1C23A

E. coli methionine aminopeptidase: methionine phosphonate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c23A00
2GU5A 4RZYA 4S00A 2GG5A 1C21A 1QXWA 1R58A 2Q94A 5CDVA 5E5BA 4U6EA 5CE6A 3RVAA 1WL6A 4FLJA 1YJ3A 2EVOA 1YW8A 1YVMA 2EVCA 2BWXA 1KQ0A 1XGNA 4U70A 4U73A 4U6WA 4IKTA 3L24A 3PKDA 4R60A 4B28A 1M35A 4ZWOA 2GZ5A 2B3HA 2IW2A 2OAZA 2Q92A 2BWYA 5FCFA 2GG7A 2GTXA 2BHAA 1BOAA 3PKBA 2HOWA 1KP0A 3FMRA 2V6CA 4IKRA 2BWSA 3IU9A 4JUQA 2Q95A 4A6WA 4OOKA 4PV4A 4S2RP 2V3YA 2EA2A 3BIPA 3IU7A 4IPAA 4U6JA 1O0XA 3CB5A 1R5GA 3FMQA 1PV9A 1C27A 5CDEA 4IECA 1YW9A 2BWWA 1XNZA 3CTZA 1C22A 2G6PA 1WY2A 3L7GA 1WL9A 3MATA 4FO8A 2DFIA 5D6EA 3BIQA 4IF7A 5CNXA 4IKUA 4FLLA 2BHCA 3TAVA 1B6AA 4U6CA 1WKMA 2NQ7A 2GU6A 1N51A 3Q6DA 1XGMA 4KM3A 2MATA 2Q93A 2P99A 4ZWUA 3S6BA 3IU8A 3MX6A 3CB6A 5JFRA 4QR8A 4IDYA 2Q8KA 1C23A 1WN1A 4A6VA 2BWVA 2ADUA 4RGZ1 1QXYA 2BB7A 3D27A 2BHDA 3FM3A 4FLKA 1C24A 1Y1NA 3MR1A 4ZNGA 3PKCA 1QXZA 1KQ9A 4FLIA 4U6ZA 1XGSA 2BN7A 4U71A 1YW7A 2BH3A 2GG3A 4IU6A 4RZZA 3RORA 2GG0A 2EVMA 4MATA 2ZSGA 3IG4A 4S01A 1QZYA 2B3LA 2BWUA 5JI6A 2GG8A 4HXXA 5D6FA 4S2TP 4IKSA 4ZWPA 5CIKA 2BHBA 2B3KA 1W7VA 1WLRA 1JAWA 4EGEA 2GGCA 3PKEA 1CHMA 1XGOA 5FCHA 5JHUA 1WBQA 2V3ZA 2OKNA 3BITA 4U75A 5CDLA 2V3XA 2Q96A 4FKCA 1R5HA 2GG9A 2BWTA 2GA2A 4PNCA 3TB5A 1B59A 2P9AA 2GU4A 2GGBA 3PKAA 2P98A 4Z7MA 2NQ6A 2GU7A 2GG2A 1BN5A 2EA4A 4FO7A 4U76A 1MATA 4U69A 4FUKA 1W2MA 4U1BA 1A16A 5CLSA
chains in the Genus database with same CATH superfamily
2GU5A 4RZYA 4S00A 2GG5A 1C21A 1QXWA 1R58A 2Q94A 5CDVA 5E5BA 4U6EA 5CE6A 3RVAA 1WL6A 4FLJA 1YJ3A 2EVOA 1YW8A 1YVMA 2EVCA 2BWXA 1KQ0A 1XGNA 4U70A 4U73A 4U6WA 4IKTA 3L24A 3PKDA 4R60A 4B28A 1M35A 4ZWOA 2GZ5A 2B3HA 2IW2A 2OAZA 2Q92A 2BWYA 5FCFA 2GG7A 2GTXA 2BHAA 1BOAA 3PKBA 2HOWA 1KP0A 3FMRA 2V6CA 4IKRA 2BWSA 3IU9A 4JUQA 2Q95A 4A6WA 4OOKA 4PV4A 4S2RP 2V3YA 2EA2A 3BIPA 3IU7A 4IPAA 4U6JA 1O0XA 3CB5A 1R5GA 3FMQA 1PV9A 1C27A 5CDEA 4IECA 1YW9A 2BWWA 1XNZA 3CTZA 1C22A 2G6PA 1WY2A 3L7GA 1WL9A 3MATA 4FO8A 2DFIA 5D6EA 3BIQA 4IF7A 5CNXA 4IKUA 