4FLKA

Human metap1 with bengamide analog y10, in mn form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4flkA00
5CNXA 1B59A 3MATA 2BB7A 4PV4A 4A6WA 2GG9A 1WL6A 3FMQA 3FMRA 5JHUA 5CLSA 5CE6A 3TB5A 2BN7A 2GU7A 1KQ9A 2BWYA 4IKRA 1W7VA 2EVMA 3MR1A 4FLIA 4IF7A 4OOKA 4RGZ1 2GU5A 1R5HA 2GG8A 1QXZA 2BHBA 2B3KA 4U6EA 1YW8A 4FO8A 1BOAA 4EGEA 5E5BA 4RZYA 4U70A 3PKEA 2B3HA 3Q6DA 4QR8A 1W2MA 4HXXA 1C24A 4FUKA 1C27A 4U69A 3PKBA 2Q94A 1Y1NA 3L24A 1CHMA 3IU9A 4U6CA 2GZ5A 5CDVA 4IU6A 5D6EA 1YW9A 4PNCA 3S6BA 1WL9A 4FLJA 5D6FA 2V3ZA 2GA2A 3BIPA 1C23A 4FLKA 3RORA 4A6VA 4B28A 4IECA 4R60A 4ZWPA 4Z7MA 2Q93A 4U1BA 2GG3A 2B3LA 2Q8KA 2V3XA 2OKNA 1KQ0A 2EVCA 2V3YA 4KM3A 1QXWA 2EA2A 2Q95A 1WY2A 1YVMA 2BWSA 1WLRA 2GGCA 5CDEA 2BHDA 2BHAA 5FCHA 3IU7A 3BITA 4S2TP 1XGMA 1M35A 2NQ7A 4U6ZA 1XGNA 2GU6A 2HOWA 2BWVA 4FO7A 1YJ3A 4MATA 1QXYA 2BWUA 3CTZA 3BIQA 2G6PA 2GTXA 2GG7A 2V6CA 3CB6A 3IG4A 4ZWUA 3RVAA 2P99A 4FKCA 1XNZA 4U75A 2BHCA 1BN5A 5CDLA 1WBQA 1O0XA 2GG2A 4IPAA 2GG5A 2BWWA 2ZSGA 3MX6A 5FCFA 2MATA 1R58A 1C22A 2Q96A 3D27A 4IDYA 3L7GA 1A16A 4S00A 4U6WA 2BH3A 1XGOA 1R5GA 2GG0A 1PV9A 1WKMA 1XGSA 2GGBA 4ZWOA 1N51A 3FM3A 3IU8A 4FLLA 5JFRA 1MATA 2BWTA 4U71A 4U76A 4IKTA 5JI6A 3TAVA 1JAWA 1WN1A 4JUQA 2EA4A 2P9AA 2Q92A 2ADUA 3PKDA 3PKAA 2BWXA 4S2RP 1C21A 4RZZA 1B6AA 2IW2A 2P98A 1KP0A 2DFIA 2OAZA 1QZYA 2NQ6A 3PKCA 3CB5A 5CIKA 4IKUA 2EVOA 2GU4A 4S01A 4U73A 4ZNGA 4IKSA 1YW7A 4U6JA
chains in the Genus database with same CATH superfamily
5CNXA 1B59A 3MATA 2BB7A 4PV4A 4A6WA 2GG9A 1WL6A 3FMQA 3FMRA 5JHUA 5CLSA 5CE6A 3TB5A 2BN7A 2GU7A 1KQ9A 2BWYA 4IKRA 1W7VA 2EVMA 3MR1A 4FLIA 4IF7A 4OOKA 4RGZ1 2GU5A 1R5HA 2GG8A 1QXZA 2BHBA 2B3KA 4U6EA 1YW8A 4FO8A 1BOAA 4EGEA 5E5BA 4RZYA 4U70A 3PKEA 2B3HA 3Q6DA 4QR8A 1W2MA 4HXXA 1C24A 4FUKA 1C27A 4U69A 3PKBA 2Q94A 1Y1NA 3L24A 1CHMA 3IU9A 4U6CA 2GZ5A 5CDVA 4IU6A 5D6EA 1YW9A 4PNCA 3S6BA 1WL9A 4FLJA 5D6FA 2V3ZA 2GA2A 3BIPA 1C23A 4FLKA 3RORA 4A6VA 4B28A 4IECA 4R60A 4ZWPA 4Z7MA 2Q93A 4U1BA 2GG3A 2B3LA 2Q8KA 2V3XA 2OKNA 1KQ0A 2EVCA 2V3YA 