4FLKA

Human metap1 with bengamide analog y10, in mn form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4flkA00
4IU6A 1JAWA 2BWWA 4S2RP 5CE6A 3IU8A 1W7VA 3RORA 2GGCA 4U76A 2OKNA 2GU5A 4IF7A 1XNZA 5D6FA 5JFRA 2BWSA 5CDVA 2P98A 4RZYA 1XGMA 4A6VA 2B3KA 1YVMA 2OAZA 3IG4A 1YJ3A 4ZWUA 1WLRA 4U69A 3MX6A 4EGEA 4IDYA 4ZWPA 4IKRA 2GG2A 2HOWA 3PKDA 2Q92A 4FUKA 2GU7A 1WKMA 4S00A 4U70A 3TB5A 1R58A 4RGZ1 4A6WA 1O0XA 4IECA 2Q95A 2GU6A 1B6AA 3RVAA 5FCHA 2P9AA 2V6CA 4U6EA 2GG3A 5CNXA 4IKUA 4U1BA 3D27A 1WN1A 4ZNGA 4ZWOA 3FMQA 3CB5A 3IU7A 1R5GA 4S01A 2EVMA 1YW8A 2P99A 2Q93A 1QXWA 2V3XA 4IKTA 1C27A 2GG0A 2BWTA 4U6ZA 1M35A 4FLJA 3PKBA 4FLLA 5JI6A 3PKAA 3PKCA 1PV9A 4U71A 1KP0A 4FLKA 2V3ZA 5CDLA 4U73A 3TAVA 1MATA 1C21A 2EVCA 2BWVA 4RZZA 2MATA 1C22A 1BOAA 2ZSGA 4U6WA 2Q8KA 2DFIA 2IW2A 4JUQA 4MATA 1XGSA 5E5BA 1QZYA 3PKEA 3Q6DA 3CTZA 4Z7MA 1XGNA 1A16A 4U75A 1QXZA 3CB6A 4U6JA 2GG9A 5FCFA 5CLSA 4IKSA 5D6EA 4B28A 3MR1A 3FMRA 5CIKA 1CHMA 1XGOA 2BN7A 2ADUA 1YW9A 3L24A 1B59A 1KQ0A 1YW7A 2BHDA 5CDEA 1W2MA 3MATA 2B3LA 1C23A 2EA2A 2GA2A 3FM3A 1C24A 4QR8A 2BWXA 4KM3A 4FO7A 2BB7A 1BN5A 2BWUA 1R5HA 2GG5A 4HXXA 1Y1NA 2B3HA 2GTXA 4R60A 4S2TP 4U6CA 2GZ5A 4FLIA 4FKCA 4FO8A 1WY2A 2EVOA 2BH3A 2GGBA 2BWYA 2BHAA 2V3YA 2BHBA 1N51A 1WL9A 5JHUA 2EA4A 2G6PA 3BIQA 4OOKA 1WL6A 3S6BA 2Q94A 1WBQA 2Q96A 2GG8A 2NQ6A 4IPAA 1KQ9A 2NQ7A 4PNCA 3L7GA 2GU4A 3BITA 3BIPA 4PV4A 2GG7A 3IU9A 2BHCA 1QXYA
chains in the Genus database with same CATH superfamily
4IU6A 1JAWA 2BWWA 4S2RP 5CE6A 3IU8A 1W7VA 3RORA 2GGCA 4U76A 2OKNA 2GU5A 4IF7A 1XNZA 5D6FA 5JFRA 2BWSA 5CDVA 2P98A 4RZYA 1XGMA 4A6VA 2B3KA 1YVMA 2OAZA 3IG4A 1YJ3A 4ZWUA 1WLRA 4U69A 3MX6A 4EGEA 4IDYA 4ZWPA 4IKRA 2GG2A 2HOWA 3PKDA 2Q92A 4FUKA 2GU7A 1WKMA 4S00A 4U70A 3TB5A 1R58A 4RGZ1 4A6WA 1O0XA 4IECA 2Q95A 2GU6A 1B6AA 3RVAA 5FCHA 2P9AA 2V6CA 4U6EA 2GG3A 5CNXA 4IKUA 4U1BA 3D27A 1WN1A 4ZNGA 4ZWOA 3FMQA 3CB5A 3IU7A 1R5GA 4S01A 2EVMA 1YW8A 2P99A 2Q93A 1QXWA 2V3XA 4IKTA 1C27A 2GG0A 2BWTA 4U6ZA 1M35A 4FLJA 3PKBA 4FLLA 5JI6A 3PKAA 3PKCA 