4FLLA 2BHCA 3TAVA 1B6AA 4U6CA 1WKMA 2NQ7A 2GU6A 1N51A 3Q6DA 1XGMA 4KM3A 2MATA 2Q93A 2P99A 4ZWUA 3S6BA 3IU8A 3MX6A 3CB6A 5JFRA 4QR8A 4IDYA 2Q8KA 1C23A 1WN1A 4A6VA 2BWVA 2ADUA 4RGZ1 1QXYA 2BB7A 3D27A 2BHDA 3FM3A 4FLKA 1C24A 1Y1NA 3MR1A 4ZNGA 3PKCA 1QXZA 1KQ9A 4FLIA 4U6ZA 1XGSA 2BN7A 4U71A 1YW7A 2BH3A 2GG3A 4IU6A 4RZZA 3RORA 2GG0A 2EVMA 4MATA 2ZSGA 3IG4A 4S01A 1QZYA 2B3LA 2BWUA 5JI6A 2GG8A 4HXXA 5D6FA 4S2TP 4IKSA 4ZWPA 5CIKA 2BHBA 2B3KA 1W7VA 1WLRA 1JAWA 4EGEA 2GGCA 3PKEA 1CHMA 1XGOA 5FCHA 5JHUA 1WBQA 2V3ZA 2OKNA 3BITA 4U75A 5CDLA 2V3XA 2Q96A 4FKCA 1R5HA 2GG9A 2BWTA 2GA2A 4PNCA 3TB5A 1B59A 2P9AA 2GU4A 2GGBA 3PKAA 2P98A 4Z7MA 2NQ6A 2GU7A 2GG2A 1BN5A 2EA4A 4FO7A 4U76A 1MATA 4U69A 4FUKA 1W2MA 4U1BA 1A16A 5CLSA
chains in the Genus database with same CATH topology
2GU5A 4RZYA 4S00A 2GG5A 1C21A 1QXWA 1R58A 2Q94A 5CDVA 5E5BA 4U6EA 5CE6A 3RVAA 1WL6A 4FLJA 1YJ3A 2EVOA 1YW8A 1YVMA 2EVCA 2BWXA 1KQ0A 1XGNA 4U70A 4U73A 4U6WA 4IKTA 3L24A 3PKDA 4R60A 4B28A 1M35A 4ZWOA 2GZ5A 2B3HA 2IW2A 2OAZA 2Q92A 2BWYA 5FCFA 2GG7A 2GTXA 2BHAA 1BOAA 3PKBA 2HOWA 1KP0A 3FMRA 2V6CA 4IKRA 2BWSA 3IU9A 4JUQA 2Q95A 4A6WA 4OOKA 4PV4A 4S2RP 2V3YA 2EA2A 3BIPA 3IU7A 4IPAA 4U6JA 1O0XA 3CB5A 1R5GA 3FMQA 1PV9A 1C27A 5CDEA 4IECA 1YW9A 2BWWA 1XNZA 3CTZA 1C22A 2G6PA 1WY2A 3L7GA 1WL9A 3MATA 4FO8A 2DFIA 5D6EA 3BIQA 4IF7A 5CNXA 4IKUA 4FLLA 2BHCA 3TAVA 1B6AA 4U6CA 1WKMA 2NQ7A 2GU6A 1N51A 3Q6DA 1XGMA 4KM3A 2MATA 2Q93A 2P99A 4ZWUA 3S6BA 3IU8A 3MX6A 3CB6A 5JFRA 4QR8A 4IDYA 2Q8KA 1C23A 1WN1A 4A6VA 2BWVA 2ADUA 4RGZ1 1QXYA 2BB7A 3D27A 2BHDA 3FM3A 4FLKA 1C24A 1Y1NA 3MR1A 4ZNGA 3PKCA 1QXZA 1KQ9A 4FLIA 4U6ZA 1XGSA 2BN7A 4U71A 1YW7A 2BH3A 2GG3A 4IU6A 4RZZA 3RORA 2GG0A 2EVMA 4MATA 2ZSGA 3IG4A 4S01A 1QZYA 2B3LA 2BWUA 5JI6A 2GG8A 4HXXA 5D6FA 4S2TP 4IKSA 4ZWPA 5CIKA 2BHBA 2B3KA 1W7VA 1WLRA 1JAWA 4EGEA 2GGCA 3PKEA 1CHMA 1XGOA 5FCHA 5JHUA 1WBQA 2V3ZA 2OKNA 3BITA 4U75A 5CDLA 2V3XA 2Q96A 4FKCA 1R5HA 2GG9A 2BWTA 2GA2A 4PNCA 3TB5A 1B59A 2P9AA 2GU4A 2GGBA 3PKAA 2P98A 4Z7MA 2NQ6A 2GU7A 2GG2A 1BN5A 2EA4A 