4FLKA

Human metap1 with bengamide analog y10, in mn form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4flkA00
2V3ZA 1O0XA 2GA2A 1A16A 1R58A 3CTZA 4IDYA 1XGSA 5JHUA 4ZWOA 2BWTA 4KM3A 3D27A 4S01A 2Q93A 4JUQA 3CB5A 3PKCA 4PNCA 4IKRA 1XGMA 5CDVA 3L24A 3TAVA 4IF7A 4U6ZA 4FUKA 1W7VA 4U6WA 1R5GA 4IPAA 2NQ7A 4S2TP 1C24A 1KP0A 1WKMA 2GG5A 4U76A 3IG4A 1XGNA 2V3YA 2BN7A 4U70A 5CNXA 1WL9A 5JI6A 4HXXA 2OAZA 4FLLA 4IKUA 4A6WA 4FO8A 4FLKA 1QZYA 2Q94A 1B6AA 4U6JA 5CIKA 1N51A 1YW8A 5E5BA 2OKNA 3PKAA 4IKTA 2V3XA 4MATA 2P98A 3BIPA 3IU9A 4IU6A 5D6FA 4U69A 5JFRA 2HOWA 1B59A 2B3LA 1QXZA 2BHAA 2BWSA 5CE6A 4RZYA 4QR8A 5CDLA 2NQ6A 2Q95A 4FO7A 1BN5A 4U6CA 2IW2A 1M35A 5CDEA 4ZNGA 2BWYA 5D6EA 1WN1A 3FMRA 4ZWPA 5FCHA 3S6BA 2GG9A 2P99A 2BHDA 4B28A 2GU5A 1C21A 1KQ9A 2EA4A 2GU6A 4U6EA 3FM3A 2GZ5A 2MATA 3FMQA 1W2MA 4S00A 2GU7A 4RZZA 2BHCA 2BWUA 3MR1A 2GG0A 2Q92A 4RGZ1 4OOKA 4PV4A 2P9AA 2BWVA 1WY2A 4FKCA 1XNZA 5FCFA 2BWXA 1R5HA 3TB5A 2GGBA 1BOAA 2ADUA 1PV9A 3RORA 1YW9A 3IU8A 1YVMA 2B3HA 2EA2A 2Q8KA 3PKEA 3RVAA 1JAWA 2B3KA 3PKBA 1XGOA 2Q96A 2DFIA 4U1BA 3L7GA 1YJ3A 2GG2A 5CLSA 2GGCA 1QXWA 2EVMA 1WBQA 3BITA 4FLIA 1QXYA 4Z7MA 4U75A 2BWWA 4IECA 3MX6A 1MATA 4S2RP 2BB7A 4EGEA 4U71A 1WLRA 1C23A 1C27A 2EVCA 2GTXA 2BHBA 2ZSGA 1WL6A 2GU4A 4FLJA 3Q6DA 2V6CA 3BIQA 2GG8A 3CB6A 4R60A 2BH3A 1KQ0A 2GG7A 1C22A 1YW7A 1CHMA 2GG3A 4U73A 4IKSA 3PKDA 4ZWUA 2EVOA 2G6PA 4A6VA 3MATA 1Y1NA 3IU7A
chains in the Genus database with same CATH superfamily
2V3ZA 1O0XA 2GA2A 1A16A 1R58A 3CTZA 4IDYA 1XGSA 5JHUA 4ZWOA 2BWTA 4KM3A 3D27A 4S01A 2Q93A 4JUQA 3CB5A 3PKCA 4PNCA 4IKRA 1XGMA 5CDVA 3L24A 3TAVA 4IF7A 4U6ZA 4FUKA 1W7VA 4U6WA 1R5GA 4IPAA 2NQ7A 4S2TP 1C24A 1KP0A 1WKMA 2GG5A 4U76A 3IG4A 1XGNA 2V3YA 2BN7A 4U70A 5CNXA 1WL9A 5JI6A 4HXXA 2OAZA 4FLLA 4IKUA 4A6WA 4FO8A 4FLKA 1QZYA 2Q94A 1B6AA 4U6JA 5CIKA 1N51A 1YW8A 5E5BA 2OKNA 3PKAA 4IKTA 2V3XA 4MATA 2P98A 3BIPA 3IU9A 4IU6A 5D6FA 4U69A 5JFRA 2HOWA 1B59A 2B3LA 1QXZA 2BHAA 2BWSA 5CE6A 4RZYA 4QR8A 5CDLA 2NQ6A 2Q95A 4FO7A 1BN5A 4U6CA 2IW2A 