1PV9A 4U71A 1KP0A 4FLKA 2V3ZA 5CDLA 4U73A 3TAVA 1MATA 1C21A 2EVCA 2BWVA 4RZZA 2MATA 1C22A 1BOAA 2ZSGA 4U6WA 2Q8KA 2DFIA 2IW2A 4JUQA 4MATA 1XGSA 5E5BA 1QZYA 3PKEA 3Q6DA 3CTZA 4Z7MA 1XGNA 1A16A 4U75A 1QXZA 3CB6A 4U6JA 2GG9A 5FCFA 5CLSA 4IKSA 5D6EA 4B28A 3MR1A 3FMRA 5CIKA 1CHMA 1XGOA 2BN7A 2ADUA 1YW9A 3L24A 1B59A 1KQ0A 1YW7A 2BHDA 5CDEA 1W2MA 3MATA 2B3LA 1C23A 2EA2A 2GA2A 3FM3A 1C24A 4QR8A 2BWXA 4KM3A 4FO7A 2BB7A 1BN5A 2BWUA 1R5HA 2GG5A 4HXXA 1Y1NA 2B3HA 2GTXA 4R60A 4S2TP 4U6CA 2GZ5A 4FLIA 4FKCA 4FO8A 1WY2A 2EVOA 2BH3A 2GGBA 2BWYA 2BHAA 2V3YA 2BHBA 1N51A 1WL9A 5JHUA 2EA4A 2G6PA 3BIQA 4OOKA 1WL6A 3S6BA 2Q94A 1WBQA 2Q96A 2GG8A 2NQ6A 4IPAA 1KQ9A 2NQ7A 4PNCA 3L7GA 2GU4A 3BITA 3BIPA 4PV4A 2GG7A 3IU9A 2BHCA 1QXYA
chains in the Genus database with same CATH topology
4IU6A 1JAWA 2BWWA 4S2RP 5CE6A 3IU8A 1W7VA 3RORA 2GGCA 4U76A 2OKNA 2GU5A 4IF7A 1XNZA 5D6FA 5JFRA 2BWSA 5CDVA 2P98A 4RZYA 1XGMA 4A6VA 2B3KA 1YVMA 2OAZA 3IG4A 1YJ3A 4ZWUA 1WLRA 4U69A 3MX6A 4EGEA 4IDYA 4ZWPA 4IKRA 2GG2A 2HOWA 3PKDA 2Q92A 4FUKA 2GU7A 1WKMA 4S00A 4U70A 3TB5A 1R58A 4RGZ1 4A6WA 1O0XA 4IECA 2Q95A 2GU6A 1B6AA 3RVAA 5FCHA 2P9AA 2V6CA 4U6EA 2GG3A 5CNXA 4IKUA 4U1BA 3D27A 1WN1A 4ZNGA 4ZWOA 3FMQA 3CB5A 3IU7A 1R5GA 4S01A 2EVMA 1YW8A 2P99A 2Q93A 1QXWA 2V3XA 4IKTA 1C27A 2GG0A 2BWTA 4U6ZA 1M35A 4FLJA 3PKBA 4FLLA 5JI6A 3PKAA 3PKCA 1PV9A 4U71A 1KP0A 4FLKA 2V3ZA 5CDLA 4U73A 3TAVA 1MATA 1C21A 2EVCA 2BWVA 4RZZA 2MATA 1C22A 1BOAA 2ZSGA 4U6WA 2Q8KA 2DFIA 2IW2A 4JUQA 4MATA 1XGSA 5E5BA 1QZYA 3PKEA 3Q6DA 3CTZA 4Z7MA 1XGNA 1A16A 4U75A 1QXZA 3CB6A 4U6JA 2GG9A 5FCFA 5CLSA 4IKSA 5D6EA 4B28A 3MR1A 3FMRA 5CIKA 1CHMA 1XGOA 2BN7A 2ADUA 1YW9A 3L24A 1B59A 1KQ0A 1YW7A 2BHDA 5CDEA 1W2MA 3MATA 2B3LA 1C23A 2EA2A 2GA2A 3FM3A 1C24A 4QR8A 2BWXA 4KM3A 4FO7A 2BB7A 1BN5A 2BWUA 1R5HA 2GG5A 4HXXA 1Y1NA 2B3HA 2GTXA 4R60A 4S2TP 4U6CA 2GZ5A 4FLIA 4FKCA 4FO8A 1WY2A 2EVOA 2BH3A 2GGBA 2BWYA 2BHAA 2V3YA 2BHBA 1N51A 1WL9A 5JHUA 2EA4A 2G6PA 3BIQA 4OOKA 1WL6A 3S6BA 2Q94A 1WBQA 2Q96A 2GG8A 2NQ6A 4IPAA 1KQ9A 2NQ7A 4PNCA 