1C23A

E. coli methionine aminopeptidase: methionine phosphonate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c23A00
3IG4A 4FO7A 3L7GA 3TB5A 4RGZ1 2BWWA 2GG3A 2GZ5A 2BWSA 2GU4A 1B59A 2GG7A 1XGMA 2Q94A 4JUQA 4QR8A 4U6CA 2GG2A 2GGBA 5CNXA 3FM3A 4EGEA 1XGSA 1XGNA 4B28A 3PKAA 3L24A 4FKCA 5D6EA 2ADUA 2B3HA 2B3LA 5JFRA 4PV4A 4ZWOA 4U69A 5D6FA 3IU8A 2Q95A 4S2RP 2BHCA 2Q92A 3PKCA 1CHMA 4IF7A 5CE6A 3TAVA 1WKMA 1WL9A 5CDVA 2GG5A 1XGOA 2BWVA 2EVMA 1JAWA 4U76A 4A6VA 4IECA 4FUKA 4IKTA 2GTXA 2EVOA 2IW2A 1YVMA 3MR1A 4FLIA 4IDYA 3RVAA 5CDLA 1C22A 5JI6A 4ZWPA 2GU5A 1KP0A 1MATA 4ZNGA 4U6JA 3PKEA 4U6EA 4U6WA 1YW8A 3BIPA 1C21A 1YJ3A 3CTZA 2GG9A 2ZSGA 2BWUA 3IU9A 2P98A 1W2MA 3Q6DA 5FCFA 2HOWA 1WL6A 4IKRA 2GG8A 1WBQA 2NQ7A 2Q96A 5E5BA 3RORA 1QZYA 2GU7A 4U1BA 4R60A 5JHUA 2BHAA 1R5GA 1BOAA 1KQ0A 4OOKA 4S00A 4IU6A 4RZZA 4HXXA 2OKNA 4RZYA 3IU7A 2V3YA 1M35A 1C23A 3FMQA 3S6BA 3PKDA 5FCHA 1B6AA 3MATA 1C27A 2P99A 1BN5A 4KM3A 1YW9A 2BH3A 2BWTA 3FMRA 4ZWUA 5CDEA 2GU6A 2B3KA 1QXYA 4U75A 5CIKA 2GGCA 4PNCA 1QXZA 4IPAA 3MX6A 2EA4A 2GG0A 2Q8KA 4FO8A 1WLRA 2V3XA 2G6PA 1KQ9A 2BHDA 4U73A 4MATA 3BIQA 4U6ZA 4S01A 3CB5A 5CLSA 4IKSA 3BITA 1PV9A 2BN7A 4S2TP 2OAZA 2BWXA 2BHBA 4U70A 4A6WA 1QXWA 2P9AA 4FLJA 1N51A 1A16A 2BB7A 3PKBA 4FLKA 2V3ZA 2MATA 2BWYA 4U71A 2DFIA 2EA2A 3D27A 1WY2A 1R58A 1WN1A 3CB6A 4FLLA 1YW7A 1R5HA 1C24A 2EVCA 2Q93A 4IKUA 4Z7MA 1W7VA 1O0XA 2GA2A 2NQ6A 1XNZA 1Y1NA 2V6CA
chains in the Genus database with same CATH superfamily
3IG4A 4FO7A 3L7GA 3TB5A 4RGZ1 2BWWA 2GG3A 2GZ5A 2BWSA 2GU4A 1B59A 2GG7A 1XGMA 2Q94A 4JUQA 4QR8A 4U6CA 2GG2A 2GGBA 5CNXA 3FM3A 4EGEA 1XGSA 1XGNA 4B28A 3PKAA 3L24A 4FKCA 5D6EA 2ADUA 2B3HA 2B3LA 5JFRA 4PV4A 4ZWOA 4U69A 5D6FA 3IU8A 2Q95A 4S2RP 2BHCA 2Q92A 3PKCA 1CHMA 4IF7A 5CE6A 3TAVA 1WKMA 1WL9A 5CDVA 2GG5A 1XGOA 2BWVA 2EVMA 1JAWA 4U76A 4A6VA 4IECA 4FUKA 4IKTA 2GTXA 2EVOA 2IW2A 1YVMA 3MR1A 4FLIA 4IDYA 3RVAA 5CDLA 1C22A 5JI6A 4ZWPA 2GU5A 1KP0A 1MATA 4ZNGA 4U6JA 3PKEA 4U6EA 4U6WA 1YW8A 3BIPA 1C21A 1YJ3A 3CTZA 2GG9A 2ZSGA 2BWUA 3IU9A 