1C23A

E. coli methionine aminopeptidase: methionine phosphonate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c23A00
3CB5A 2G6PA 3FMQA 2Q95A 1WL9A 5JI6A 4S2RP 1R5GA 4ZNGA 1XGSA 2GG5A 1R5HA 2Q8KA 1WY2A 2GTXA 4S00A 4ZWOA 2BWSA 4IKRA 2BWVA 2EVMA 2BB7A 4U76A 3S6BA 4U75A 1W2MA 3PKDA 2BHAA 2P98A 5CE6A 1QXWA 4QR8A 2GA2A 2OKNA 2V3XA 1BOAA 2NQ6A 1C23A 4U69A 4A6VA 2IW2A 2BWUA 5CNXA 4IF7A 3TAVA 3PKBA 3L7GA 2GG3A 1N51A 4MATA 3PKEA 4U1BA 3IU9A 4ZWUA 4ZWPA 1BN5A 1C24A 1C27A 1JAWA 1QXZA 2EVCA 1QXYA 1A16A 5CDLA 1C21A 4JUQA 2B3LA 4S01A 3IG4A 1YW8A 2GU6A 3D27A 4U6ZA 3FM3A 4IKUA 3FMRA 3BIPA 2BWWA 4FLKA 2DFIA 1XGMA 4U70A 4IPAA 1WN1A 3PKCA 4KM3A 4IKTA 2BHCA 1WL6A 2HOWA 4U6WA 2GG9A 3MX6A 1M35A 2GGBA 2BHDA 5E5BA 4FKCA 4HXXA 1YW9A 2NQ7A 5D6FA 4RZYA 2GG2A 4IDYA 5JFRA 4EGEA 4U6CA 1MATA 2GZ5A 2GU5A 2BWTA 2BWYA 1WLRA 4FLJA 4U73A 2ADUA 1CHMA 1KP0A 2B3HA 2Q96A 1XGOA 3MATA 4R60A 4FO8A 4OOKA 5FCHA 2B3KA 4IKSA 4U71A 1KQ0A 2GG7A 5CDVA 1B59A 3BIQA 2GG8A 2Q92A 4FLIA 2Q93A 1KQ9A 5CIKA 5CDEA 3CB6A 3RORA 1WBQA 5JHUA 4PNCA 1PV9A 1XNZA 4RZZA 3TB5A 3L24A 3IU8A 3PKAA 2MATA 2EVOA 3MR1A 3RVAA 4IECA 2BWXA 1B6AA 4FO7A 1YJ3A 1R58A 2EA4A 2Q94A 2V6CA 4U6JA 1WKMA 2BHBA 4Z7MA 5FCFA 4B28A 2GGCA 4FLLA 3CTZA 3Q6DA 3BITA 4A6WA 2GU4A 1O0XA 5CLSA 2P99A 2BH3A 2ZSGA 1XGNA 1Y1NA 4FUKA 4U6EA 1W7VA 4S2TP 1QZYA 2GG0A 2EA2A 4RGZ1 2P9AA 2GU7A 4PV4A 1C22A 4IU6A 2V3YA 2V3ZA 2BN7A 5D6EA 1YW7A 3IU7A 2OAZA 1YVMA
chains in the Genus database with same CATH superfamily
3CB5A 2G6PA 3FMQA 2Q95A 1WL9A 5JI6A 4S2RP 1R5GA 4ZNGA 1XGSA 2GG5A 1R5HA 2Q8KA 1WY2A 2GTXA 4S00A 4ZWOA 2BWSA 4IKRA 2BWVA 2EVMA 2BB7A 4U76A 3S6BA 4U75A 1W2MA 3PKDA 2BHAA 2P98A 5CE6A 1QXWA 4QR8A 2GA2A 2OKNA 2V3XA 1BOAA 2NQ6A 1C23A 4U69A 4A6VA 2IW2A 2BWUA 5CNXA 4IF7A 3TAVA 3PKBA 3L7GA 2GG3A 1N51A 4MATA 3PKEA 4U1BA 3IU9A 4ZWUA 4ZWPA 1BN5A 1C24A 1C27A 1JAWA 1QXZA 2EVCA 1QXYA 1A16A 5CDLA 1C21A 4JUQA 2B3LA 4S01A 3IG4A 1YW8A 2GU6A 3D27A 4U6ZA 3FM3A 4IKUA 3FMRA 3BIPA 2BWWA 4FLKA 2DFIA 1XGMA 4U70A 4IPAA 1WN1A 3PKCA 4KM3A 4IKTA 2BHCA 1WL6A 