3L7GA 2GU4A 3BITA 3BIPA 4PV4A 2GG7A 3IU9A 2BHCA 1QXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU6 A;  1JAW A;  2BWW A;  4S2R P;  5CE6 A;  3IU8 A;  1W7V A;  3ROR A;  2GGC A;  4U76 A;  2OKN A;  2GU5 A;  4IF7 A;  1XNZ A;  5D6F A;  5JFR A;  2BWS A;  5CDV A;  2P98 A;  4RZY A;  1XGM A;  4A6V A;  2B3K A;  1YVM A;  2OAZ A;  3IG4 A;  1YJ3 A;  4ZWU A;  1WLR A;  4U69 A;  3MX6 A;  4EGE A;  4IDY A;  4ZWP A;  4IKR A;  2GG2 A;  2HOW A;  3PKD A;  2Q92 A;  4FUK A;  2GU7 A;  1WKM A;  4S00 A;  4U70 A;  3TB5 A;  1R58 A;  4RGZ 1;  4A6W A;  1O0X A;  4IEC A;  2Q95 A;  2GU6 A;  1B6A A;  3RVA A;  5FCH A;  2P9A A;  2V6C A;  4U6E A;  2GG3 A;  5CNX A;  4IKU A;  4U1B A;  3D27 A;  1WN1 A;  4ZNG A;  4ZWO A;  3FMQ A;  3CB5 A;  3IU7 A;  1R5G A;  4S01 A;  2EVM A;  1YW8 A;  2P99 A;  2Q93 A;  1QXW A;  2V3X A;  4IKT A;  1C27 A;  2GG0 A;  2BWT A;  4U6Z A;  1M35 A;  4FLJ A;  3PKB A;  4FLL A;  5JI6 A;  3PKA A;  3PKC A;  1PV9 A;  4U71 A;  1KP0 A;  4FLK A;  2V3Z A;  5CDL A;  4U73 A;  3TAV A;  1MAT A;  1C21 A;  2EVC A;  2BWV A;  4RZZ A;  2MAT A;  1C22 A;  1BOA A;  2ZSG A;  4U6W A;  2Q8K A;  2DFI A;  2IW2 A;  4JUQ A;  4MAT A;  1XGS A;  5E5B A;  1QZY A;  3PKE A;  3Q6D A;  3CTZ A;  4Z7M A;  1XGN A;  1A16 A;  4U75 A;  1QXZ A;  3CB6 A;  4U6J A;  2GG9 A;  5FCF A;  5CLS A;  4IKS A;  5D6E A;  4B28 A;  3MR1 A;  3FMR A;  5CIK A;  1CHM A;  1XGO A;  2BN7 A;  2ADU A;  1YW9 A;  3L24 A;  1B59 A;  1KQ0 A;  1YW7 A;  2BHD A;  5CDE A;  1W2M A;  3MAT A;  2B3L A;  1C23 A;  2EA2 A;  2GA2 A;  3FM3 A;  1C24 A;  4QR8 A;  2BWX A;  4KM3 A;  4FO7 A;  2BB7 A;  1BN5 A;  2BWU A;  1R5H A;  2GG5 A;  4HXX A;  1Y1N A;  2B3H A;  2GTX A;  4R60 A;  4S2T P;  4U6C A;  2GZ5 A;  4FLI A;  4FKC A;  4FO8 A;  1WY2 A;  2EVO A;  2BH3 A;  2GGB A;  2BWY A;  2BHA A;  2V3Y A;  2BHB A;  1N51 A;  1WL9 A;  5JHU A;  2EA4 A;  2G6P A;  3BIQ A;  4OOK A;  1WL6 A;  3S6B A;  2Q94 A;  1WBQ A;  2Q96 A;  2GG8 A;  2NQ6 A;  4IPA A;  1KQ9 A;  2NQ7 A;  4PNC A;  3L7G A;  2GU4 A;  3BIT A;  3BIP A;  4PV4 A;  2GG7 A;  3IU9 A;  2BHC A;  1QXY A; 
