A 5D6EA 2V3XA 3S6BA 5CE6A 4A6WA 2OKNA 2GG2A 4RZZA 1CHMA 2MATA 4FO7A 1O0XA 4FLJA 4FKCA 3L24A 3CTZA 4S2RP 2BHCA 4U71A 2BWXA 2Q8KA 3TB5A 5CDVA 1C23A 1XNZA 1WY2A 1C21A 2EVOA 4PV4A 1WKMA 2Q92A 2GU5A 1C27A 3FMQA 4FLKA 5CDLA 4U76A 4IKTA 2Q93A 3L7GA 4IKRA 1WLRA 2BWUA 2BWYA 4IDYA 5CDEA 1WL9A 1W2MA 3MATA 1R5HA 1YW9A 5E5BA 4FO8A 4IKSA 1JAWA 1BOAA 2Q94A 2IW2A 1QXWA 5CLSA 2GG9A 2P99A 5CNXA 4A6VA 1YW8A 2BWVA 4ZNGA 2V6CA 4HXXA 3TAVA 4U6JA 4U69A 2Q95A 3FM3A 2GZ5A 4ZWPA 3RVAA 2ADUA 2BWWA 2GG5A 3PKDA 1KP0A 3CB6A 4U6EA 1R58A 2GG0A 4S2TP 1C24A 2NQ7A 3FMRA 3PKCA 1M35A 2B3HA 3IU7A 4OOKA 4ZWUA 2GGCA 1YJ3A 4FLLA 2GTXA 3PKAA 3Q6DA 2GG7A 3BITA 3MR1A 4U6WA 4JUQA 1WL6A 2BHAA 2GU4A 4R60A 4U70A 4IKUA 1XGMA 2GG3A 3PKEA 4IPAA 1MATA 4FLIA 3PKBA 2BHDA 2HOWA 4U6CA 4U75A 4RZYA 2GA2A 1KQ9A 3IG4A 1QXZA 1PV9A 2EA2A 1W7VA 2BN7A 2G6PA 2BHBA 1WBQA 2OAZA 1C22A 5JHUA 4IECA 4B28A 1YVMA 3IU8A 1QZYA 3BIQA 4FUKA 2Q96A 1XGOA 1R5GA 1Y1NA 2BH3A 4S00A 4IU6A 4U73A 2BWSA 1B59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7M A;  2BB7 A;  1A16 A;  4IF7 A;  4U6Z A;  5CIK A;  4RGZ 1;  3IU9 A;  3BIP A;  2GU6 A;  2DFI A;  3ROR A;  1XGN A;  4KM3 A;  2GG8 A;  5FCF A;  2GGB A;  3CB5 A;  5D6F A;  2GU7 A;  2ZSG A;  4MAT A;  4PNC A;  2V3Y A;  1N51 A;  3D27 A;  5JFR A;  2P98 A;  4QR8 A;  5FCH A;  2P9A A;  2EVC A;  2EVM A;  2NQ6 A;  1QXY A;  2B3L A;  1XGS A;  3MX6 A;  1BN5 A;  4S01 A;  5JI6 A;  2BWT A;  2B3K A;  4ZWO A;  4EGE A;  2V3Z A;  1B6A A;  1WN1 A;  1KQ0 A;  2EA4 A;  4U1B A;  1YW7 A;  5D6E A;  2V3X A;  3S6B A;  5CE6 A;  4A6W A;  2OKN A;  2GG2 A;  4RZZ A;  1CHM A;  2MAT A;  4FO7 A;  1O0X A;  4FLJ A;  4FKC A;  3L24 A;  3CTZ A;  4S2R P;  2BHC A;  4U71 A;  2BWX A;  2Q8K A;  3TB5 A;  5CDV A;  1C23 A;  1XNZ A;  1WY2 A;  1C21 A;  2EVO A;  4PV4 A;  1WKM A;  2Q92 A;  2GU5 A;  1C27 A;  3FMQ A;  4FLK A;  5CDL A;  4U76 A;  4IKT A;  2Q93 A;  3L7G A;  4IKR A;  1WLR A;  2BWU A;  2BWY A;  4IDY A;  5CDE A;  1WL9 A;  1W2M A;  3MAT A;  1R5H A;  1YW9 A;  5E5B A;  4FO8 A;  4IKS A;  1JAW A;  1BOA A;  2Q94 A;  2IW2 A;  1QXW A;  5CLS A;  2GG9 A;  2P99 A;  5CNX A;  4A6V A;  1YW8 A;  2BWV A;  4ZNG A;  2V6C A;  4HXX A;  3TAV A;  4U6J A;  4U69 A;  2Q95 A;  3FM3 A;  2GZ5 A;  4ZWP A;  3RVA A;  2ADU A;  2BWW A;  2GG5 A;  3PKD A;  1KP0 A;  3CB6 A;  4U6E A;  1R58 A;  2GG0 A;  4S2T P;  1C24 A;  2NQ7 A;  