4FLKA

Human metap1 with bengamide analog y10, in mn form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4flkA00
1BOAA 2NQ7A 2BWSA 1C24A 3MX6A 4FLLA 4ZWOA 2V3XA 1WL6A 5CIKA 2GU5A 3IU9A 4U69A 2BWUA 2IW2A 4IKUA 5E5BA 2BB7A 3PKCA 1XGSA 4FLJA 1B59A 3L24A 1MATA 2EA2A 3PKEA 2BWWA 2Q94A 4FKCA 2Q8KA 2NQ6A 1Y1NA 3TB5A 1XGOA 5JI6A 2BN7A 3FM3A 2GU7A 1QXZA 1R58A 1C21A 2P98A 4Z7MA 4U6ZA 1WY2A 2V3YA 4A6VA 1YVMA 2BWXA 5CDEA 2Q92A 3PKAA 3BITA 3FMQA 3S6BA 1R5HA 3RORA 5CLSA 4ZNGA 3MATA 1A16A 1WLRA 2BHCA 2DFIA 1R5GA 1M35A 3CB5A 2BHBA 2P9AA 4RZZA 4FLKA 4JUQA 4IU6A 4FO7A 4U75A 1BN5A 2EA4A 1CHMA 4HXXA 4RZYA 1YJ3A 2GZ5A 3PKDA 2BH3A 4KM3A 2ADUA 2GGBA 4U70A 4PV4A 4R60A 2G6PA 4FLIA 2GG9A 4U1BA 3IU8A 4FO8A 1YW9A 4IPAA 4RGZ1 5D6FA 2GG5A 3PKBA 5D6EA 1WN1A 4IF7A 3RVAA 1W2MA 3CB6A 1KQ9A 2GTXA 4FUKA 2MATA 2GU6A 4U6JA 2OAZA 5FCFA 2BWYA 1XNZA 1KQ0A 5CNXA 1YW7A 2Q95A 2GA2A 2GG3A 3IU7A 4QR8A 5FCHA 4U6EA 2GG2A 2ZSGA 1XGMA 3L7GA 1JAWA 2GU4A 3FMRA 4A6WA 5CDLA 4IECA 2GG8A 5CE6A 1WL9A 4U6WA 1PV9A 5CDVA 2Q93A 2BHDA 1B6AA 1KP0A 1QXWA 2P99A 4IKTA 1W7VA 4ZWUA 2GGCA 1O0XA 2V6CA 4U6CA 4PNCA 3TAVA 2Q96A 1QZYA 1XGNA 2EVOA 4S2TP 4EGEA 3BIPA 4IDYA 3MR1A 1QXYA 2BWVA 1C22A 4ZWPA 1N51A 3BIQA 1YW8A 4U73A 3Q6DA 1WBQA 4IKSA 1C27A 4S01A 2V3ZA 4S2RP 2B3HA 2BWTA 4U71A 5JFRA 2B3LA 2HOWA 2OKNA 2GG0A 5JHUA 4U76A 1WKMA 2EVCA 2BHAA 2GG7A 3D27A 2B3KA 3CTZA 4S00A 1C23A 2EVMA 4OOKA 3IG4A 4MATA 4IKRA 4B28A
chains in the Genus database with same CATH superfamily
1BOAA 2NQ7A 2BWSA 1C24A 3MX6A 4FLLA 4ZWOA 2V3XA 1WL6A 5CIKA 2GU5A 3IU9A 4U69A 2BWUA 2IW2A 4IKUA 5E5BA 2BB7A 3PKCA 1XGSA 4FLJA 1B59A 3L24A 1MATA 2EA2A 3PKEA 2BWWA 2Q94A 4FKCA 2Q8KA 2NQ6A 1Y1NA 3TB5A 1XGOA 5JI6A 2BN7A 3FM3A 2GU7A 1QXZA 1R58A 1C21A 2P98A 4Z7MA 4U6ZA 1WY2A 2V3YA 4A6VA 1YVMA 2BWXA 5CDEA 2Q92A 3PKAA 3BITA 3FMQA 3S6BA 1R5HA 3RORA 5CLSA 4ZNGA 3MATA 1A16A 1WLRA 2BHCA 2DFIA 1R5GA 1M35A 3CB5A 2BHBA 2P9AA 4RZZA 4FLKA 4JUQA 4IU6A 4FO7A 4U75A 1BN5A 2EA4A 1CHMA 4HXXA 4RZYA 1YJ3A 2GZ5A 3PKDA 2BH3A 4KM3A 2ADUA 2GGBA 4U70A 4PV4A 