4FO7A 4U76A 1MATA 4U69A 4FUKA 1W2MA 4U1BA 1A16A 5CLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU5 A;  4RZY A;  4S00 A;  2GG5 A;  1C21 A;  1QXW A;  1R58 A;  2Q94 A;  5CDV A;  5E5B A;  4U6E A;  5CE6 A;  3RVA A;  1WL6 A;  4FLJ A;  1YJ3 A;  2EVO A;  1YW8 A;  1YVM A;  2EVC A;  2BWX A;  1KQ0 A;  1XGN A;  4U70 A;  4U73 A;  4U6W A;  4IKT A;  3L24 A;  3PKD A;  4R60 A;  4B28 A;  1M35 A;  4ZWO A;  2GZ5 A;  2B3H A;  2IW2 A;  2OAZ A;  2Q92 A;  2BWY A;  5FCF A;  2GG7 A;  2GTX A;  2BHA A;  1BOA A;  3PKB A;  2HOW A;  1KP0 A;  3FMR A;  2V6C A;  4IKR A;  2BWS A;  3IU9 A;  4JUQ A;  2Q95 A;  4A6W A;  4OOK A;  4PV4 A;  4S2R P;  2V3Y A;  2EA2 A;  3BIP A;  3IU7 A;  4IPA A;  4U6J A;  1O0X A;  3CB5 A;  1R5G A;  3FMQ A;  1PV9 A;  1C27 A;  5CDE A;  4IEC A;  1YW9 A;  2BWW A;  1XNZ A;  3CTZ A;  1C22 A;  2G6P A;  1WY2 A;  3L7G A;  1WL9 A;  3MAT A;  4FO8 A;  2DFI A;  5D6E A;  3BIQ A;  4IF7 A;  5CNX A;  4IKU A;  4FLL A;  2BHC A;  3TAV A;  1B6A A;  4U6C A;  1WKM A;  2NQ7 A;  2GU6 A;  1N51 A;  3Q6D A;  1XGM A;  4KM3 A;  2MAT A;  2Q93 A;  2P99 A;  4ZWU A;  3S6B A;  3IU8 A;  3MX6 A;  3CB6 A;  5JFR A;  4QR8 A;  4IDY A;  2Q8K A;  1C23 A;  1WN1 A;  4A6V A;  2BWV A;  2ADU A;  4RGZ 1;  1QXY A;  2BB7 A;  3D27 A;  2BHD A;  3FM3 A;  4FLK A;  1C24 A;  1Y1N A;  3MR1 A;  4ZNG A;  3PKC A;  1QXZ A;  1KQ9 A;  4FLI A;  4U6Z A;  1XGS A;  2BN7 A;  4U71 A;  1YW7 A;  2BH3 A;  2GG3 A;  4IU6 A;  4RZZ A;  3ROR A;  2GG0 A;  2EVM A;  4MAT A;  2ZSG A;  3IG4 A;  4S01 A;  1QZY A;  2B3L A;  2BWU A;  5JI6 A;  2GG8 A;  4HXX A;  5D6F A;  4S2T P;  4IKS A;  4ZWP A;  5CIK A;  2BHB A;  2B3K A;  1W7V A;  1WLR A;  1JAW A;  4EGE A;  2GGC A;  3PKE A;  1CHM A;  1XGO A;  5FCH A;  5JHU A;  1WBQ A;  2V3Z A;  2OKN A;  3BIT A;  4U75 A;  5CDL A;  2V3X A;  2Q96 A;  4FKC A;  1R5H A;  2GG9 A;  2BWT A;  2GA2 A;  4PNC A;  3TB5 A;  1B59 A;  2P9A A;  2GU4 A;  2GGB A;  3PKA A;  2P98 A;  4Z7M A;  2NQ6 A;  2GU7 A;  2GG2 A;  1BN5 A;  2EA4 A;  4FO7 A;  4U76 A;  1MAT A;  4U69 A;  4FUK A;  1W2M A;  4U1B A;  1A16 A;  5CLS A; 
