4FLKA

Human metap1 with bengamide analog y10, in mn form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4flkA00
1C23A 5E5BA 3FMRA 2NQ6A 1C22A 1Y1NA 2GG3A 3BIPA 5FCFA 2BWWA 4B28A 1B6AA 2B3LA 1B59A 1YJ3A 4IDYA 1C21A 1BN5A 2BWYA 4A6WA 4S00A 2Q95A 4IKSA 3L24A 4JUQA 1QZYA 1XGSA 1O0XA 2GG5A 3D27A 1XGMA 2BWSA 4IKRA 4ZWUA 1A16A 2BN7A 2BWVA 2GZ5A 4FO7A 3PKAA 1YVMA 2V3YA 2NQ7A 3PKEA 4FKCA 4FLIA 3BITA 2GG2A 2V3ZA 4U73A 2BWUA 4U6CA 5JFRA 3BIQA 2BHDA 4FUKA 4PV4A 3FMQA 4FO8A 4HXXA 3CTZA 1WLRA 4EGEA 4U70A 3L7GA 1QXWA 1R58A 2HOWA 4R60A 4U71A 4OOKA 1M35A 4IKUA 4A6VA 1N51A 5CLSA 2DFIA 1BOAA 4FLKA 4IECA 1QXYA 4PNCA 3MX6A 5CDEA 1XGNA 2GU5A 4Z7MA 1JAWA 2GG7A 3PKDA 3TB5A 4QR8A 4S2TP 2BWXA 1KQ0A 4ZWOA 1WL6A 2GG9A 1KP0A 3CB6A 2Q96A 3MR1A 4IKTA 2ADUA 3RORA 4U1BA 2EVOA 3TAVA 2P98A 1YW7A 1R5HA 3IU9A 4U6JA 4ZWPA 1WY2A 2GGCA 1YW9A 3MATA 3RVAA 4U69A 2Q93A 2P9AA 4U76A 2GTXA 4ZNGA 5CIKA 3PKBA 2GU4A 4RGZ1 2OKNA 3IU7A 5CNXA 5JI6A 3IU8A 1MATA 2GGBA 2BHAA 4U6EA 1KQ9A 4IU6A 2OAZA 2V6CA 1QXZA 2BHBA 3CB5A 4RZZA 1YW8A 2Q92A 4IF7A 2BB7A 1C27A 2EVMA 4U6WA 3S6BA 1CHMA 2V3XA 2B3KA 4RZYA 4S2RP 1WBQA 2BH3A 3Q6DA 2GU6A 5D6EA 2GA2A 4KM3A 1R5GA 2IW2A 5FCHA 4FLJA 5CDLA 2GU7A 5CE6A 1WKMA 2P99A 2BWTA 2ZSGA 4U6ZA 1C24A 4IPAA 2G6PA 1PV9A 4U75A 2BHCA 2GG8A 3FM3A 5CDVA 2GG0A 5JHUA 1W2MA 1WL9A 2EVCA 2Q94A 2MATA 3IG4A 2EA2A 4FLLA 1WN1A 1XGOA 2EA4A 5D6FA 3PKCA 2B3HA 4MATA 1XNZA 2Q8KA 4S01A 1W7VA
chains in the Genus database with same CATH superfamily
1C23A 5E5BA 3FMRA 2NQ6A 1C22A 1Y1NA 2GG3A 3BIPA 5FCFA 2BWWA 4B28A 1B6AA 2B3LA 1B59A 1YJ3A 4IDYA 1C21A 1BN5A 2BWYA 4A6WA 4S00A 2Q95A 4IKSA 3L24A 4JUQA 1QZYA 1XGSA 1O0XA 2GG5A 3D27A 1XGMA 2BWSA 4IKRA 4ZWUA 1A16A 2BN7A 2BWVA 2GZ5A 4FO7A 3PKAA 1YVMA 2V3YA 2NQ7A 3PKEA 4FKCA 4FLIA 3BITA 2GG2A 2V3ZA 4U73A 2BWUA 4U6CA 5JFRA 3BIQA 2BHDA 4FUKA 4PV4A 3FMQA 4FO8A 4HXXA 3CTZA 1WLRA 4EGEA 4U70A 3L7GA 1QXWA 1R58A 2HOWA 4R60A 4U71A 4OOKA 1M35A 4IKUA 4A6VA 1N51A 5CLSA 2DFIA 1BOAA 4FLKA 4IECA 1QXYA 4PNCA 3MX6A 5CDEA 1XGNA 2GU5A 4Z7MA 1JAWA 2GG7A 3PKDA 