4R60A 2G6PA 4FLIA 2GG9A 4U1BA 3IU8A 4FO8A 1YW9A 4IPAA 4RGZ1 5D6FA 2GG5A 3PKBA 5D6EA 1WN1A 4IF7A 3RVAA 1W2MA 3CB6A 1KQ9A 2GTXA 4FUKA 2MATA 2GU6A 4U6JA 2OAZA 5FCFA 2BWYA 1XNZA 1KQ0A 5CNXA 1YW7A 2Q95A 2GA2A 2GG3A 3IU7A 4QR8A 5FCHA 4U6EA 2GG2A 2ZSGA 1XGMA 3L7GA 1JAWA 2GU4A 3FMRA 4A6WA 5CDLA 4IECA 2GG8A 5CE6A 1WL9A 4U6WA 1PV9A 5CDVA 2Q93A 2BHDA 1B6AA 1KP0A 1QXWA 2P99A 4IKTA 1W7VA 4ZWUA 2GGCA 1O0XA 2V6CA 4U6CA 4PNCA 3TAVA 2Q96A 1QZYA 1XGNA 2EVOA 4S2TP 4EGEA 3BIPA 4IDYA 3MR1A 1QXYA 2BWVA 1C22A 4ZWPA 1N51A 3BIQA 1YW8A 4U73A 3Q6DA 1WBQA 4IKSA 1C27A 4S01A 2V3ZA 4S2RP 2B3HA 2BWTA 4U71A 5JFRA 2B3LA 2HOWA 2OKNA 2GG0A 5JHUA 4U76A 1WKMA 2EVCA 2BHAA 2GG7A 3D27A 2B3KA 3CTZA 4S00A 1C23A 2EVMA 4OOKA 3IG4A 4MATA 4IKRA 4B28A
chains in the Genus database with same CATH topology
1BOAA 2NQ7A 2BWSA 1C24A 3MX6A 4FLLA 4ZWOA 2V3XA 1WL6A 5CIKA 2GU5A 3IU9A 4U69A 2BWUA 2IW2A 4IKUA 5E5BA 2BB7A 3PKCA 1XGSA 4FLJA 1B59A 3L24A 1MATA 2EA2A 3PKEA 2BWWA 2Q94A 4FKCA 2Q8KA 2NQ6A 1Y1NA 3TB5A 1XGOA 5JI6A 2BN7A 3FM3A 2GU7A 1QXZA 1R58A 1C21A 2P98A 4Z7MA 4U6ZA 1WY2A 2V3YA 4A6VA 1YVMA 2BWXA 5CDEA 2Q92A 3PKAA 3BITA 3FMQA 3S6BA 1R5HA 3RORA 5CLSA 4ZNGA 3MATA 1A16A 1WLRA 2BHCA 2DFIA 1R5GA 1M35A 3CB5A 2BHBA 2P9AA 4RZZA 4FLKA 4JUQA 4IU6A 4FO7A 4U75A 1BN5A 2EA4A 1CHMA 4HXXA 4RZYA 1YJ3A 2GZ5A 3PKDA 2BH3A 4KM3A 2ADUA 2GGBA 4U70A 4PV4A 4R60A 2G6PA 4FLIA 2GG9A 4U1BA 3IU8A 4FO8A 1YW9A 4IPAA 4RGZ1 5D6FA 2GG5A 3PKBA 5D6EA 1WN1A 4IF7A 3RVAA 1W2MA 3CB6A 1KQ9A 2GTXA 4FUKA 2MATA 2GU6A 4U6JA 2OAZA 5FCFA 2BWYA 1XNZA 1KQ0A 5CNXA 1YW7A 2Q95A 2GA2A 2GG3A 3IU7A 4QR8A 5FCHA 4U6EA 2GG2A 2ZSGA 1XGMA 3L7GA 1JAWA 2GU4A 3FMRA 4A6WA 5CDLA 4IECA 2GG8A 5CE6A 1WL9A 4U6WA 1PV9A 5CDVA 2Q93A 2BHDA 1B6AA 1KP0A 1QXWA 2P99A 4IKTA 1W7VA 4ZWUA 2GGCA 1O0XA 2V6CA 4U6CA 4PNCA 3TAVA 2Q96A 1QZYA 1XGNA 2EVOA 4S2TP 4EGEA 3BIPA 4IDYA 3MR1A 1QXYA 2BWVA 1C22A 4ZWPA 1N51A 3BIQA 1YW8A 4U73A 3Q6DA 1WBQA 4IKSA 1C27A 4S01A 2V3ZA 4S2RP 2B3HA 2BWTA 4U71A 5JFRA 2B3LA 2HOWA 2OKNA 2GG0A 5JHUA 4U76A 1WKMA 2EVCA 2BHAA 2GG7A 3D27A 2B3KA 