1M35A 5CDEA 4ZNGA 2BWYA 5D6EA 1WN1A 3FMRA 4ZWPA 5FCHA 3S6BA 2GG9A 2P99A 2BHDA 4B28A 2GU5A 1C21A 1KQ9A 2EA4A 2GU6A 4U6EA 3FM3A 2GZ5A 2MATA 3FMQA 1W2MA 4S00A 2GU7A 4RZZA 2BHCA 2BWUA 3MR1A 2GG0A 2Q92A 4RGZ1 4OOKA 4PV4A 2P9AA 2BWVA 1WY2A 4FKCA 1XNZA 5FCFA 2BWXA 1R5HA 3TB5A 2GGBA 1BOAA 2ADUA 1PV9A 3RORA 1YW9A 3IU8A 1YVMA 2B3HA 2EA2A 2Q8KA 3PKEA 3RVAA 1JAWA 2B3KA 3PKBA 1XGOA 2Q96A 2DFIA 4U1BA 3L7GA 1YJ3A 2GG2A 5CLSA 2GGCA 1QXWA 2EVMA 1WBQA 3BITA 4FLIA 1QXYA 4Z7MA 4U75A 2BWWA 4IECA 3MX6A 1MATA 4S2RP 2BB7A 4EGEA 4U71A 1WLRA 1C23A 1C27A 2EVCA 2GTXA 2BHBA 2ZSGA 1WL6A 2GU4A 4FLJA 3Q6DA 2V6CA 3BIQA 2GG8A 3CB6A 4R60A 2BH3A 1KQ0A 2GG7A 1C22A 1YW7A 1CHMA 2GG3A 4U73A 4IKSA 3PKDA 4ZWUA 2EVOA 2G6PA 4A6VA 3MATA 1Y1NA 3IU7A
chains in the Genus database with same CATH topology
2V3ZA 1O0XA 2GA2A 1A16A 1R58A 3CTZA 4IDYA 1XGSA 5JHUA 4ZWOA 2BWTA 4KM3A 3D27A 4S01A 2Q93A 4JUQA 3CB5A 3PKCA 4PNCA 4IKRA 1XGMA 5CDVA 3L24A 3TAVA 4IF7A 4U6ZA 4FUKA 1W7VA 4U6WA 1R5GA 4IPAA 2NQ7A 4S2TP 1C24A 1KP0A 1WKMA 2GG5A 4U76A 3IG4A 1XGNA 2V3YA 2BN7A 4U70A 5CNXA 1WL9A 5JI6A 4HXXA 2OAZA 4FLLA 4IKUA 4A6WA 4FO8A 4FLKA 1QZYA 2Q94A 1B6AA 4U6JA 5CIKA 1N51A 1YW8A 5E5BA 2OKNA 3PKAA 4IKTA 2V3XA 4MATA 2P98A 3BIPA 3IU9A 4IU6A 5D6FA 4U69A 5JFRA 2HOWA 1B59A 2B3LA 1QXZA 2BHAA 2BWSA 5CE6A 4RZYA 4QR8A 5CDLA 2NQ6A 2Q95A 4FO7A 1BN5A 4U6CA 2IW2A 1M35A 5CDEA 4ZNGA 2BWYA 5D6EA 1WN1A 3FMRA 4ZWPA 5FCHA 3S6BA 2GG9A 2P99A 2BHDA 4B28A 2GU5A 1C21A 1KQ9A 2EA4A 2GU6A 4U6EA 3FM3A 2GZ5A 2MATA 3FMQA 1W2MA 4S00A 2GU7A 4RZZA 2BHCA 2BWUA 3MR1A 2GG0A 2Q92A 4RGZ1 4OOKA 4PV4A 2P9AA 2BWVA 1WY2A 4FKCA 1XNZA 5FCFA 2BWXA 1R5HA 3TB5A 2GGBA 1BOAA 2ADUA 1PV9A 3RORA 1YW9A 3IU8A 1YVMA 2B3HA 2EA2A 2Q8KA 3PKEA 3RVAA 1JAWA 2B3KA 3PKBA 1XGOA 2Q96A 2DFIA 4U1BA 3L7GA 1YJ3A 2GG2A 5CLSA 2GGCA 1QXWA 2EVMA 1WBQA 3BITA 4FLIA 1QXYA 4Z7MA 4U75A 2BWWA 4IECA 3MX6A 1MATA 4S2RP 2BB7A 4EGEA 4U71A 1WLRA 1C23A 1C27A 2EVCA 2GTXA 2BHBA 2ZSGA 1WL6A 2GU4A 4FLJA 3Q6DA 2V6CA 3BIQA 2GG8A 3CB6A 4R60A 2BH3A 1KQ0A 2GG7A 1C22A 1YW7A 1CHMA 2GG3A 4U73A 