4KM3A 1QXWA 2EA2A 2Q95A 1WY2A 1YVMA 2BWSA 1WLRA 2GGCA 5CDEA 2BHDA 2BHAA 5FCHA 3IU7A 3BITA 4S2TP 1XGMA 1M35A 2NQ7A 4U6ZA 1XGNA 2GU6A 2HOWA 2BWVA 4FO7A 1YJ3A 4MATA 1QXYA 2BWUA 3CTZA 3BIQA 2G6PA 2GTXA 2GG7A 2V6CA 3CB6A 3IG4A 4ZWUA 3RVAA 2P99A 4FKCA 1XNZA 4U75A 2BHCA 1BN5A 5CDLA 1WBQA 1O0XA 2GG2A 4IPAA 2GG5A 2BWWA 2ZSGA 3MX6A 5FCFA 2MATA 1R58A 1C22A 2Q96A 3D27A 4IDYA 3L7GA 1A16A 4S00A 4U6WA 2BH3A 1XGOA 1R5GA 2GG0A 1PV9A 1WKMA 1XGSA 2GGBA 4ZWOA 1N51A 3FM3A 3IU8A 4FLLA 5JFRA 1MATA 2BWTA 4U71A 4U76A 4IKTA 5JI6A 3TAVA 1JAWA 1WN1A 4JUQA 2EA4A 2P9AA 2Q92A 2ADUA 3PKDA 3PKAA 2BWXA 4S2RP 1C21A 4RZZA 1B6AA 2IW2A 2P98A 1KP0A 2DFIA 2OAZA 1QZYA 2NQ6A 3PKCA 3CB5A 5CIKA 4IKUA 2EVOA 2GU4A 4S01A 4U73A 4ZNGA 4IKSA 1YW7A 4U6JA
chains in the Genus database with same CATH topology
5CNXA 1B59A 3MATA 2BB7A 4PV4A 4A6WA 2GG9A 1WL6A 3FMQA 3FMRA 5JHUA 5CLSA 5CE6A 3TB5A 2BN7A 2GU7A 1KQ9A 2BWYA 4IKRA 1W7VA 2EVMA 3MR1A 4FLIA 4IF7A 4OOKA 4RGZ1 2GU5A 1R5HA 2GG8A 1QXZA 2BHBA 2B3KA 4U6EA 1YW8A 4FO8A 1BOAA 4EGEA 5E5BA 4RZYA 4U70A 3PKEA 2B3HA 3Q6DA 4QR8A 1W2MA 4HXXA 1C24A 4FUKA 1C27A 4U69A 3PKBA 2Q94A 1Y1NA 3L24A 1CHMA 3IU9A 4U6CA 2GZ5A 5CDVA 4IU6A 5D6EA 1YW9A 4PNCA 3S6BA 1WL9A 4FLJA 5D6FA 2V3ZA 2GA2A 3BIPA 1C23A 4FLKA 3RORA 4A6VA 4B28A 4IECA 4R60A 4ZWPA 4Z7MA 2Q93A 4U1BA 2GG3A 2B3LA 2Q8KA 2V3XA 2OKNA 1KQ0A 2EVCA 2V3YA 4KM3A 1QXWA 2EA2A 2Q95A 1WY2A 1YVMA 2BWSA 1WLRA 2GGCA 5CDEA 2BHDA 2BHAA 5FCHA 3IU7A 3BITA 4S2TP 1XGMA 1M35A 2NQ7A 4U6ZA 1XGNA 2GU6A 2HOWA 2BWVA 4FO7A 1YJ3A 4MATA 1QXYA 2BWUA 3CTZA 3BIQA 2G6PA 2GTXA 2GG7A 2V6CA 3CB6A 3IG4A 4ZWUA 3RVAA 2P99A 4FKCA 1XNZA 4U75A 2BHCA 1BN5A 5CDLA 1WBQA 1O0XA 2GG2A 4IPAA 2GG5A 2BWWA 2ZSGA 3MX6A 5FCFA 2MATA 1R58A 1C22A 2Q96A 3D27A 4IDYA 3L7GA 1A16A 4S00A 4U6WA 2BH3A 1XGOA 1R5GA 2GG0A 1PV9A 1WKMA 1XGSA 2GGBA 4ZWOA 1N51A 3FM3A 3IU8A 4FLLA 5JFRA 1MATA 2BWTA 4U71A 4U76A 4IKTA 5JI6A 3TAVA 1JAWA 1WN1A 4JUQA 2EA4A 2P9AA 2Q92A 2ADUA 3PKDA 3PKAA 2BWXA 4S2RP 1C21A 4RZZA 1B6AA 2IW2A 2P98A 1KP0A 2DFIA 2OAZA 1QZYA 2NQ6A 3PKCA 3CB5A 5CIKA 