2HOWA 4U6WA 2GG9A 3MX6A 1M35A 2GGBA 2BHDA 5E5BA 4FKCA 4HXXA 1YW9A 2NQ7A 5D6FA 4RZYA 2GG2A 4IDYA 5JFRA 4EGEA 4U6CA 1MATA 2GZ5A 2GU5A 2BWTA 2BWYA 1WLRA 4FLJA 4U73A 2ADUA 1CHMA 1KP0A 2B3HA 2Q96A 1XGOA 3MATA 4R60A 4FO8A 4OOKA 5FCHA 2B3KA 4IKSA 4U71A 1KQ0A 2GG7A 5CDVA 1B59A 3BIQA 2GG8A 2Q92A 4FLIA 2Q93A 1KQ9A 5CIKA 5CDEA 3CB6A 3RORA 1WBQA 5JHUA 4PNCA 1PV9A 1XNZA 4RZZA 3TB5A 3L24A 3IU8A 3PKAA 2MATA 2EVOA 3MR1A 3RVAA 4IECA 2BWXA 1B6AA 4FO7A 1YJ3A 1R58A 2EA4A 2Q94A 2V6CA 4U6JA 1WKMA 2BHBA 4Z7MA 5FCFA 4B28A 2GGCA 4FLLA 3CTZA 3Q6DA 3BITA 4A6WA 2GU4A 1O0XA 5CLSA 2P99A 2BH3A 2ZSGA 1XGNA 1Y1NA 4FUKA 4U6EA 1W7VA 4S2TP 1QZYA 2GG0A 2EA2A 4RGZ1 2P9AA 2GU7A 4PV4A 1C22A 4IU6A 2V3YA 2V3ZA 2BN7A 5D6EA 1YW7A 3IU7A 2OAZA 1YVMA
chains in the Genus database with same CATH topology
3CB5A 2G6PA 3FMQA 2Q95A 1WL9A 5JI6A 4S2RP 1R5GA 4ZNGA 1XGSA 2GG5A 1R5HA 2Q8KA 1WY2A 2GTXA 4S00A 4ZWOA 2BWSA 4IKRA 2BWVA 2EVMA 2BB7A 4U76A 3S6BA 4U75A 1W2MA 3PKDA 2BHAA 2P98A 5CE6A 1QXWA 4QR8A 2GA2A 2OKNA 2V3XA 1BOAA 2NQ6A 1C23A 4U69A 4A6VA 2IW2A 2BWUA 5CNXA 4IF7A 3TAVA 3PKBA 3L7GA 2GG3A 1N51A 4MATA 3PKEA 4U1BA 3IU9A 4ZWUA 4ZWPA 1BN5A 1C24A 1C27A 1JAWA 1QXZA 2EVCA 1QXYA 1A16A 5CDLA 1C21A 4JUQA 2B3LA 4S01A 3IG4A 1YW8A 2GU6A 3D27A 4U6ZA 3FM3A 4IKUA 3FMRA 3BIPA 2BWWA 4FLKA 2DFIA 1XGMA 4U70A 4IPAA 1WN1A 3PKCA 4KM3A 4IKTA 2BHCA 1WL6A 2HOWA 4U6WA 2GG9A 3MX6A 1M35A 2GGBA 2BHDA 5E5BA 4FKCA 4HXXA 1YW9A 2NQ7A 5D6FA 4RZYA 2GG2A 4IDYA 5JFRA 4EGEA 4U6CA 1MATA 2GZ5A 2GU5A 2BWTA 2BWYA 1WLRA 4FLJA 4U73A 2ADUA 1CHMA 1KP0A 2B3HA 2Q96A 1XGOA 3MATA 4R60A 4FO8A 4OOKA 5FCHA 2B3KA 4IKSA 4U71A 1KQ0A 2GG7A 5CDVA 1B59A 3BIQA 2GG8A 2Q92A 4FLIA 2Q93A 1KQ9A 5CIKA 5CDEA 3CB6A 3RORA 1WBQA 5JHUA 4PNCA 1PV9A 1XNZA 4RZZA 3TB5A 3L24A 3IU8A 3PKAA 2MATA 2EVOA 3MR1A 3RVAA 4IECA 2BWXA 1B6AA 4FO7A 1YJ3A 1R58A 2EA4A 2Q94A 2V6CA 4U6JA 1WKMA 2BHBA 4Z7MA 5FCFA 4B28A 2GGCA 4FLLA 3CTZA 3Q6DA 3BITA 4A6WA 2GU4A 1O0XA 5CLSA 2P99A 2BH3A 2ZSGA 1XGNA 1Y1NA 4FUKA 4U6EA 1W7VA 4S2TP 1QZYA 2GG0A 2EA2A 4RGZ1 2P9AA 2GU7A 4PV4A 1C22A 