3CTZA 4S00A 1C23A 2EVMA 4OOKA 3IG4A 4MATA 4IKRA 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOA A;  2NQ7 A;  2BWS A;  1C24 A;  3MX6 A;  4FLL A;  4ZWO A;  2V3X A;  1WL6 A;  5CIK A;  2GU5 A;  3IU9 A;  4U69 A;  2BWU A;  2IW2 A;  4IKU A;  5E5B A;  2BB7 A;  3PKC A;  1XGS A;  4FLJ A;  1B59 A;  3L24 A;  1MAT A;  2EA2 A;  3PKE A;  2BWW A;  2Q94 A;  4FKC A;  2Q8K A;  2NQ6 A;  1Y1N A;  3TB5 A;  1XGO A;  5JI6 A;  2BN7 A;  3FM3 A;  2GU7 A;  1QXZ A;  1R58 A;  1C21 A;  2P98 A;  4Z7M A;  4U6Z A;  1WY2 A;  2V3Y A;  4A6V A;  1YVM A;  2BWX A;  5CDE A;  2Q92 A;  3PKA A;  3BIT A;  3FMQ A;  3S6B A;  1R5H A;  3ROR A;  5CLS A;  4ZNG A;  3MAT A;  1A16 A;  1WLR A;  2BHC A;  2DFI A;  1R5G A;  1M35 A;  3CB5 A;  2BHB A;  2P9A A;  4RZZ A;  4FLK A;  4JUQ A;  4IU6 A;  4FO7 A;  4U75 A;  1BN5 A;  2EA4 A;  1CHM A;  4HXX A;  4RZY A;  1YJ3 A;  2GZ5 A;  3PKD A;  2BH3 A;  4KM3 A;  2ADU A;  2GGB A;  4U70 A;  4PV4 A;  4R60 A;  2G6P A;  4FLI A;  2GG9 A;  4U1B A;  3IU8 A;  4FO8 A;  1YW9 A;  4IPA A;  4RGZ 1;  5D6F A;  2GG5 A;  3PKB A;  5D6E A;  1WN1 A;  4IF7 A;  3RVA A;  1W2M A;  3CB6 A;  1KQ9 A;  2GTX A;  4FUK A;  2MAT A;  2GU6 A;  4U6J A;  2OAZ A;  5FCF A;  2BWY A;  1XNZ A;  1KQ0 A;  5CNX A;  1YW7 A;  2Q95 A;  2GA2 A;  2GG3 A;  3IU7 A;  4QR8 A;  5FCH A;  4U6E A;  2GG2 A;  2ZSG A;  1XGM A;  3L7G A;  1JAW A;  2GU4 A;  3FMR A;  4A6W A;  5CDL A;  4IEC A;  2GG8 A;  5CE6 A;  1WL9 A;  4U6W A;  1PV9 A;  5CDV A;  2Q93 A;  2BHD A;  1B6A A;  1KP0 A;  1QXW A;  2P99 A;  4IKT A;  1W7V A;  4ZWU A;  2GGC A;  1O0X A;  2V6C A;  4U6C A;  4PNC A;  3TAV A;  2Q96 A;  1QZY A;  1XGN A;  2EVO A;  4S2T P;  4EGE A;  3BIP A;  4IDY A;  3MR1 A;  1QXY A;  2BWV A;  1C22 A;  4ZWP A;  1N51 A;  3BIQ A;  1YW8 A;  4U73 A;  3Q6D A;  1WBQ A;  4IKS A;  1C27 A;  4S01 A;  2V3Z A;  4S2R P;  2B3H A;  2BWT A;  4U71 A;  5JFR A;  2B3L A;  2HOW A;  2OKN A;  2GG0 A;  5JHU A;  4U76 A;  1WKM A;  2EVC A;  2BHA A;  2GG7 A;  3D27 A;  2B3K A;  3CTZ A;  4S00 A;  1C23 A;  2EVM A;  4OOK A;  3IG4 A;  4MAT A;  4IKR A;  4B28 A; 