4IKSA 3PKDA 4ZWUA 2EVOA 2G6PA 4A6VA 3MATA 1Y1NA 3IU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3Z A;  1O0X A;  2GA2 A;  1A16 A;  1R58 A;  3CTZ A;  4IDY A;  1XGS A;  5JHU A;  4ZWO A;  2BWT A;  4KM3 A;  3D27 A;  4S01 A;  2Q93 A;  4JUQ A;  3CB5 A;  3PKC A;  4PNC A;  4IKR A;  1XGM A;  5CDV A;  3L24 A;  3TAV A;  4IF7 A;  4U6Z A;  4FUK A;  1W7V A;  4U6W A;  1R5G A;  4IPA A;  2NQ7 A;  4S2T P;  1C24 A;  1KP0 A;  1WKM A;  2GG5 A;  4U76 A;  3IG4 A;  1XGN A;  2V3Y A;  2BN7 A;  4U70 A;  5CNX A;  1WL9 A;  5JI6 A;  4HXX A;  2OAZ A;  4FLL A;  4IKU A;  4A6W A;  4FO8 A;  4FLK A;  1QZY A;  2Q94 A;  1B6A A;  4U6J A;  5CIK A;  1N51 A;  1YW8 A;  5E5B A;  2OKN A;  3PKA A;  4IKT A;  2V3X A;  4MAT A;  2P98 A;  3BIP A;  3IU9 A;  4IU6 A;  5D6F A;  4U69 A;  5JFR A;  2HOW A;  1B59 A;  2B3L A;  1QXZ A;  2BHA A;  2BWS A;  5CE6 A;  4RZY A;  4QR8 A;  5CDL A;  2NQ6 A;  2Q95 A;  4FO7 A;  1BN5 A;  4U6C A;  2IW2 A;  1M35 A;  5CDE A;  4ZNG A;  2BWY A;  5D6E A;  1WN1 A;  3FMR A;  4ZWP A;  5FCH A;  3S6B A;  2GG9 A;  2P99 A;  2BHD A;  4B28 A;  2GU5 A;  1C21 A;  1KQ9 A;  2EA4 A;  2GU6 A;  4U6E A;  3FM3 A;  2GZ5 A;  2MAT A;  3FMQ A;  1W2M A;  4S00 A;  2GU7 A;  4RZZ A;  2BHC A;  2BWU A;  3MR1 A;  2GG0 A;  2Q92 A;  4RGZ 1;  4OOK A;  4PV4 A;  2P9A A;  2BWV A;  1WY2 A;  4FKC A;  1XNZ A;  5FCF A;  2BWX A;  1R5H A;  3TB5 A;  2GGB A;  1BOA A;  2ADU A;  1PV9 A;  3ROR A;  1YW9 A;  3IU8 A;  1YVM A;  2B3H A;  2EA2 A;  2Q8K A;  3PKE A;  3RVA A;  1JAW A;  2B3K A;  3PKB A;  1XGO A;  2Q96 A;  2DFI A;  4U1B A;  3L7G A;  1YJ3 A;  2GG2 A;  5CLS A;  2GGC A;  1QXW A;  2EVM A;  1WBQ A;  3BIT A;  4FLI A;  1QXY A;  4Z7M A;  4U75 A;  2BWW A;  4IEC A;  3MX6 A;  1MAT A;  4S2R P;  2BB7 A;  4EGE A;  4U71 A;  1WLR A;  1C23 A;  1C27 A;  2EVC A;  2GTX A;  2BHB A;  2ZSG A;  1WL6 A;  2GU4 A;  4FLJ A;  3Q6D A;  2V6C A;  3BIQ A;  2GG8 A;  3CB6 A;  4R60 A;  2BH3 A;  1KQ0 A;  2GG7 A;  1C22 A;  1YW7 A;  1CHM A;  2GG3 A;  4U73 A;  4IKS A;  3PKD A;  4ZWU A;  2EVO A;  2G6P A;  4A6V A;  3MAT A;  1Y1N A;  3IU7 A; 