3TB5A 4QR8A 4S2TP 2BWXA 1KQ0A 4ZWOA 1WL6A 2GG9A 1KP0A 3CB6A 2Q96A 3MR1A 4IKTA 2ADUA 3RORA 4U1BA 2EVOA 3TAVA 2P98A 1YW7A 1R5HA 3IU9A 4U6JA 4ZWPA 1WY2A 2GGCA 1YW9A 3MATA 3RVAA 4U69A 2Q93A 2P9AA 4U76A 2GTXA 4ZNGA 5CIKA 3PKBA 2GU4A 4RGZ1 2OKNA 3IU7A 5CNXA 5JI6A 3IU8A 1MATA 2GGBA 2BHAA 4U6EA 1KQ9A 4IU6A 2OAZA 2V6CA 1QXZA 2BHBA 3CB5A 4RZZA 1YW8A 2Q92A 4IF7A 2BB7A 1C27A 2EVMA 4U6WA 3S6BA 1CHMA 2V3XA 2B3KA 4RZYA 4S2RP 1WBQA 2BH3A 3Q6DA 2GU6A 5D6EA 2GA2A 4KM3A 1R5GA 2IW2A 5FCHA 4FLJA 5CDLA 2GU7A 5CE6A 1WKMA 2P99A 2BWTA 2ZSGA 4U6ZA 1C24A 4IPAA 2G6PA 1PV9A 4U75A 2BHCA 2GG8A 3FM3A 5CDVA 2GG0A 5JHUA 1W2MA 1WL9A 2EVCA 2Q94A 2MATA 3IG4A 2EA2A 4FLLA 1WN1A 1XGOA 2EA4A 5D6FA 3PKCA 2B3HA 4MATA 1XNZA 2Q8KA 4S01A 1W7VA
chains in the Genus database with same CATH topology
1C23A 5E5BA 3FMRA 2NQ6A 1C22A 1Y1NA 2GG3A 3BIPA 5FCFA 2BWWA 4B28A 1B6AA 2B3LA 1B59A 1YJ3A 4IDYA 1C21A 1BN5A 2BWYA 4A6WA 4S00A 2Q95A 4IKSA 3L24A 4JUQA 1QZYA 1XGSA 1O0XA 2GG5A 3D27A 1XGMA 2BWSA 4IKRA 4ZWUA 1A16A 2BN7A 2BWVA 2GZ5A 4FO7A 3PKAA 1YVMA 2V3YA 2NQ7A 3PKEA 4FKCA 4FLIA 3BITA 2GG2A 2V3ZA 4U73A 2BWUA 4U6CA 5JFRA 3BIQA 2BHDA 4FUKA 4PV4A 3FMQA 4FO8A 4HXXA 3CTZA 1WLRA 4EGEA 4U70A 3L7GA 1QXWA 1R58A 2HOWA 4R60A 4U71A 4OOKA 1M35A 4IKUA 4A6VA 1N51A 5CLSA 2DFIA 1BOAA 4FLKA 4IECA 1QXYA 4PNCA 3MX6A 5CDEA 1XGNA 2GU5A 4Z7MA 1JAWA 2GG7A 3PKDA 3TB5A 4QR8A 4S2TP 2BWXA 1KQ0A 4ZWOA 1WL6A 2GG9A 1KP0A 3CB6A 2Q96A 3MR1A 4IKTA 2ADUA 3RORA 4U1BA 2EVOA 3TAVA 2P98A 1YW7A 1R5HA 3IU9A 4U6JA 4ZWPA 1WY2A 2GGCA 1YW9A 3MATA 3RVAA 4U69A 2Q93A 2P9AA 4U76A 2GTXA 4ZNGA 5CIKA 3PKBA 2GU4A 4RGZ1 2OKNA 3IU7A 5CNXA 5JI6A 3IU8A 1MATA 2GGBA 2BHAA 4U6EA 1KQ9A 4IU6A 2OAZA 2V6CA 1QXZA 2BHBA 3CB5A 4RZZA 1YW8A 2Q92A 4IF7A 2BB7A 1C27A 2EVMA 4U6WA 3S6BA 1CHMA 2V3XA 2B3KA 4RZYA 4S2RP 1WBQA 2BH3A 3Q6DA 2GU6A 5D6EA 2GA2A 4KM3A 1R5GA 2IW2A 5FCHA 4FLJA 5CDLA 2GU7A 5CE6A 1WKMA 2P99A 2BWTA 2ZSGA 4U6ZA 1C24A 4IPAA 2G6PA 1PV9A 4U75A 2BHCA 2GG8A 3FM3A 5CDVA 2GG0A 5JHUA 1W2MA 1WL9A 2EVCA 2Q94A 2MATA 3IG4A 2EA2A 4FLLA 1WN1A 1XGOA 