3FMR A;  3PKC A;  1M35 A;  2B3H A;  3IU7 A;  4OOK A;  4ZWU A;  2GGC A;  1YJ3 A;  4FLL A;  2GTX A;  3PKA A;  3Q6D A;  2GG7 A;  3BIT A;  3MR1 A;  4U6W A;  4JUQ A;  1WL6 A;  2BHA A;  2GU4 A;  4R60 A;  4U70 A;  4IKU A;  1XGM A;  2GG3 A;  3PKE A;  4IPA A;  1MAT A;  4FLI A;  3PKB A;  2BHD A;  2HOW A;  4U6C A;  4U75 A;  4RZY A;  2GA2 A;  1KQ9 A;  3IG4 A;  1QXZ A;  1PV9 A;  2EA2 A;  1W7V A;  2BN7 A;  2G6P A;  2BHB A;  1WBQ A;  2OAZ A;  1C22 A;  5JHU A;  4IEC A;  4B28 A;  1YVM A;  3IU8 A;  1QZY A;  3BIQ A;  4FUK A;  2Q96 A;  1XGO A;  1R5G A;  1Y1N A;  2BH3 A;  4S00 A;  4IU6 A;  4U73 A;  2BWS A;  1B59 A; 
#chains in the Genus database with same CATH topology
 4Z7M A;  2BB7 A;  1A16 A;  4IF7 A;  4U6Z A;  5CIK A;  4RGZ 1;  3IU9 A;  3BIP A;  2GU6 A;  2DFI A;  3ROR A;  1XGN A;  4KM3 A;  2GG8 A;  5FCF A;  2GGB A;  3CB5 A;  5D6F A;  2GU7 A;  2ZSG A;  4MAT A;  4PNC A;  2V3Y A;  1N51 A;  3D27 A;  5JFR A;  2P98 A;  4QR8 A;  5FCH A;  2P9A A;  2EVC A;  2EVM A;  2NQ6 A;  1QXY A;  2B3L A;  1XGS A;  3MX6 A;  1BN5 A;  4S01 A;  5JI6 A;  2BWT A;  2B3K A;  4ZWO A;  4EGE A;  2V3Z A;  1B6A A;  1WN1 A;  1KQ0 A;  2EA4 A;  4U1B A;  1YW7 A;  5D6E A;  2V3X A;  3S6B A;  5CE6 A;  4A6W A;  2OKN A;  2GG2 A;  4RZZ A;  1CHM A;  2MAT A;  4FO7 A;  1O0X A;  4FLJ A;  4FKC A;  3L24 A;  3CTZ A;  4S2R P;  2BHC A;  4U71 A;  2BWX A;  2Q8K A;  3TB5 A;  5CDV A;  1C23 A;  1XNZ A;  1WY2 A;  1C21 A;  2EVO A;  4PV4 A;  1WKM A;  2Q92 A;  2GU5 A;  1C27 A;  3FMQ A;  4FLK A;  5CDL A;  4U76 A;  4IKT A;  2Q93 A;  3L7G A;  4IKR A;  1WLR A;  2BWU A;  2BWY A;  4IDY A;  5CDE A;  1WL9 A;  1W2M A;  3MAT A;  1R5H A;  1YW9 A;  5E5B A;  4FO8 A;  4IKS A;  1JAW A;  1BOA A;  2Q94 A;  2IW2 A;  1QXW A;  5CLS A;  2GG9 A;  2P99 A;  5CNX A;  4A6V A;  1YW8 A;  2BWV A;  4ZNG A;  2V6C A;  4HXX A;  3TAV A;  4U6J A;  4U69 A;  2Q95 A;  3FM3 A;  2GZ5 A;  4ZWP A;  3RVA A;  2ADU A;  2BWW A;  2GG5 A;  3PKD A;  1KP0 A;  3CB6 A;  4U6E A;  1R58 A;  2GG0 A;  4S2T P;  1C24 A;  2NQ7 A;  3FMR A;  3PKC A;  1M35 A;  2B3H A;  3IU7 A;  4OOK A;  4ZWU A;  2GGC A;  1YJ3 A;  4FLL A;  2GTX A;  3PKA A;  3Q6D A;  2GG7 A;  3BIT A;  3MR1 A;  4U6W A;  4JUQ A;  1WL6 A;  2BHA A;  2GU4 A;  4R60 A;  4U70 A;  4IKU A;  1XGM A;  2GG3 A;  3PKE A;  4IPA A;  1MAT A;  4FLI A;  3PKB A;  2BHD A;  2HOW A;  4U6C A;  4U75 A;  4RZY A;  2GA2 A;  1KQ9 A;  3IG4 A;  1QXZ A;  1PV9 A;  2EA2 A;  1W7V A;  2BN7 A;  2G6P A;  2BHB A;  1WBQ A;  2OAZ A;  1C22 A;  5JHU A;  4IEC A;  4B28 A;  1YVM A;  3IU8 A;  1QZY A;  3BIQ A;  4FUK A;  2Q96 A;  1XGO A;  1R5G A;  1Y1N A;  2BH3 A;  4S00 A;  4IU6 A;  4U73 A;  2BWS A;  1B59 A; 