4IU6A 2V3YA 2V3ZA 2BN7A 5D6EA 1YW7A 3IU7A 2OAZA 1YVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CB5 A;  2G6P A;  3FMQ A;  2Q95 A;  1WL9 A;  5JI6 A;  4S2R P;  1R5G A;  4ZNG A;  1XGS A;  2GG5 A;  1R5H A;  2Q8K A;  1WY2 A;  2GTX A;  4S00 A;  4ZWO A;  2BWS A;  4IKR A;  2BWV A;  2EVM A;  2BB7 A;  4U76 A;  3S6B A;  4U75 A;  1W2M A;  3PKD A;  2BHA A;  2P98 A;  5CE6 A;  1QXW A;  4QR8 A;  2GA2 A;  2OKN A;  2V3X A;  1BOA A;  2NQ6 A;  1C23 A;  4U69 A;  4A6V A;  2IW2 A;  2BWU A;  5CNX A;  4IF7 A;  3TAV A;  3PKB A;  3L7G A;  2GG3 A;  1N51 A;  4MAT A;  3PKE A;  4U1B A;  3IU9 A;  4ZWU A;  4ZWP A;  1BN5 A;  1C24 A;  1C27 A;  1JAW A;  1QXZ A;  2EVC A;  1QXY A;  1A16 A;  5CDL A;  1C21 A;  4JUQ A;  2B3L A;  4S01 A;  3IG4 A;  1YW8 A;  2GU6 A;  3D27 A;  4U6Z A;  3FM3 A;  4IKU A;  3FMR A;  3BIP A;  2BWW A;  4FLK A;  2DFI A;  1XGM A;  4U70 A;  4IPA A;  1WN1 A;  3PKC A;  4KM3 A;  4IKT A;  2BHC A;  1WL6 A;  2HOW A;  4U6W A;  2GG9 A;  3MX6 A;  1M35 A;  2GGB A;  2BHD A;  5E5B A;  4FKC A;  4HXX A;  1YW9 A;  2NQ7 A;  5D6F A;  4RZY A;  2GG2 A;  4IDY A;  5JFR A;  4EGE A;  4U6C A;  1MAT A;  2GZ5 A;  2GU5 A;  2BWT A;  2BWY A;  1WLR A;  4FLJ A;  4U73 A;  2ADU A;  1CHM A;  1KP0 A;  2B3H A;  2Q96 A;  1XGO A;  3MAT A;  4R60 A;  4FO8 A;  4OOK A;  5FCH A;  2B3K A;  4IKS A;  4U71 A;  1KQ0 A;  2GG7 A;  5CDV A;  1B59 A;  3BIQ A;  2GG8 A;  2Q92 A;  4FLI A;  2Q93 A;  1KQ9 A;  5CIK A;  5CDE A;  3CB6 A;  3ROR A;  1WBQ A;  5JHU A;  4PNC A;  1PV9 A;  1XNZ A;  4RZZ A;  3TB5 A;  3L24 A;  3IU8 A;  3PKA A;  2MAT A;  2EVO A;  3MR1 A;  3RVA A;  4IEC A;  2BWX A;  1B6A A;  4FO7 A;  1YJ3 A;  1R58 A;  2EA4 A;  2Q94 A;  2V6C A;  4U6J A;  1WKM A;  2BHB A;  4Z7M A;  5FCF A;  4B28 A;  2GGC A;  4FLL A;  3CTZ A;  3Q6D A;  3BIT A;  4A6W A;  2GU4 A;  1O0X A;  5CLS A;  2P99 A;  2BH3 A;  2ZSG A;  1XGN A;  1Y1N A;  4FUK A;  4U6E A;  1W7V A;  4S2T P;  1QZY A;  2GG0 A;  2EA2 A;  4RGZ 1;  2P9A A;  2GU7 A;  4PV4 A;  1C22 A;  4IU6 A;  2V3Y A;  2V3Z A;  2BN7 A;  5D6E A;  1YW7 A;  3IU7 A;  2OAZ A;  1YVM A; 