2EA4A 5D6FA 3PKCA 2B3HA 4MATA 1XNZA 2Q8KA 4S01A 1W7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C23 A;  5E5B A;  3FMR A;  2NQ6 A;  1C22 A;  1Y1N A;  2GG3 A;  3BIP A;  5FCF A;  2BWW A;  4B28 A;  1B6A A;  2B3L A;  1B59 A;  1YJ3 A;  4IDY A;  1C21 A;  1BN5 A;  2BWY A;  4A6W A;  4S00 A;  2Q95 A;  4IKS A;  3L24 A;  4JUQ A;  1QZY A;  1XGS A;  1O0X A;  2GG5 A;  3D27 A;  1XGM A;  2BWS A;  4IKR A;  4ZWU A;  1A16 A;  2BN7 A;  2BWV A;  2GZ5 A;  4FO7 A;  3PKA A;  1YVM A;  2V3Y A;  2NQ7 A;  3PKE A;  4FKC A;  4FLI A;  3BIT A;  2GG2 A;  2V3Z A;  4U73 A;  2BWU A;  4U6C A;  5JFR A;  3BIQ A;  2BHD A;  4FUK A;  4PV4 A;  3FMQ A;  4FO8 A;  4HXX A;  3CTZ A;  1WLR A;  4EGE A;  4U70 A;  3L7G A;  1QXW A;  1R58 A;  2HOW A;  4R60 A;  4U71 A;  4OOK A;  1M35 A;  4IKU A;  4A6V A;  1N51 A;  5CLS A;  2DFI A;  1BOA A;  4FLK A;  4IEC A;  1QXY A;  4PNC A;  3MX6 A;  5CDE A;  1XGN A;  2GU5 A;  4Z7M A;  1JAW A;  2GG7 A;  3PKD A;  3TB5 A;  4QR8 A;  4S2T P;  2BWX A;  1KQ0 A;  4ZWO A;  1WL6 A;  2GG9 A;  1KP0 A;  3CB6 A;  2Q96 A;  3MR1 A;  4IKT A;  2ADU A;  3ROR A;  4U1B A;  2EVO A;  3TAV A;  2P98 A;  1YW7 A;  1R5H A;  3IU9 A;  4U6J A;  4ZWP A;  1WY2 A;  2GGC A;  1YW9 A;  3MAT A;  3RVA A;  4U69 A;  2Q93 A;  2P9A A;  4U76 A;  2GTX A;  4ZNG A;  5CIK A;  3PKB A;  2GU4 A;  4RGZ 1;  2OKN A;  3IU7 A;  5CNX A;  5JI6 A;  3IU8 A;  1MAT A;  2GGB A;  2BHA A;  4U6E A;  1KQ9 A;  4IU6 A;  2OAZ A;  2V6C A;  1QXZ A;  2BHB A;  3CB5 A;  4RZZ A;  1YW8 A;  2Q92 A;  4IF7 A;  2BB7 A;  1C27 A;  2EVM A;  4U6W A;  3S6B A;  1CHM A;  2V3X A;  2B3K A;  4RZY A;  4S2R P;  1WBQ A;  2BH3 A;  3Q6D A;  2GU6 A;  5D6E A;  2GA2 A;  4KM3 A;  1R5G A;  2IW2 A;  5FCH A;  4FLJ A;  5CDL A;  2GU7 A;  5CE6 A;  1WKM A;  2P99 A;  2BWT A;  2ZSG A;  4U6Z A;  1C24 A;  4IPA A;  2G6P A;  1PV9 A;  4U75 A;  2BHC A;  2GG8 A;  3FM3 A;  5CDV A;  2GG0 A;  5JHU A;  1W2M A;  1WL9 A;  2EVC A;  2Q94 A;  2MAT A;  3IG4 A;  2EA2 A;  4FLL A;  1WN1 A;  1XGO A;  2EA4 A;  5D6F A;  3PKC A;  2B3H A;  4MAT A;  1XNZ A;  2Q8K A;  4S01 A;  1W7V A; 