#chains in the Genus database with same CATH topology
 1BOA A;  2NQ7 A;  2BWS A;  1C24 A;  3MX6 A;  4FLL A;  4ZWO A;  2V3X A;  1WL6 A;  5CIK A;  2GU5 A;  3IU9 A;  4U69 A;  2BWU A;  2IW2 A;  4IKU A;  5E5B A;  2BB7 A;  3PKC A;  1XGS A;  4FLJ A;  1B59 A;  3L24 A;  1MAT A;  2EA2 A;  3PKE A;  2BWW A;  2Q94 A;  4FKC A;  2Q8K A;  2NQ6 A;  1Y1N A;  3TB5 A;  1XGO A;  5JI6 A;  2BN7 A;  3FM3 A;  2GU7 A;  1QXZ A;  1R58 A;  1C21 A;  2P98 A;  4Z7M A;  4U6Z A;  1WY2 A;  2V3Y A;  4A6V A;  1YVM A;  2BWX A;  5CDE A;  2Q92 A;  3PKA A;  3BIT A;  3FMQ A;  3S6B A;  1R5H A;  3ROR A;  5CLS A;  4ZNG A;  3MAT A;  1A16 A;  1WLR A;  2BHC A;  2DFI A;  1R5G A;  1M35 A;  3CB5 A;  2BHB A;  2P9A A;  4RZZ A;  4FLK A;  4JUQ A;  4IU6 A;  4FO7 A;  4U75 A;  1BN5 A;  2EA4 A;  1CHM A;  4HXX A;  4RZY A;  1YJ3 A;  2GZ5 A;  3PKD A;  2BH3 A;  4KM3 A;  2ADU A;  2GGB A;  4U70 A;  4PV4 A;  4R60 A;  2G6P A;  4FLI A;  2GG9 A;  4U1B A;  3IU8 A;  4FO8 A;  1YW9 A;  4IPA A;  4RGZ 1;  5D6F A;  2GG5 A;  3PKB A;  5D6E A;  1WN1 A;  4IF7 A;  3RVA A;  1W2M A;  3CB6 A;  1KQ9 A;  2GTX A;  4FUK A;  2MAT A;  2GU6 A;  4U6J A;  2OAZ A;  5FCF A;  2BWY A;  1XNZ A;  1KQ0 A;  5CNX A;  1YW7 A;  2Q95 A;  2GA2 A;  2GG3 A;  3IU7 A;  4QR8 A;  5FCH A;  4U6E A;  2GG2 A;  2ZSG A;  1XGM A;  3L7G A;  1JAW A;  2GU4 A;  3FMR A;  4A6W A;  5CDL A;  4IEC A;  2GG8 A;  5CE6 A;  1WL9 A;  4U6W A;  1PV9 A;  5CDV A;  2Q93 A;  2BHD A;  1B6A A;  1KP0 A;  1QXW A;  2P99 A;  4IKT A;  1W7V A;  4ZWU A;  2GGC A;  1O0X A;  2V6C A;  4U6C A;  4PNC A;  3TAV A;  2Q96 A;  1QZY A;  1XGN A;  2EVO A;  4S2T P;  4EGE A;  3BIP A;  4IDY A;  3MR1 A;  1QXY A;  2BWV A;  1C22 A;  4ZWP A;  1N51 A;  3BIQ A;  1YW8 A;  4U73 A;  3Q6D A;  1WBQ A;  4IKS A;  1C27 A;  4S01 A;  2V3Z A;  4S2R P;  2B3H A;  2BWT A;  4U71 A;  5JFR A;  2B3L A;  2HOW A;  2OKN A;  2GG0 A;  5JHU A;  4U76 A;  1WKM A;  2EVC A;  2BHA A;  2GG7 A;  3D27 A;  2B3K A;  3CTZ A;  4S00 A;  1C23 A;  2EVM A;  4OOK A;  3IG4 A;  4MAT A;  4IKR A;  4B28 A; 