2P98A 1W2MA 3Q6DA 5FCFA 2HOWA 1WL6A 4IKRA 2GG8A 1WBQA 2NQ7A 2Q96A 5E5BA 3RORA 1QZYA 2GU7A 4U1BA 4R60A 5JHUA 2BHAA 1R5GA 1BOAA 1KQ0A 4OOKA 4S00A 4IU6A 4RZZA 4HXXA 2OKNA 4RZYA 3IU7A 2V3YA 1M35A 1C23A 3FMQA 3S6BA 3PKDA 5FCHA 1B6AA 3MATA 1C27A 2P99A 1BN5A 4KM3A 1YW9A 2BH3A 2BWTA 3FMRA 4ZWUA 5CDEA 2GU6A 2B3KA 1QXYA 4U75A 5CIKA 2GGCA 4PNCA 1QXZA 4IPAA 3MX6A 2EA4A 2GG0A 2Q8KA 4FO8A 1WLRA 2V3XA 2G6PA 1KQ9A 2BHDA 4U73A 4MATA 3BIQA 4U6ZA 4S01A 3CB5A 5CLSA 4IKSA 3BITA 1PV9A 2BN7A 4S2TP 2OAZA 2BWXA 2BHBA 4U70A 4A6WA 1QXWA 2P9AA 4FLJA 1N51A 1A16A 2BB7A 3PKBA 4FLKA 2V3ZA 2MATA 2BWYA 4U71A 2DFIA 2EA2A 3D27A 1WY2A 1R58A 1WN1A 3CB6A 4FLLA 1YW7A 1R5HA 1C24A 2EVCA 2Q93A 4IKUA 4Z7MA 1W7VA 1O0XA 2GA2A 2NQ6A 1XNZA 1Y1NA 2V6CA
chains in the Genus database with same CATH topology
3IG4A 4FO7A 3L7GA 3TB5A 4RGZ1 2BWWA 2GG3A 2GZ5A 2BWSA 2GU4A 1B59A 2GG7A 1XGMA 2Q94A 4JUQA 4QR8A 4U6CA 2GG2A 2GGBA 5CNXA 3FM3A 4EGEA 1XGSA 1XGNA 4B28A 3PKAA 3L24A 4FKCA 5D6EA 2ADUA 2B3HA 2B3LA 5JFRA 4PV4A 4ZWOA 4U69A 5D6FA 3IU8A 2Q95A 4S2RP 2BHCA 2Q92A 3PKCA 1CHMA 4IF7A 5CE6A 3TAVA 1WKMA 1WL9A 5CDVA 2GG5A 1XGOA 2BWVA 2EVMA 1JAWA 4U76A 4A6VA 4IECA 4FUKA 4IKTA 2GTXA 2EVOA 2IW2A 1YVMA 3MR1A 4FLIA 4IDYA 3RVAA 5CDLA 1C22A 5JI6A 4ZWPA 2GU5A 1KP0A 1MATA 4ZNGA 4U6JA 3PKEA 4U6EA 4U6WA 1YW8A 3BIPA 1C21A 1YJ3A 3CTZA 2GG9A 2ZSGA 2BWUA 3IU9A 2P98A 1W2MA 3Q6DA 5FCFA 2HOWA 1WL6A 4IKRA 2GG8A 1WBQA 2NQ7A 2Q96A 5E5BA 3RORA 1QZYA 2GU7A 4U1BA 4R60A 5JHUA 2BHAA 1R5GA 1BOAA 1KQ0A 4OOKA 4S00A 4IU6A 4RZZA 4HXXA 2OKNA 4RZYA 3IU7A 2V3YA 1M35A 1C23A 3FMQA 3S6BA 3PKDA 5FCHA 1B6AA 3MATA 1C27A 2P99A 1BN5A 4KM3A 1YW9A 2BH3A 2BWTA 3FMRA 4ZWUA 5CDEA 2GU6A 2B3KA 1QXYA 4U75A 5CIKA 2GGCA 4PNCA 1QXZA 4IPAA 3MX6A 2EA4A 2GG0A 2Q8KA 4FO8A 1WLRA 2V3XA 2G6PA 1KQ9A 2BHDA 4U73A 4MATA 3BIQA 4U6ZA 4S01A 3CB5A 5CLSA 4IKSA 3BITA 1PV9A 2BN7A 4S2TP 2OAZA 2BWXA 2BHBA 4U70A 4A6WA 1QXWA 2P9AA 4FLJA 1N51A 1A16A 2BB7A 3PKBA 4FLKA 2V3ZA 2MATA 2BWYA 4U71A 2DFIA 2EA2A 3D27A 1WY2A 1R58A 1WN1A 3CB6A 4FLLA 1YW7A 1R5HA 1C24A 2EVCA 