#chains in the Genus database with same CATH topology
 1C23 A;  5E5B A;  3FMR A;  2NQ6 A;  1C22 A;  1Y1N A;  2GG3 A;  3BIP A;  5FCF A;  2BWW A;  4B28 A;  1B6A A;  2B3L A;  1B59 A;  1YJ3 A;  4IDY A;  1C21 A;  1BN5 A;  2BWY A;  4A6W A;  4S00 A;  2Q95 A;  4IKS A;  3L24 A;  4JUQ A;  1QZY A;  1XGS A;  1O0X A;  2GG5 A;  3D27 A;  1XGM A;  2BWS A;  4IKR A;  4ZWU A;  1A16 A;  2BN7 A;  2BWV A;  2GZ5 A;  4FO7 A;  3PKA A;  1YVM A;  2V3Y A;  2NQ7 A;  3PKE A;  4FKC A;  4FLI A;  3BIT A;  2GG2 A;  2V3Z A;  4U73 A;  2BWU A;  4U6C A;  5JFR A;  3BIQ A;  2BHD A;  4FUK A;  4PV4 A;  3FMQ A;  4FO8 A;  4HXX A;  3CTZ A;  1WLR A;  4EGE A;  4U70 A;  3L7G A;  1QXW A;  1R58 A;  2HOW A;  4R60 A;  4U71 A;  4OOK A;  1M35 A;  4IKU A;  4A6V A;  1N51 A;  5CLS A;  2DFI A;  1BOA A;  4FLK A;  4IEC A;  1QXY A;  4PNC A;  3MX6 A;  5CDE A;  1XGN A;  2GU5 A;  4Z7M A;  1JAW A;  2GG7 A;  3PKD A;  3TB5 A;  4QR8 A;  4S2T P;  2BWX A;  1KQ0 A;  4ZWO A;  1WL6 A;  2GG9 A;  1KP0 A;  3CB6 A;  2Q96 A;  3MR1 A;  4IKT A;  2ADU A;  3ROR A;  4U1B A;  2EVO A;  3TAV A;  2P98 A;  1YW7 A;  1R5H A;  3IU9 A;  4U6J A;  4ZWP A;  1WY2 A;  2GGC A;  1YW9 A;  3MAT A;  3RVA A;  4U69 A;  2Q93 A;  2P9A A;  4U76 A;  2GTX A;  4ZNG A;  5CIK A;  3PKB A;  2GU4 A;  4RGZ 1;  2OKN A;  3IU7 A;  5CNX A;  5JI6 A;  3IU8 A;  1MAT A;  2GGB A;  2BHA A;  4U6E A;  1KQ9 A;  4IU6 A;  2OAZ A;  2V6C A;  1QXZ A;  2BHB A;  3CB5 A;  4RZZ A;  1YW8 A;  2Q92 A;  4IF7 A;  2BB7 A;  1C27 A;  2EVM A;  4U6W A;  3S6B A;  1CHM A;  2V3X A;  2B3K A;  4RZY A;  4S2R P;  1WBQ A;  2BH3 A;  3Q6D A;  2GU6 A;  5D6E A;  2GA2 A;  4KM3 A;  1R5G A;  2IW2 A;  5FCH A;  4FLJ A;  5CDL A;  2GU7 A;  5CE6 A;  1WKM A;  2P99 A;  2BWT A;  2ZSG A;  4U6Z A;  1C24 A;  4IPA A;  2G6P A;  1PV9 A;  4U75 A;  2BHC A;  2GG8 A;  3FM3 A;  5CDV A;  2GG0 A;  5JHU A;  1W2M A;  1WL9 A;  2EVC A;  2Q94 A;  2MAT A;  3IG4 A;  2EA2 A;  4FLL A;  1WN1 A;  1XGO A;  2EA4 A;  5D6F A;  3PKC A;  2B3H A;  4MAT A;  1XNZ A;  2Q8K A;  4S01 A;  1W7V A; 