#chains in the Genus database with same CATH homology
 1BOA A;  2NQ7 A;  2BWS A;  1C24 A;  3MX6 A;  4FLL A;  4ZWO A;  2V3X A;  1WL6 A;  5CIK A;  2GU5 A;  3IU9 A;  4U69 A;  2BWU A;  2IW2 A;  4IKU A;  5E5B A;  2BB7 A;  3PKC A;  1XGS A;  4FLJ A;  1B59 A;  3L24 A;  1MAT A;  2EA2 A;  3PKE A;  2BWW A;  2Q94 A;  4FKC A;  2Q8K A;  2NQ6 A;  1Y1N A;  3TB5 A;  1XGO A;  5JI6 A;  2BN7 A;  3FM3 A;  2GU7 A;  1QXZ A;  1R58 A;  1C21 A;  2P98 A;  4Z7M A;  4U6Z A;  1WY2 A;  2V3Y A;  4A6V A;  1YVM A;  2BWX A;  5CDE A;  2Q92 A;  3PKA A;  3BIT A;  3FMQ A;  3S6B A;  1R5H A;  3ROR A;  5CLS A;  4ZNG A;  3MAT A;  1A16 A;  1WLR A;  2BHC A;  2DFI A;  1R5G A;  1M35 A;  3CB5 A;  2BHB A;  2P9A A;  4RZZ A;  4FLK A;  4JUQ A;  4IU6 A;  4FO7 A;  4U75 A;  1BN5 A;  2EA4 A;  1CHM A;  4HXX A;  4RZY A;  1YJ3 A;  2GZ5 A;  3PKD A;  2BH3 A;  4KM3 A;  2ADU A;  2GGB A;  4U70 A;  4PV4 A;  4R60 A;  2G6P A;  4FLI A;  2GG9 A;  4U1B A;  3IU8 A;  4FO8 A;  1YW9 A;  4IPA A;  4RGZ 1;  5D6F A;  2GG5 A;  3PKB A;  5D6E A;  1WN1 A;  4IF7 A;  3RVA A;  1W2M A;  3CB6 A;  1KQ9 A;  2GTX A;  4FUK A;  2MAT A;  2GU6 A;  4U6J A;  2OAZ A;  5FCF A;  2BWY A;  1XNZ A;  1KQ0 A;  5CNX A;  1YW7 A;  2Q95 A;  2GA2 A;  2GG3 A;  3IU7 A;  4QR8 A;  5FCH A;  4U6E A;  2GG2 A;  2ZSG A;  1XGM A;  3L7G A;  1JAW A;  2GU4 A;  3FMR A;  4A6W A;  5CDL A;  4IEC A;  2GG8 A;  5CE6 A;  1WL9 A;  4U6W A;  1PV9 A;  5CDV A;  2Q93 A;  2BHD A;  1B6A A;  1KP0 A;  1QXW A;  2P99 A;  4IKT A;  1W7V A;  4ZWU A;  2GGC A;  1O0X A;  2V6C A;  4U6C A;  4PNC A;  3TAV A;  2Q96 A;  1QZY A;  1XGN A;  2EVO A;  4S2T P;  4EGE A;  3BIP A;  4IDY A;  3MR1 A;  1QXY A;  2BWV A;  1C22 A;  4ZWP A;  1N51 A;  3BIQ A;  1YW8 A;  4U73 A;  3Q6D A;  1WBQ A;  4IKS A;  1C27 A;  4S01 A;  2V3Z A;  4S2R P;  2B3H A;  2BWT A;  4U71 A;  5JFR A;  2B3L A;  2HOW A;  2OKN A;  2GG0 A;  5JHU A;  4U76 A;  1WKM A;  2EVC A;  2BHA A;  2GG7 A;  3D27 A;  2B3K A;  3CTZ A;  4S00 A;  1C23 A;  2EVM A;  4OOK A;  3IG4 A;  4MAT A;  4IKR A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...