#chains in the Genus database with same CATH topology
 3CB5 A;  2G6P A;  3FMQ A;  2Q95 A;  1WL9 A;  5JI6 A;  4S2R P;  1R5G A;  4ZNG A;  1XGS A;  2GG5 A;  1R5H A;  2Q8K A;  1WY2 A;  2GTX A;  4S00 A;  4ZWO A;  2BWS A;  4IKR A;  2BWV A;  2EVM A;  2BB7 A;  4U76 A;  3S6B A;  4U75 A;  1W2M A;  3PKD A;  2BHA A;  2P98 A;  5CE6 A;  1QXW A;  4QR8 A;  2GA2 A;  2OKN A;  2V3X A;  1BOA A;  2NQ6 A;  1C23 A;  4U69 A;  4A6V A;  2IW2 A;  2BWU A;  5CNX A;  4IF7 A;  3TAV A;  3PKB A;  3L7G A;  2GG3 A;  1N51 A;  4MAT A;  3PKE A;  4U1B A;  3IU9 A;  4ZWU A;  4ZWP A;  1BN5 A;  1C24 A;  1C27 A;  1JAW A;  1QXZ A;  2EVC A;  1QXY A;  1A16 A;  5CDL A;  1C21 A;  4JUQ A;  2B3L A;  4S01 A;  3IG4 A;  1YW8 A;  2GU6 A;  3D27 A;  4U6Z A;  3FM3 A;  4IKU A;  3FMR A;  3BIP A;  2BWW A;  4FLK A;  2DFI A;  1XGM A;  4U70 A;  4IPA A;  1WN1 A;  3PKC A;  4KM3 A;  4IKT A;  2BHC A;  1WL6 A;  2HOW A;  4U6W A;  2GG9 A;  3MX6 A;  1M35 A;  2GGB A;  2BHD A;  5E5B A;  4FKC A;  4HXX A;  1YW9 A;  2NQ7 A;  5D6F A;  4RZY A;  2GG2 A;  4IDY A;  5JFR A;  4EGE A;  4U6C A;  1MAT A;  2GZ5 A;  2GU5 A;  2BWT A;  2BWY A;  1WLR A;  4FLJ A;  4U73 A;  2ADU A;  1CHM A;  1KP0 A;  2B3H A;  2Q96 A;  1XGO A;  3MAT A;  4R60 A;  4FO8 A;  4OOK A;  5FCH A;  2B3K A;  4IKS A;  4U71 A;  1KQ0 A;  2GG7 A;  5CDV A;  1B59 A;  3BIQ A;  2GG8 A;  2Q92 A;  4FLI A;  2Q93 A;  1KQ9 A;  5CIK A;  5CDE A;  3CB6 A;  3ROR A;  1WBQ A;  5JHU A;  4PNC A;  1PV9 A;  1XNZ A;  4RZZ A;  3TB5 A;  3L24 A;  3IU8 A;  3PKA A;  2MAT A;  2EVO A;  3MR1 A;  3RVA A;  4IEC A;  2BWX A;  1B6A A;  4FO7 A;  1YJ3 A;  1R58 A;  2EA4 A;  2Q94 A;  2V6C A;  4U6J A;  1WKM A;  2BHB A;  4Z7M A;  5FCF A;  4B28 A;  2GGC A;  4FLL A;  3CTZ A;  3Q6D A;  3BIT A;  4A6W A;  2GU4 A;  1O0X A;  5CLS A;  2P99 A;  2BH3 A;  2ZSG A;  1XGN A;  1Y1N A;  4FUK A;  4U6E A;  1W7V A;  4S2T P;  1QZY A;  2GG0 A;  2EA2 A;  4RGZ 1;  2P9A A;  2GU7 A;  4PV4 A;  1C22 A;  4IU6 A;  2V3Y A;  2V3Z A;  2BN7 A;  5D6E A;  1YW7 A;  3IU7 A;  2OAZ A;  1YVM A; 