#chains in the Genus database with same CATH topology
 2GU5 A;  4RZY A;  4S00 A;  2GG5 A;  1C21 A;  1QXW A;  1R58 A;  2Q94 A;  5CDV A;  5E5B A;  4U6E A;  5CE6 A;  3RVA A;  1WL6 A;  4FLJ A;  1YJ3 A;  2EVO A;  1YW8 A;  1YVM A;  2EVC A;  2BWX A;  1KQ0 A;  1XGN A;  4U70 A;  4U73 A;  4U6W A;  4IKT A;  3L24 A;  3PKD A;  4R60 A;  4B28 A;  1M35 A;  4ZWO A;  2GZ5 A;  2B3H A;  2IW2 A;  2OAZ A;  2Q92 A;  2BWY A;  5FCF A;  2GG7 A;  2GTX A;  2BHA A;  1BOA A;  3PKB A;  2HOW A;  1KP0 A;  3FMR A;  2V6C A;  4IKR A;  2BWS A;  3IU9 A;  4JUQ A;  2Q95 A;  4A6W A;  4OOK A;  4PV4 A;  4S2R P;  2V3Y A;  2EA2 A;  3BIP A;  3IU7 A;  4IPA A;  4U6J A;  1O0X A;  3CB5 A;  1R5G A;  3FMQ A;  1PV9 A;  1C27 A;  5CDE A;  4IEC A;  1YW9 A;  2BWW A;  1XNZ A;  3CTZ A;  1C22 A;  2G6P A;  1WY2 A;  3L7G A;  1WL9 A;  3MAT A;  4FO8 A;  2DFI A;  5D6E A;  3BIQ A;  4IF7 A;  5CNX A;  4IKU A;  4FLL A;  2BHC A;  3TAV A;  1B6A A;  4U6C A;  1WKM A;  2NQ7 A;  2GU6 A;  1N51 A;  3Q6D A;  1XGM A;  4KM3 A;  2MAT A;  2Q93 A;  2P99 A;  4ZWU A;  3S6B A;  3IU8 A;  3MX6 A;  3CB6 A;  5JFR A;  4QR8 A;  4IDY A;  2Q8K A;  1C23 A;  1WN1 A;  4A6V A;  2BWV A;  2ADU A;  4RGZ 1;  1QXY A;  2BB7 A;  3D27 A;  2BHD A;  3FM3 A;  4FLK A;  1C24 A;  1Y1N A;  3MR1 A;  4ZNG A;  3PKC A;  1QXZ A;  1KQ9 A;  4FLI A;  4U6Z A;  1XGS A;  2BN7 A;  4U71 A;  1YW7 A;  2BH3 A;  2GG3 A;  4IU6 A;  4RZZ A;  3ROR A;  2GG0 A;  2EVM A;  4MAT A;  2ZSG A;  3IG4 A;  4S01 A;  1QZY A;  2B3L A;  2BWU A;  5JI6 A;  2GG8 A;  4HXX A;  5D6F A;  4S2T P;  4IKS A;  4ZWP A;  5CIK A;  2BHB A;  2B3K A;  1W7V A;  1WLR A;  1JAW A;  4EGE A;  2GGC A;  3PKE A;  1CHM A;  1XGO A;  5FCH A;  5JHU A;  1WBQ A;  2V3Z A;  2OKN A;  3BIT A;  4U75 A;  5CDL A;  2V3X A;  2Q96 A;  4FKC A;  1R5H A;  2GG9 A;  2BWT A;  2GA2 A;  4PNC A;  3TB5 A;  1B59 A;  2P9A A;  2GU4 A;  2GGB A;  3PKA A;  2P98 A;  4Z7M A;  2NQ6 A;  2GU7 A;  2GG2 A;  1BN5 A;  2EA4 A;  4FO7 A;  4U76 A;  1MAT A;  4U69 A;  4FUK A;  1W2M A;  4U1B A;  1A16 A;  5CLS A; 