2Q93A 4IKUA 4Z7MA 1W7VA 1O0XA 2GA2A 2NQ6A 1XNZA 1Y1NA 2V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG4 A;  4FO7 A;  3L7G A;  3TB5 A;  4RGZ 1;  2BWW A;  2GG3 A;  2GZ5 A;  2BWS A;  2GU4 A;  1B59 A;  2GG7 A;  1XGM A;  2Q94 A;  4JUQ A;  4QR8 A;  4U6C A;  2GG2 A;  2GGB A;  5CNX A;  3FM3 A;  4EGE A;  1XGS A;  1XGN A;  4B28 A;  3PKA A;  3L24 A;  4FKC A;  5D6E A;  2ADU A;  2B3H A;  2B3L A;  5JFR A;  4PV4 A;  4ZWO A;  4U69 A;  5D6F A;  3IU8 A;  2Q95 A;  4S2R P;  2BHC A;  2Q92 A;  3PKC A;  1CHM A;  4IF7 A;  5CE6 A;  3TAV A;  1WKM A;  1WL9 A;  5CDV A;  2GG5 A;  1XGO A;  2BWV A;  2EVM A;  1JAW A;  4U76 A;  4A6V A;  4IEC A;  4FUK A;  4IKT A;  2GTX A;  2EVO A;  2IW2 A;  1YVM A;  3MR1 A;  4FLI A;  4IDY A;  3RVA A;  5CDL A;  1C22 A;  5JI6 A;  4ZWP A;  2GU5 A;  1KP0 A;  1MAT A;  4ZNG A;  4U6J A;  3PKE A;  4U6E A;  4U6W A;  1YW8 A;  3BIP A;  1C21 A;  1YJ3 A;  3CTZ A;  2GG9 A;  2ZSG A;  2BWU A;  3IU9 A;  2P98 A;  1W2M A;  3Q6D A;  5FCF A;  2HOW A;  1WL6 A;  4IKR A;  2GG8 A;  1WBQ A;  2NQ7 A;  2Q96 A;  5E5B A;  3ROR A;  1QZY A;  2GU7 A;  4U1B A;  4R60 A;  5JHU A;  2BHA A;  1R5G A;  1BOA A;  1KQ0 A;  4OOK A;  4S00 A;  4IU6 A;  4RZZ A;  4HXX A;  2OKN A;  4RZY A;  3IU7 A;  2V3Y A;  1M35 A;  1C23 A;  3FMQ A;  3S6B A;  3PKD A;  5FCH A;  1B6A A;  3MAT A;  1C27 A;  2P99 A;  1BN5 A;  4KM3 A;  1YW9 A;  2BH3 A;  2BWT A;  3FMR A;  4ZWU A;  5CDE A;  2GU6 A;  2B3K A;  1QXY A;  4U75 A;  5CIK A;  2GGC A;  4PNC A;  1QXZ A;  4IPA A;  3MX6 A;  2EA4 A;  2GG0 A;  2Q8K A;  4FO8 A;  1WLR A;  2V3X A;  2G6P A;  1KQ9 A;  2BHD A;  4U73 A;  4MAT A;  3BIQ A;  4U6Z A;  4S01 A;  3CB5 A;  5CLS A;  4IKS A;  3BIT A;  1PV9 A;  2BN7 A;  4S2T P;  2OAZ A;  2BWX A;  2BHB A;  4U70 A;  4A6W A;  1QXW A;  2P9A A;  4FLJ A;  1N51 A;  1A16 A;  2BB7 A;  3PKB A;  4FLK A;  2V3Z A;  2MAT A;  2BWY A;  4U71 A;  2DFI A;  2EA2 A;  3D27 A;  1WY2 A;  1R58 A;  1WN1 A;  3CB6 A;  4FLL A;  1YW7 A;  1R5H A;  1C24 A;  2EVC A;  2Q93 A;  4IKU A;  4Z7M A;  1W7V A;  1O0X A;  2GA2 A;  2NQ6 A;  1XNZ A;  1Y1N A;  2V6C A; 