4IKUA 2EVOA 2GU4A 4S01A 4U73A 4ZNGA 4IKSA 1YW7A 4U6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNX A;  1B59 A;  3MAT A;  2BB7 A;  4PV4 A;  4A6W A;  2GG9 A;  1WL6 A;  3FMQ A;  3FMR A;  5JHU A;  5CLS A;  5CE6 A;  3TB5 A;  2BN7 A;  2GU7 A;  1KQ9 A;  2BWY A;  4IKR A;  1W7V A;  2EVM A;  3MR1 A;  4FLI A;  4IF7 A;  4OOK A;  4RGZ 1;  2GU5 A;  1R5H A;  2GG8 A;  1QXZ A;  2BHB A;  2B3K A;  4U6E A;  1YW8 A;  4FO8 A;  1BOA A;  4EGE A;  5E5B A;  4RZY A;  4U70 A;  3PKE A;  2B3H A;  3Q6D A;  4QR8 A;  1W2M A;  4HXX A;  1C24 A;  4FUK A;  1C27 A;  4U69 A;  3PKB A;  2Q94 A;  1Y1N A;  3L24 A;  1CHM A;  3IU9 A;  4U6C A;  2GZ5 A;  5CDV A;  4IU6 A;  5D6E A;  1YW9 A;  4PNC A;  3S6B A;  1WL9 A;  4FLJ A;  5D6F A;  2V3Z A;  2GA2 A;  3BIP A;  1C23 A;  4FLK A;  3ROR A;  4A6V A;  4B28 A;  4IEC A;  4R60 A;  4ZWP A;  4Z7M A;  2Q93 A;  4U1B A;  2GG3 A;  2B3L A;  2Q8K A;  2V3X A;  2OKN A;  1KQ0 A;  2EVC A;  2V3Y A;  4KM3 A;  1QXW A;  2EA2 A;  2Q95 A;  1WY2 A;  1YVM A;  2BWS A;  1WLR A;  2GGC A;  5CDE A;  2BHD A;  2BHA A;  5FCH A;  3IU7 A;  3BIT A;  4S2T P;  1XGM A;  1M35 A;  2NQ7 A;  4U6Z A;  1XGN A;  2GU6 A;  2HOW A;  2BWV A;  4FO7 A;  1YJ3 A;  4MAT A;  1QXY A;  2BWU A;  3CTZ A;  3BIQ A;  2G6P A;  2GTX A;  2GG7 A;  2V6C A;  3CB6 A;  3IG4 A;  4ZWU A;  3RVA A;  2P99 A;  4FKC A;  1XNZ A;  4U75 A;  2BHC A;  1BN5 A;  5CDL A;  1WBQ A;  1O0X A;  2GG2 A;  4IPA A;  2GG5 A;  2BWW A;  2ZSG A;  3MX6 A;  5FCF A;  2MAT A;  1R58 A;  1C22 A;  2Q96 A;  3D27 A;  4IDY A;  3L7G A;  1A16 A;  4S00 A;  4U6W A;  2BH3 A;  1XGO A;  1R5G A;  2GG0 A;  1PV9 A;  1WKM A;  1XGS A;  2GGB A;  4ZWO A;  1N51 A;  3FM3 A;  3IU8 A;  4FLL A;  5JFR A;  1MAT A;  2BWT A;  4U71 A;  4U76 A;  4IKT A;  5JI6 A;  3TAV A;  1JAW A;  1WN1 A;  4JUQ A;  2EA4 A;  2P9A A;  2Q92 A;  2ADU A;  3PKD A;  3PKA A;  2BWX A;  4S2R P;  1C21 A;  4RZZ A;  1B6A A;  2IW2 A;  2P98 A;  1KP0 A;  2DFI A;  2OAZ A;  1QZY A;  2NQ6 A;  3PKC A;  3CB5 A;  5CIK A;  4IKU A;  2EVO A;  2GU4 A;  4S01 A;  4U73 A;  4ZNG A;  4IKS A;  1YW7 A;  4U6J A; 