#chains in the Genus database with same CATH homology
 4Z7M A;  2BB7 A;  1A16 A;  4IF7 A;  4U6Z A;  5CIK A;  4RGZ 1;  3IU9 A;  3BIP A;  2GU6 A;  2DFI A;  3ROR A;  1XGN A;  4KM3 A;  2GG8 A;  5FCF A;  2GGB A;  3CB5 A;  5D6F A;  2GU7 A;  2ZSG A;  4MAT A;  4PNC A;  2V3Y A;  1N51 A;  3D27 A;  5JFR A;  2P98 A;  4QR8 A;  5FCH A;  2P9A A;  2EVC A;  2EVM A;  2NQ6 A;  1QXY A;  2B3L A;  1XGS A;  3MX6 A;  1BN5 A;  4S01 A;  5JI6 A;  2BWT A;  2B3K A;  4ZWO A;  4EGE A;  2V3Z A;  1B6A A;  1WN1 A;  1KQ0 A;  2EA4 A;  4U1B A;  1YW7 A;  5D6E A;  2V3X A;  3S6B A;  5CE6 A;  4A6W A;  2OKN A;  2GG2 A;  4RZZ A;  1CHM A;  2MAT A;  4FO7 A;  1O0X A;  4FLJ A;  4FKC A;  3L24 A;  3CTZ A;  4S2R P;  2BHC A;  4U71 A;  2BWX A;  2Q8K A;  3TB5 A;  5CDV A;  1C23 A;  1XNZ A;  1WY2 A;  1C21 A;  2EVO A;  4PV4 A;  1WKM A;  2Q92 A;  2GU5 A;  1C27 A;  3FMQ A;  4FLK A;  5CDL A;  4U76 A;  4IKT A;  2Q93 A;  3L7G A;  4IKR A;  1WLR A;  2BWU A;  2BWY A;  4IDY A;  5CDE A;  1WL9 A;  1W2M A;  3MAT A;  1R5H A;  1YW9 A;  5E5B A;  4FO8 A;  4IKS A;  1JAW A;  1BOA A;  2Q94 A;  2IW2 A;  1QXW A;  5CLS A;  2GG9 A;  2P99 A;  5CNX A;  4A6V A;  1YW8 A;  2BWV A;  4ZNG A;  2V6C A;  4HXX A;  3TAV A;  4U6J A;  4U69 A;  2Q95 A;  3FM3 A;  2GZ5 A;  4ZWP A;  3RVA A;  2ADU A;  2BWW A;  2GG5 A;  3PKD A;  1KP0 A;  3CB6 A;  4U6E A;  1R58 A;  2GG0 A;  4S2T P;  1C24 A;  2NQ7 A;  3FMR A;  3PKC A;  1M35 A;  2B3H A;  3IU7 A;  4OOK A;  4ZWU A;  2GGC A;  1YJ3 A;  4FLL A;  2GTX A;  3PKA A;  3Q6D A;  2GG7 A;  3BIT A;  3MR1 A;  4U6W A;  4JUQ A;  1WL6 A;  2BHA A;  2GU4 A;  4R60 A;  4U70 A;  4IKU A;  1XGM A;  2GG3 A;  3PKE A;  4IPA A;  1MAT A;  4FLI A;  3PKB A;  2BHD A;  2HOW A;  4U6C A;  4U75 A;  4RZY A;  2GA2 A;  1KQ9 A;  3IG4 A;  1QXZ A;  1PV9 A;  2EA2 A;  1W7V A;  2BN7 A;  2G6P A;  2BHB A;  1WBQ A;  2OAZ A;  1C22 A;  5JHU A;  4IEC A;  4B28 A;  1YVM A;  3IU8 A;  1QZY A;  3BIQ A;  4FUK A;  2Q96 A;  1XGO A;  1R5G A;  1Y1N A;  2BH3 A;  4S00 A;  4IU6 A;  4U73 A;  2BWS A;  1B59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...