#chains in the Genus database with same CATH topology
 4IU6 A;  1JAW A;  2BWW A;  4S2R P;  5CE6 A;  3IU8 A;  1W7V A;  3ROR A;  2GGC A;  4U76 A;  2OKN A;  2GU5 A;  4IF7 A;  1XNZ A;  5D6F A;  5JFR A;  2BWS A;  5CDV A;  2P98 A;  4RZY A;  1XGM A;  4A6V A;  2B3K A;  1YVM A;  2OAZ A;  3IG4 A;  1YJ3 A;  4ZWU A;  1WLR A;  4U69 A;  3MX6 A;  4EGE A;  4IDY A;  4ZWP A;  4IKR A;  2GG2 A;  2HOW A;  3PKD A;  2Q92 A;  4FUK A;  2GU7 A;  1WKM A;  4S00 A;  4U70 A;  3TB5 A;  1R58 A;  4RGZ 1;  4A6W A;  1O0X A;  4IEC A;  2Q95 A;  2GU6 A;  1B6A A;  3RVA A;  5FCH A;  2P9A A;  2V6C A;  4U6E A;  2GG3 A;  5CNX A;  4IKU A;  4U1B A;  3D27 A;  1WN1 A;  4ZNG A;  4ZWO A;  3FMQ A;  3CB5 A;  3IU7 A;  1R5G A;  4S01 A;  2EVM A;  1YW8 A;  2P99 A;  2Q93 A;  1QXW A;  2V3X A;  4IKT A;  1C27 A;  2GG0 A;  2BWT A;  4U6Z A;  1M35 A;  4FLJ A;  3PKB A;  4FLL A;  5JI6 A;  3PKA A;  3PKC A;  1PV9 A;  4U71 A;  1KP0 A;  4FLK A;  2V3Z A;  5CDL A;  4U73 A;  3TAV A;  1MAT A;  1C21 A;  2EVC A;  2BWV A;  4RZZ A;  2MAT A;  1C22 A;  1BOA A;  2ZSG A;  4U6W A;  2Q8K A;  2DFI A;  2IW2 A;  4JUQ A;  4MAT A;  1XGS A;  5E5B A;  1QZY A;  3PKE A;  3Q6D A;  3CTZ A;  4Z7M A;  1XGN A;  1A16 A;  4U75 A;  1QXZ A;  3CB6 A;  4U6J A;  2GG9 A;  5FCF A;  5CLS A;  4IKS A;  5D6E A;  4B28 A;  3MR1 A;  3FMR A;  5CIK A;  1CHM A;  1XGO A;  2BN7 A;  2ADU A;  1YW9 A;  3L24 A;  1B59 A;  1KQ0 A;  1YW7 A;  2BHD A;  5CDE A;  1W2M A;  3MAT A;  2B3L A;  1C23 A;  2EA2 A;  2GA2 A;  3FM3 A;  1C24 A;  4QR8 A;  2BWX A;  4KM3 A;  4FO7 A;  2BB7 A;  1BN5 A;  2BWU A;  1R5H A;  2GG5 A;  4HXX A;  1Y1N A;  2B3H A;  2GTX A;  4R60 A;  4S2T P;  4U6C A;  2GZ5 A;  4FLI A;  4FKC A;  4FO8 A;  1WY2 A;  2EVO A;  2BH3 A;  2GGB A;  2BWY A;  2BHA A;  2V3Y A;  2BHB A;  1N51 A;  1WL9 A;  5JHU A;  2EA4 A;  2G6P A;  3BIQ A;  4OOK A;  1WL6 A;  3S6B A;  2Q94 A;  1WBQ A;  2Q96 A;  2GG8 A;  2NQ6 A;  4IPA A;  1KQ9 A;  2NQ7 A;  4PNC A;  3L7G A;  2GU4 A;  3BIT A;  3BIP A;  4PV4 A;  2GG7 A;  3IU9 A;  2BHC A;  1QXY A; 