#chains in the Genus database with same CATH topology
 5CNX A;  1B59 A;  3MAT A;  2BB7 A;  4PV4 A;  4A6W A;  2GG9 A;  1WL6 A;  3FMQ A;  3FMR A;  5JHU A;  5CLS A;  5CE6 A;  3TB5 A;  2BN7 A;  2GU7 A;  1KQ9 A;  2BWY A;  4IKR A;  1W7V A;  2EVM A;  3MR1 A;  4FLI A;  4IF7 A;  4OOK A;  4RGZ 1;  2GU5 A;  1R5H A;  2GG8 A;  1QXZ A;  2BHB A;  2B3K A;  4U6E A;  1YW8 A;  4FO8 A;  1BOA A;  4EGE A;  5E5B A;  4RZY A;  4U70 A;  3PKE A;  2B3H A;  3Q6D A;  4QR8 A;  1W2M A;  4HXX A;  1C24 A;  4FUK A;  1C27 A;  4U69 A;  3PKB A;  2Q94 A;  1Y1N A;  3L24 A;  1CHM A;  3IU9 A;  4U6C A;  2GZ5 A;  5CDV A;  4IU6 A;  5D6E A;  1YW9 A;  4PNC A;  3S6B A;  1WL9 A;  4FLJ A;  5D6F A;  2V3Z A;  2GA2 A;  3BIP A;  1C23 A;  4FLK A;  3ROR A;  4A6V A;  4B28 A;  4IEC A;  4R60 A;  4ZWP A;  4Z7M A;  2Q93 A;  4U1B A;  2GG3 A;  2B3L A;  2Q8K A;  2V3X A;  2OKN A;  1KQ0 A;  2EVC A;  2V3Y A;  4KM3 A;  1QXW A;  2EA2 A;  2Q95 A;  1WY2 A;  1YVM A;  2BWS A;  1WLR A;  2GGC A;  5CDE A;  2BHD A;  2BHA A;  5FCH A;  3IU7 A;  3BIT A;  4S2T P;  1XGM A;  1M35 A;  2NQ7 A;  4U6Z A;  1XGN A;  2GU6 A;  2HOW A;  2BWV A;  4FO7 A;  1YJ3 A;  4MAT A;  1QXY A;  2BWU A;  3CTZ A;  3BIQ A;  2G6P A;  2GTX A;  2GG7 A;  2V6C A;  3CB6 A;  3IG4 A;  4ZWU A;  3RVA A;  2P99 A;  4FKC A;  1XNZ A;  4U75 A;  2BHC A;  1BN5 A;  5CDL A;  1WBQ A;  1O0X A;  2GG2 A;  4IPA A;  2GG5 A;  2BWW A;  2ZSG A;  3MX6 A;  5FCF A;  2MAT A;  1R58 A;  1C22 A;  2Q96 A;  3D27 A;  4IDY A;  3L7G A;  1A16 A;  4S00 A;  4U6W A;  2BH3 A;  1XGO A;  1R5G A;  2GG0 A;  1PV9 A;  1WKM A;  1XGS A;  2GGB A;  4ZWO A;  1N51 A;  3FM3 A;  3IU8 A;  4FLL A;  5JFR A;  1MAT A;  2BWT A;  4U71 A;  4U76 A;  4IKT A;  5JI6 A;  3TAV A;  1JAW A;  1WN1 A;  4JUQ A;  2EA4 A;  2P9A A;  2Q92 A;  2ADU A;  3PKD A;  3PKA A;  2BWX A;  4S2R P;  1C21 A;  4RZZ A;  1B6A A;  2IW2 A;  2P98 A;  1KP0 A;  2DFI A;  2OAZ A;  1QZY A;  2NQ6 A;  3PKC A;  3CB5 A;  5CIK A;  4IKU A;  2EVO A;  2GU4 A;  4S01 A;  4U73 A;  4ZNG A;  4IKS A;  1YW7 A;  4U6J A; 