#chains in the Genus database with same CATH homology
 1C23 A;  5E5B A;  3FMR A;  2NQ6 A;  1C22 A;  1Y1N A;  2GG3 A;  3BIP A;  5FCF A;  2BWW A;  4B28 A;  1B6A A;  2B3L A;  1B59 A;  1YJ3 A;  4IDY A;  1C21 A;  1BN5 A;  2BWY A;  4A6W A;  4S00 A;  2Q95 A;  4IKS A;  3L24 A;  4JUQ A;  1QZY A;  1XGS A;  1O0X A;  2GG5 A;  3D27 A;  1XGM A;  2BWS A;  4IKR A;  4ZWU A;  1A16 A;  2BN7 A;  2BWV A;  2GZ5 A;  4FO7 A;  3PKA A;  1YVM A;  2V3Y A;  2NQ7 A;  3PKE A;  4FKC A;  4FLI A;  3BIT A;  2GG2 A;  2V3Z A;  4U73 A;  2BWU A;  4U6C A;  5JFR A;  3BIQ A;  2BHD A;  4FUK A;  4PV4 A;  3FMQ A;  4FO8 A;  4HXX A;  3CTZ A;  1WLR A;  4EGE A;  4U70 A;  3L7G A;  1QXW A;  1R58 A;  2HOW A;  4R60 A;  4U71 A;  4OOK A;  1M35 A;  4IKU A;  4A6V A;  1N51 A;  5CLS A;  2DFI A;  1BOA A;  4FLK A;  4IEC A;  1QXY A;  4PNC A;  3MX6 A;  5CDE A;  1XGN A;  2GU5 A;  4Z7M A;  1JAW A;  2GG7 A;  3PKD A;  3TB5 A;  4QR8 A;  4S2T P;  2BWX A;  1KQ0 A;  4ZWO A;  1WL6 A;  2GG9 A;  1KP0 A;  3CB6 A;  2Q96 A;  3MR1 A;  4IKT A;  2ADU A;  3ROR A;  4U1B A;  2EVO A;  3TAV A;  2P98 A;  1YW7 A;  1R5H A;  3IU9 A;  4U6J A;  4ZWP A;  1WY2 A;  2GGC A;  1YW9 A;  3MAT A;  3RVA A;  4U69 A;  2Q93 A;  2P9A A;  4U76 A;  2GTX A;  4ZNG A;  5CIK A;  3PKB A;  2GU4 A;  4RGZ 1;  2OKN A;  3IU7 A;  5CNX A;  5JI6 A;  3IU8 A;  1MAT A;  2GGB A;  2BHA A;  4U6E A;  1KQ9 A;  4IU6 A;  2OAZ A;  2V6C A;  1QXZ A;  2BHB A;  3CB5 A;  4RZZ A;  1YW8 A;  2Q92 A;  4IF7 A;  2BB7 A;  1C27 A;  2EVM A;  4U6W A;  3S6B A;  1CHM A;  2V3X A;  2B3K A;  4RZY A;  4S2R P;  1WBQ A;  2BH3 A;  3Q6D A;  2GU6 A;  5D6E A;  2GA2 A;  4KM3 A;  1R5G A;  2IW2 A;  5FCH A;  4FLJ A;  5CDL A;  2GU7 A;  5CE6 A;  1WKM A;  2P99 A;  2BWT A;  2ZSG A;  4U6Z A;  1C24 A;  4IPA A;  2G6P A;  1PV9 A;  4U75 A;  2BHC A;  2GG8 A;  3FM3 A;  5CDV A;  2GG0 A;  5JHU A;  1W2M A;  1WL9 A;  2EVC A;  2Q94 A;  2MAT A;  3IG4 A;  2EA2 A;  4FLL A;  1WN1 A;  1XGO A;  2EA4 A;  5D6F A;  3PKC A;  2B3H A;  4MAT A;  1XNZ A;  2Q8K A;  4S01 A;  1W7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...