#chains in the Genus database with same CATH homology
 2GU5 A;  4RZY A;  4S00 A;  2GG5 A;  1C21 A;  1QXW A;  1R58 A;  2Q94 A;  5CDV A;  5E5B A;  4U6E A;  5CE6 A;  3RVA A;  1WL6 A;  4FLJ A;  1YJ3 A;  2EVO A;  1YW8 A;  1YVM A;  2EVC A;  2BWX A;  1KQ0 A;  1XGN A;  4U70 A;  4U73 A;  4U6W A;  4IKT A;  3L24 A;  3PKD A;  4R60 A;  4B28 A;  1M35 A;  4ZWO A;  2GZ5 A;  2B3H A;  2IW2 A;  2OAZ A;  2Q92 A;  2BWY A;  5FCF A;  2GG7 A;  2GTX A;  2BHA A;  1BOA A;  3PKB A;  2HOW A;  1KP0 A;  3FMR A;  2V6C A;  4IKR A;  2BWS A;  3IU9 A;  4JUQ A;  2Q95 A;  4A6W A;  4OOK A;  4PV4 A;  4S2R P;  2V3Y A;  2EA2 A;  3BIP A;  3IU7 A;  4IPA A;  4U6J A;  1O0X A;  3CB5 A;  1R5G A;  3FMQ A;  1PV9 A;  1C27 A;  5CDE A;  4IEC A;  1YW9 A;  2BWW A;  1XNZ A;  3CTZ A;  1C22 A;  2G6P A;  1WY2 A;  3L7G A;  1WL9 A;  3MAT A;  4FO8 A;  2DFI A;  5D6E A;  3BIQ A;  4IF7 A;  5CNX A;  4IKU A;  4FLL A;  2BHC A;  3TAV A;  1B6A A;  4U6C A;  1WKM A;  2NQ7 A;  2GU6 A;  1N51 A;  3Q6D A;  1XGM A;  4KM3 A;  2MAT A;  2Q93 A;  2P99 A;  4ZWU A;  3S6B A;  3IU8 A;  3MX6 A;  3CB6 A;  5JFR A;  4QR8 A;  4IDY A;  2Q8K A;  1C23 A;  1WN1 A;  4A6V A;  2BWV A;  2ADU A;  4RGZ 1;  1QXY A;  2BB7 A;  3D27 A;  2BHD A;  3FM3 A;  4FLK A;  1C24 A;  1Y1N A;  3MR1 A;  4ZNG A;  3PKC A;  1QXZ A;  1KQ9 A;  4FLI A;  4U6Z A;  1XGS A;  2BN7 A;  4U71 A;  1YW7 A;  2BH3 A;  2GG3 A;  4IU6 A;  4RZZ A;  3ROR A;  2GG0 A;  2EVM A;  4MAT A;  2ZSG A;  3IG4 A;  4S01 A;  1QZY A;  2B3L A;  2BWU A;  5JI6 A;  2GG8 A;  4HXX A;  5D6F A;  4S2T P;  4IKS A;  4ZWP A;  5CIK A;  2BHB A;  2B3K A;  1W7V A;  1WLR A;  1JAW A;  4EGE A;  2GGC A;  3PKE A;  1CHM A;  1XGO A;  5FCH A;  5JHU A;  1WBQ A;  2V3Z A;  2OKN A;  3BIT A;  4U75 A;  5CDL A;  2V3X A;  2Q96 A;  4FKC A;  1R5H A;  2GG9 A;  2BWT A;  2GA2 A;  4PNC A;  3TB5 A;  1B59 A;  2P9A A;  2GU4 A;  2GGB A;  3PKA A;  2P98 A;  4Z7M A;  2NQ6 A;  2GU7 A;  2GG2 A;  1BN5 A;  2EA4 A;  4FO7 A;  4U76 A;  1MAT A;  4U69 A;  4FUK A;  1W2M A;  4U1B A;  1A16 A;  5CLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...