#chains in the Genus database with same CATH topology
 2V3Z A;  1O0X A;  2GA2 A;  1A16 A;  1R58 A;  3CTZ A;  4IDY A;  1XGS A;  5JHU A;  4ZWO A;  2BWT A;  4KM3 A;  3D27 A;  4S01 A;  2Q93 A;  4JUQ A;  3CB5 A;  3PKC A;  4PNC A;  4IKR A;  1XGM A;  5CDV A;  3L24 A;  3TAV A;  4IF7 A;  4U6Z A;  4FUK A;  1W7V A;  4U6W A;  1R5G A;  4IPA A;  2NQ7 A;  4S2T P;  1C24 A;  1KP0 A;  1WKM A;  2GG5 A;  4U76 A;  3IG4 A;  1XGN A;  2V3Y A;  2BN7 A;  4U70 A;  5CNX A;  1WL9 A;  5JI6 A;  4HXX A;  2OAZ A;  4FLL A;  4IKU A;  4A6W A;  4FO8 A;  4FLK A;  1QZY A;  2Q94 A;  1B6A A;  4U6J A;  5CIK A;  1N51 A;  1YW8 A;  5E5B A;  2OKN A;  3PKA A;  4IKT A;  2V3X A;  4MAT A;  2P98 A;  3BIP A;  3IU9 A;  4IU6 A;  5D6F A;  4U69 A;  5JFR A;  2HOW A;  1B59 A;  2B3L A;  1QXZ A;  2BHA A;  2BWS A;  5CE6 A;  4RZY A;  4QR8 A;  5CDL A;  2NQ6 A;  2Q95 A;  4FO7 A;  1BN5 A;  4U6C A;  2IW2 A;  1M35 A;  5CDE A;  4ZNG A;  2BWY A;  5D6E A;  1WN1 A;  3FMR A;  4ZWP A;  5FCH A;  3S6B A;  2GG9 A;  2P99 A;  2BHD A;  4B28 A;  2GU5 A;  1C21 A;  1KQ9 A;  2EA4 A;  2GU6 A;  4U6E A;  3FM3 A;  2GZ5 A;  2MAT A;  3FMQ A;  1W2M A;  4S00 A;  2GU7 A;  4RZZ A;  2BHC A;  2BWU A;  3MR1 A;  2GG0 A;  2Q92 A;  4RGZ 1;  4OOK A;  4PV4 A;  2P9A A;  2BWV A;  1WY2 A;  4FKC A;  1XNZ A;  5FCF A;  2BWX A;  1R5H A;  3TB5 A;  2GGB A;  1BOA A;  2ADU A;  1PV9 A;  3ROR A;  1YW9 A;  3IU8 A;  1YVM A;  2B3H A;  2EA2 A;  2Q8K A;  3PKE A;  3RVA A;  1JAW A;  2B3K A;  3PKB A;  1XGO A;  2Q96 A;  2DFI A;  4U1B A;  3L7G A;  1YJ3 A;  2GG2 A;  5CLS A;  2GGC A;  1QXW A;  2EVM A;  1WBQ A;  3BIT A;  4FLI A;  1QXY A;  4Z7M A;  4U75 A;  2BWW A;  4IEC A;  3MX6 A;  1MAT A;  4S2R P;  2BB7 A;  4EGE A;  4U71 A;  1WLR A;  1C23 A;  1C27 A;  2EVC A;  2GTX A;  2BHB A;  2ZSG A;  1WL6 A;  2GU4 A;  4FLJ A;  3Q6D A;  2V6C A;  3BIQ A;  2GG8 A;  3CB6 A;  4R60 A;  2BH3 A;  1KQ0 A;  2GG7 A;  1C22 A;  1YW7 A;  1CHM A;  2GG3 A;  4U73 A;  4IKS A;  3PKD A;  4ZWU A;  2EVO A;  2G6P A;  4A6V A;  3MAT A;  1Y1N A;  3IU7 A; 