#chains in the Genus database with same CATH homology
 5CNX A;  1B59 A;  3MAT A;  2BB7 A;  4PV4 A;  4A6W A;  2GG9 A;  1WL6 A;  3FMQ A;  3FMR A;  5JHU A;  5CLS A;  5CE6 A;  3TB5 A;  2BN7 A;  2GU7 A;  1KQ9 A;  2BWY A;  4IKR A;  1W7V A;  2EVM A;  3MR1 A;  4FLI A;  4IF7 A;  4OOK A;  4RGZ 1;  2GU5 A;  1R5H A;  2GG8 A;  1QXZ A;  2BHB A;  2B3K A;  4U6E A;  1YW8 A;  4FO8 A;  1BOA A;  4EGE A;  5E5B A;  4RZY A;  4U70 A;  3PKE A;  2B3H A;  3Q6D A;  4QR8 A;  1W2M A;  4HXX A;  1C24 A;  4FUK A;  1C27 A;  4U69 A;  3PKB A;  2Q94 A;  1Y1N A;  3L24 A;  1CHM A;  3IU9 A;  4U6C A;  2GZ5 A;  5CDV A;  4IU6 A;  5D6E A;  1YW9 A;  4PNC A;  3S6B A;  1WL9 A;  4FLJ A;  5D6F A;  2V3Z A;  2GA2 A;  3BIP A;  1C23 A;  4FLK A;  3ROR A;  4A6V A;  4B28 A;  4IEC A;  4R60 A;  4ZWP A;  4Z7M A;  2Q93 A;  4U1B A;  2GG3 A;  2B3L A;  2Q8K A;  2V3X A;  2OKN A;  1KQ0 A;  2EVC A;  2V3Y A;  4KM3 A;  1QXW A;  2EA2 A;  2Q95 A;  1WY2 A;  1YVM A;  2BWS A;  1WLR A;  2GGC A;  5CDE A;  2BHD A;  2BHA A;  5FCH A;  3IU7 A;  3BIT A;  4S2T P;  1XGM A;  1M35 A;  2NQ7 A;  4U6Z A;  1XGN A;  2GU6 A;  2HOW A;  2BWV A;  4FO7 A;  1YJ3 A;  4MAT A;  1QXY A;  2BWU A;  3CTZ A;  3BIQ A;  2G6P A;  2GTX A;  2GG7 A;  2V6C A;  3CB6 A;  3IG4 A;  4ZWU A;  3RVA A;  2P99 A;  4FKC A;  1XNZ A;  4U75 A;  2BHC A;  1BN5 A;  5CDL A;  1WBQ A;  1O0X A;  2GG2 A;  4IPA A;  2GG5 A;  2BWW A;  2ZSG A;  3MX6 A;  5FCF A;  2MAT A;  1R58 A;  1C22 A;  2Q96 A;  3D27 A;  4IDY A;  3L7G A;  1A16 A;  4S00 A;  4U6W A;  2BH3 A;  1XGO A;  1R5G A;  2GG0 A;  1PV9 A;  1WKM A;  1XGS A;  2GGB A;  4ZWO A;  1N51 A;  3FM3 A;  3IU8 A;  4FLL A;  5JFR A;  1MAT A;  2BWT A;  4U71 A;  4U76 A;  4IKT A;  5JI6 A;  3TAV A;  1JAW A;  1WN1 A;  4JUQ A;  2EA4 A;  2P9A A;  2Q92 A;  2ADU A;  3PKD A;  3PKA A;  2BWX A;  4S2R P;  1C21 A;  4RZZ A;  1B6A A;  2IW2 A;  2P98 A;  1KP0 A;  2DFI A;  2OAZ A;  1QZY A;  2NQ6 A;  3PKC A;  3CB5 A;  5CIK A;  4IKU A;  2EVO A;  2GU4 A;  4S01 A;  4U73 A;  4ZNG A;  4IKS A;  1YW7 A;  4U6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...