#chains in the Genus database with same CATH topology
 3IG4 A;  4FO7 A;  3L7G A;  3TB5 A;  4RGZ 1;  2BWW A;  2GG3 A;  2GZ5 A;  2BWS A;  2GU4 A;  1B59 A;  2GG7 A;  1XGM A;  2Q94 A;  4JUQ A;  4QR8 A;  4U6C A;  2GG2 A;  2GGB A;  5CNX A;  3FM3 A;  4EGE A;  1XGS A;  1XGN A;  4B28 A;  3PKA A;  3L24 A;  4FKC A;  5D6E A;  2ADU A;  2B3H A;  2B3L A;  5JFR A;  4PV4 A;  4ZWO A;  4U69 A;  5D6F A;  3IU8 A;  2Q95 A;  4S2R P;  2BHC A;  2Q92 A;  3PKC A;  1CHM A;  4IF7 A;  5CE6 A;  3TAV A;  1WKM A;  1WL9 A;  5CDV A;  2GG5 A;  1XGO A;  2BWV A;  2EVM A;  1JAW A;  4U76 A;  4A6V A;  4IEC A;  4FUK A;  4IKT A;  2GTX A;  2EVO A;  2IW2 A;  1YVM A;  3MR1 A;  4FLI A;  4IDY A;  3RVA A;  5CDL A;  1C22 A;  5JI6 A;  4ZWP A;  2GU5 A;  1KP0 A;  1MAT A;  4ZNG A;  4U6J A;  3PKE A;  4U6E A;  4U6W A;  1YW8 A;  3BIP A;  1C21 A;  1YJ3 A;  3CTZ A;  2GG9 A;  2ZSG A;  2BWU A;  3IU9 A;  2P98 A;  1W2M A;  3Q6D A;  5FCF A;  2HOW A;  1WL6 A;  4IKR A;  2GG8 A;  1WBQ A;  2NQ7 A;  2Q96 A;  5E5B A;  3ROR A;  1QZY A;  2GU7 A;  4U1B A;  4R60 A;  5JHU A;  2BHA A;  1R5G A;  1BOA A;  1KQ0 A;  4OOK A;  4S00 A;  4IU6 A;  4RZZ A;  4HXX A;  2OKN A;  4RZY A;  3IU7 A;  2V3Y A;  1M35 A;  1C23 A;  3FMQ A;  3S6B A;  3PKD A;  5FCH A;  1B6A A;  3MAT A;  1C27 A;  2P99 A;  1BN5 A;  4KM3 A;  1YW9 A;  2BH3 A;  2BWT A;  3FMR A;  4ZWU A;  5CDE A;  2GU6 A;  2B3K A;  1QXY A;  4U75 A;  5CIK A;  2GGC A;  4PNC A;  1QXZ A;  4IPA A;  3MX6 A;  2EA4 A;  2GG0 A;  2Q8K A;  4FO8 A;  1WLR A;  2V3X A;  2G6P A;  1KQ9 A;  2BHD A;  4U73 A;  4MAT A;  3BIQ A;  4U6Z A;  4S01 A;  3CB5 A;  5CLS A;  4IKS A;  3BIT A;  1PV9 A;  2BN7 A;  4S2T P;  2OAZ A;  2BWX A;  2BHB A;  4U70 A;  4A6W A;  1QXW A;  2P9A A;  4FLJ A;  1N51 A;  1A16 A;  2BB7 A;  3PKB A;  4FLK A;  2V3Z A;  2MAT A;  2BWY A;  4U71 A;  2DFI A;  2EA2 A;  3D27 A;  1WY2 A;  1R58 A;  1WN1 A;  3CB6 A;  4FLL A;  1YW7 A;  1R5H A;  1C24 A;  2EVC A;  2Q93 A;  4IKU A;  4Z7M A;  1W7V A;  1O0X A;  2GA2 A;  2NQ6 A;  1XNZ A;  1Y1N A;  2V6C A; 