#chains in the Genus database with same CATH homology
 2V3Z A;  1O0X A;  2GA2 A;  1A16 A;  1R58 A;  3CTZ A;  4IDY A;  1XGS A;  5JHU A;  4ZWO A;  2BWT A;  4KM3 A;  3D27 A;  4S01 A;  2Q93 A;  4JUQ A;  3CB5 A;  3PKC A;  4PNC A;  4IKR A;  1XGM A;  5CDV A;  3L24 A;  3TAV A;  4IF7 A;  4U6Z A;  4FUK A;  1W7V A;  4U6W A;  1R5G A;  4IPA A;  2NQ7 A;  4S2T P;  1C24 A;  1KP0 A;  1WKM A;  2GG5 A;  4U76 A;  3IG4 A;  1XGN A;  2V3Y A;  2BN7 A;  4U70 A;  5CNX A;  1WL9 A;  5JI6 A;  4HXX A;  2OAZ A;  4FLL A;  4IKU A;  4A6W A;  4FO8 A;  4FLK A;  1QZY A;  2Q94 A;  1B6A A;  4U6J A;  5CIK A;  1N51 A;  1YW8 A;  5E5B A;  2OKN A;  3PKA A;  4IKT A;  2V3X A;  4MAT A;  2P98 A;  3BIP A;  3IU9 A;  4IU6 A;  5D6F A;  4U69 A;  5JFR A;  2HOW A;  1B59 A;  2B3L A;  1QXZ A;  2BHA A;  2BWS A;  5CE6 A;  4RZY A;  4QR8 A;  5CDL A;  2NQ6 A;  2Q95 A;  4FO7 A;  1BN5 A;  4U6C A;  2IW2 A;  1M35 A;  5CDE A;  4ZNG A;  2BWY A;  5D6E A;  1WN1 A;  3FMR A;  4ZWP A;  5FCH A;  3S6B A;  2GG9 A;  2P99 A;  2BHD A;  4B28 A;  2GU5 A;  1C21 A;  1KQ9 A;  2EA4 A;  2GU6 A;  4U6E A;  3FM3 A;  2GZ5 A;  2MAT A;  3FMQ A;  1W2M A;  4S00 A;  2GU7 A;  4RZZ A;  2BHC A;  2BWU A;  3MR1 A;  2GG0 A;  2Q92 A;  4RGZ 1;  4OOK A;  4PV4 A;  2P9A A;  2BWV A;  1WY2 A;  4FKC A;  1XNZ A;  5FCF A;  2BWX A;  1R5H A;  3TB5 A;  2GGB A;  1BOA A;  2ADU A;  1PV9 A;  3ROR A;  1YW9 A;  3IU8 A;  1YVM A;  2B3H A;  2EA2 A;  2Q8K A;  3PKE A;  3RVA A;  1JAW A;  2B3K A;  3PKB A;  1XGO A;  2Q96 A;  2DFI A;  4U1B A;  3L7G A;  1YJ3 A;  2GG2 A;  5CLS A;  2GGC A;  1QXW A;  2EVM A;  1WBQ A;  3BIT A;  4FLI A;  1QXY A;  4Z7M A;  4U75 A;  2BWW A;  4IEC A;  3MX6 A;  1MAT A;  4S2R P;  2BB7 A;  4EGE A;  4U71 A;  1WLR A;  1C23 A;  1C27 A;  2EVC A;  2GTX A;  2BHB A;  2ZSG A;  1WL6 A;  2GU4 A;  4FLJ A;  3Q6D A;  2V6C A;  3BIQ A;  2GG8 A;  3CB6 A;  4R60 A;  2BH3 A;  1KQ0 A;  2GG7 A;  1C22 A;  1YW7 A;  1CHM A;  2GG3 A;  4U73 A;  4IKS A;  3PKD A;  4ZWU A;  2EVO A;  2G6P A;  4A6V A;  3MAT A;  1Y1N A;  3IU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...