#chains in the Genus database with same CATH homology
 3CB5 A;  2G6P A;  3FMQ A;  2Q95 A;  1WL9 A;  5JI6 A;  4S2R P;  1R5G A;  4ZNG A;  1XGS A;  2GG5 A;  1R5H A;  2Q8K A;  1WY2 A;  2GTX A;  4S00 A;  4ZWO A;  2BWS A;  4IKR A;  2BWV A;  2EVM A;  2BB7 A;  4U76 A;  3S6B A;  4U75 A;  1W2M A;  3PKD A;  2BHA A;  2P98 A;  5CE6 A;  1QXW A;  4QR8 A;  2GA2 A;  2OKN A;  2V3X A;  1BOA A;  2NQ6 A;  1C23 A;  4U69 A;  4A6V A;  2IW2 A;  2BWU A;  5CNX A;  4IF7 A;  3TAV A;  3PKB A;  3L7G A;  2GG3 A;  1N51 A;  4MAT A;  3PKE A;  4U1B A;  3IU9 A;  4ZWU A;  4ZWP A;  1BN5 A;  1C24 A;  1C27 A;  1JAW A;  1QXZ A;  2EVC A;  1QXY A;  1A16 A;  5CDL A;  1C21 A;  4JUQ A;  2B3L A;  4S01 A;  3IG4 A;  1YW8 A;  2GU6 A;  3D27 A;  4U6Z A;  3FM3 A;  4IKU A;  3FMR A;  3BIP A;  2BWW A;  4FLK A;  2DFI A;  1XGM A;  4U70 A;  4IPA A;  1WN1 A;  3PKC A;  4KM3 A;  4IKT A;  2BHC A;  1WL6 A;  2HOW A;  4U6W A;  2GG9 A;  3MX6 A;  1M35 A;  2GGB A;  2BHD A;  5E5B A;  4FKC A;  4HXX A;  1YW9 A;  2NQ7 A;  5D6F A;  4RZY A;  2GG2 A;  4IDY A;  5JFR A;  4EGE A;  4U6C A;  1MAT A;  2GZ5 A;  2GU5 A;  2BWT A;  2BWY A;  1WLR A;  4FLJ A;  4U73 A;  2ADU A;  1CHM A;  1KP0 A;  2B3H A;  2Q96 A;  1XGO A;  3MAT A;  4R60 A;  4FO8 A;  4OOK A;  5FCH A;  2B3K A;  4IKS A;  4U71 A;  1KQ0 A;  2GG7 A;  5CDV A;  1B59 A;  3BIQ A;  2GG8 A;  2Q92 A;  4FLI A;  2Q93 A;  1KQ9 A;  5CIK A;  5CDE A;  3CB6 A;  3ROR A;  1WBQ A;  5JHU A;  4PNC A;  1PV9 A;  1XNZ A;  4RZZ A;  3TB5 A;  3L24 A;  3IU8 A;  3PKA A;  2MAT A;  2EVO A;  3MR1 A;  3RVA A;  4IEC A;  2BWX A;  1B6A A;  4FO7 A;  1YJ3 A;  1R58 A;  2EA4 A;  2Q94 A;  2V6C A;  4U6J A;  1WKM A;  2BHB A;  4Z7M A;  5FCF A;  4B28 A;  2GGC A;  4FLL A;  3CTZ A;  3Q6D A;  3BIT A;  4A6W A;  2GU4 A;  1O0X A;  5CLS A;  2P99 A;  2BH3 A;  2ZSG A;  1XGN A;  1Y1N A;  4FUK A;  4U6E A;  1W7V A;  4S2T P;  1QZY A;  2GG0 A;  2EA2 A;  4RGZ 1;  2P9A A;  2GU7 A;  4PV4 A;  1C22 A;  4IU6 A;  2V3Y A;  2V3Z A;  2BN7 A;  5D6E A;  1YW7 A;  3IU7 A;  2OAZ A;  1YVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...