#chains in the Genus database with same CATH homology
 3IG4 A;  4FO7 A;  3L7G A;  3TB5 A;  4RGZ 1;  2BWW A;  2GG3 A;  2GZ5 A;  2BWS A;  2GU4 A;  1B59 A;  2GG7 A;  1XGM A;  2Q94 A;  4JUQ A;  4QR8 A;  4U6C A;  2GG2 A;  2GGB A;  5CNX A;  3FM3 A;  4EGE A;  1XGS A;  1XGN A;  4B28 A;  3PKA A;  3L24 A;  4FKC A;  5D6E A;  2ADU A;  2B3H A;  2B3L A;  5JFR A;  4PV4 A;  4ZWO A;  4U69 A;  5D6F A;  3IU8 A;  2Q95 A;  4S2R P;  2BHC A;  2Q92 A;  3PKC A;  1CHM A;  4IF7 A;  5CE6 A;  3TAV A;  1WKM A;  1WL9 A;  5CDV A;  2GG5 A;  1XGO A;  2BWV A;  2EVM A;  1JAW A;  4U76 A;  4A6V A;  4IEC A;  4FUK A;  4IKT A;  2GTX A;  2EVO A;  2IW2 A;  1YVM A;  3MR1 A;  4FLI A;  4IDY A;  3RVA A;  5CDL A;  1C22 A;  5JI6 A;  4ZWP A;  2GU5 A;  1KP0 A;  1MAT A;  4ZNG A;  4U6J A;  3PKE A;  4U6E A;  4U6W A;  1YW8 A;  3BIP A;  1C21 A;  1YJ3 A;  3CTZ A;  2GG9 A;  2ZSG A;  2BWU A;  3IU9 A;  2P98 A;  1W2M A;  3Q6D A;  5FCF A;  2HOW A;  1WL6 A;  4IKR A;  2GG8 A;  1WBQ A;  2NQ7 A;  2Q96 A;  5E5B A;  3ROR A;  1QZY A;  2GU7 A;  4U1B A;  4R60 A;  5JHU A;  2BHA A;  1R5G A;  1BOA A;  1KQ0 A;  4OOK A;  4S00 A;  4IU6 A;  4RZZ A;  4HXX A;  2OKN A;  4RZY A;  3IU7 A;  2V3Y A;  1M35 A;  1C23 A;  3FMQ A;  3S6B A;  3PKD A;  5FCH A;  1B6A A;  3MAT A;  1C27 A;  2P99 A;  1BN5 A;  4KM3 A;  1YW9 A;  2BH3 A;  2BWT A;  3FMR A;  4ZWU A;  5CDE A;  2GU6 A;  2B3K A;  1QXY A;  4U75 A;  5CIK A;  2GGC A;  4PNC A;  1QXZ A;  4IPA A;  3MX6 A;  2EA4 A;  2GG0 A;  2Q8K A;  4FO8 A;  1WLR A;  2V3X A;  2G6P A;  1KQ9 A;  2BHD A;  4U73 A;  4MAT A;  3BIQ A;  4U6Z A;  4S01 A;  3CB5 A;  5CLS A;  4IKS A;  3BIT A;  1PV9 A;  2BN7 A;  4S2T P;  2OAZ A;  2BWX A;  2BHB A;  4U70 A;  4A6W A;  1QXW A;  2P9A A;  4FLJ A;  1N51 A;  1A16 A;  2BB7 A;  3PKB A;  4FLK A;  2V3Z A;  2MAT A;  2BWY A;  4U71 A;  2DFI A;  2EA2 A;  3D27 A;  1WY2 A;  1R58 A;  1WN1 A;  3CB6 A;  4FLL A;  1YW7 A;  1R5H A;  1C24 A;  2EVC A;  2Q93 A;  4IKU A;  4Z7M A;  1W7V A;  1O0X A;  2GA2 A;  2NQ6 A;  1XNZ A;  1Y1N A;  2V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...