#chains in the Genus database with same CATH homology
 4IU6 A;  1JAW A;  2BWW A;  4S2R P;  5CE6 A;  3IU8 A;  1W7V A;  3ROR A;  2GGC A;  4U76 A;  2OKN A;  2GU5 A;  4IF7 A;  1XNZ A;  5D6F A;  5JFR A;  2BWS A;  5CDV A;  2P98 A;  4RZY A;  1XGM A;  4A6V A;  2B3K A;  1YVM A;  2OAZ A;  3IG4 A;  1YJ3 A;  4ZWU A;  1WLR A;  4U69 A;  3MX6 A;  4EGE A;  4IDY A;  4ZWP A;  4IKR A;  2GG2 A;  2HOW A;  3PKD A;  2Q92 A;  4FUK A;  2GU7 A;  1WKM A;  4S00 A;  4U70 A;  3TB5 A;  1R58 A;  4RGZ 1;  4A6W A;  1O0X A;  4IEC A;  2Q95 A;  2GU6 A;  1B6A A;  3RVA A;  5FCH A;  2P9A A;  2V6C A;  4U6E A;  2GG3 A;  5CNX A;  4IKU A;  4U1B A;  3D27 A;  1WN1 A;  4ZNG A;  4ZWO A;  3FMQ A;  3CB5 A;  3IU7 A;  1R5G A;  4S01 A;  2EVM A;  1YW8 A;  2P99 A;  2Q93 A;  1QXW A;  2V3X A;  4IKT A;  1C27 A;  2GG0 A;  2BWT A;  4U6Z A;  1M35 A;  4FLJ A;  3PKB A;  4FLL A;  5JI6 A;  3PKA A;  3PKC A;  1PV9 A;  4U71 A;  1KP0 A;  4FLK A;  2V3Z A;  5CDL A;  4U73 A;  3TAV A;  1MAT A;  1C21 A;  2EVC A;  2BWV A;  4RZZ A;  2MAT A;  1C22 A;  1BOA A;  2ZSG A;  4U6W A;  2Q8K A;  2DFI A;  2IW2 A;  4JUQ A;  4MAT A;  1XGS A;  5E5B A;  1QZY A;  3PKE A;  3Q6D A;  3CTZ A;  4Z7M A;  1XGN A;  1A16 A;  4U75 A;  1QXZ A;  3CB6 A;  4U6J A;  2GG9 A;  5FCF A;  5CLS A;  4IKS A;  5D6E A;  4B28 A;  3MR1 A;  3FMR A;  5CIK A;  1CHM A;  1XGO A;  2BN7 A;  2ADU A;  1YW9 A;  3L24 A;  1B59 A;  1KQ0 A;  1YW7 A;  2BHD A;  5CDE A;  1W2M A;  3MAT A;  2B3L A;  1C23 A;  2EA2 A;  2GA2 A;  3FM3 A;  1C24 A;  4QR8 A;  2BWX A;  4KM3 A;  4FO7 A;  2BB7 A;  1BN5 A;  2BWU A;  1R5H A;  2GG5 A;  4HXX A;  1Y1N A;  2B3H A;  2GTX A;  4R60 A;  4S2T P;  4U6C A;  2GZ5 A;  4FLI A;  4FKC A;  4FO8 A;  1WY2 A;  2EVO A;  2BH3 A;  2GGB A;  2BWY A;  2BHA A;  2V3Y A;  2BHB A;  1N51 A;  1WL9 A;  5JHU A;  2EA4 A;  2G6P A;  3BIQ A;  4OOK A;  1WL6 A;  3S6B A;  2Q94 A;  1WBQ A;  2Q96 A;  2GG8 A;  2NQ6 A;  4IPA A;  1KQ9 A;  2NQ7 A;  4PNC A;  3L7G A;  2GU4 A;  3BIT A;  3BIP A;  4PV4 A;  2GG7 A;  3IU9 A;  2BHC A;  1QXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...