4FLKA

Human metap1 with bengamide analog y10, in mn form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4flkA00
5CDLA 4FLLA 3BITA 4ZNGA 1YW7A 5JFRA 4S2RP 3CB5A 4ZWPA 2GG9A 2GU5A 2BB7A 2V3XA 1QXWA 2V3YA 5CLSA 2ADUA 4A6WA 3IU8A 1C27A 1PV9A 3MATA 1A16A 4FLIA 1WBQA 1QZYA 2P99A 3FM3A 4OOKA 2GU4A 2BWXA 2BWUA 2DFIA 4U69A 1QXYA 4IKRA 5CDVA 2Q95A 1JAWA 1WKMA 2BWSA 4U6CA 2BWVA 1C21A 2Q92A 1B59A 2MATA 3D27A 3FMQA 4S2TP 3PKEA 1MATA 1R58A 1YJ3A 1BN5A 1O0XA 3IU7A 2IW2A 1B6AA 4PV4A 2BHCA 2EVOA 2GA2A 4U1BA 4FLKA 1YW9A 2GGCA 3L7GA 4IECA 2BHDA 4RGZ1 1C24A 2G6PA 1WY2A 2P9AA 4IKUA 1KQ9A 1YW8A 3MX6A 4JUQA 2GZ5A 3RORA 4HXXA 1KQ0A 2GU7A 4RZZA 4RZYA 3S6BA 3RVAA 5D6EA 2B3HA 4IF7A 2HOWA 2EVMA 4IKSA 1W2MA 2BHAA 2OKNA 4MATA 4U6EA 3TB5A 4U71A 1R5GA 2GGBA 1XGOA 4EGEA 1KP0A 4QR8A 4S01A 2BH3A 2B3KA 1CHMA 1XNZA 4FKCA 3MR1A 4U75A 4A6VA 1R5HA 2GG2A 3IG4A 2GG7A 4U6ZA 2GG0A 5CIKA 2GU6A 4B28A 3PKBA 2NQ7A 2GG3A 1WL9A 2NQ6A 5FCFA 3IU9A 3FMRA 2BN7A 3CTZA 4IDYA 4U6JA 4IKTA 5CE6A 3CB6A 5CDEA 3BIQA 4ZWOA 2Q8KA 3PKAA 2P98A 2BHBA 4R60A 2EVCA 5E5BA 1WLRA 2B3LA 3BIPA 5D6FA 3L24A 4U6WA 4IPAA 4KM3A 4U73A 3PKCA 5CNXA 2BWTA 1WN1A 1C22A 4PNCA 4FUKA 2OAZA 2ZSGA 4U76A 4S00A 1Y1NA 4FLJA 4ZWUA 1XGNA 4Z7MA 5JHUA 2EA4A 2BWYA 3PKDA 1M35A 1QXZA 1WL6A 4FO7A 2GTXA 5JI6A 1N51A 2Q96A 1XGMA 1W7VA 2EA2A 2Q94A 1BOAA 4FO8A 4U70A 2V3ZA 1XGSA 4IU6A 3TAVA 2GG5A 5FCHA 3Q6DA 2BWWA 1C23A 2V6CA 1YVMA 2GG8A 2Q93A
chains in the Genus database with same CATH superfamily
5CDLA 4FLLA 3BITA 4ZNGA 1YW7A 5JFRA 4S2RP 3CB5A 4ZWPA 2GG9A 2GU5A 2BB7A 2V3XA 1QXWA 2V3YA 5CLSA 2ADUA 4A6WA 3IU8A 1C27A 1PV9A 3MATA 1A16A 4FLIA 1WBQA 1QZYA 2P99A 3FM3A 4OOKA 2GU4A 2BWXA 2BWUA 2DFIA 4U69A 1QXYA 4IKRA 5CDVA 2Q95A 1JAWA 1WKMA 2BWSA 4U6CA 2BWVA 1C21A 2Q92A 1B59A 2MATA 3D27A 3FMQA 4S2TP 3PKEA 1MATA 1R58A 1YJ3A 1BN5A 1O0XA 3IU7A 2IW2A 1B6AA 4PV4A 2BHCA 2EVOA 2GA2A 4U1BA 4FLKA 1YW9A 2GGCA 3L7GA 4IECA 2BHDA 4RGZ1 1C24A 2G6PA 1WY2A 2P9AA 4IKUA 1KQ9A 1YW8A 3MX6A 4JUQA 2GZ5A 3RORA 4HXXA 1KQ0A 2GU7A 4RZZA 4RZYA 3S6BA 3RVAA 5D6EA 2B3HA 4IF7A 2HOWA 2EVMA 4IKSA 1W2MA 2BHAA 2OKNA 4MATA 4U6EA 3TB5A 4U71A 1R5GA 2GGBA 1XGOA 4EGEA 1KP0A 4QR8A 4S01A 2BH3A 2B3KA 1CHMA 1XNZA 4FKCA 3MR1A 4U75A 4A6VA 1R5HA 2GG2A 3IG4A 2GG7A 4U6ZA 2GG0A 5CIKA 2GU6A 4B28A 3PKBA 2NQ7A 2GG3A 1WL9A 2NQ6A 5FCFA 3IU9A 3FMRA 2BN7A 3CTZA 4IDYA 4U6JA 4IKTA 5CE6A 3CB6A 5CDEA 3BIQA 4ZWOA 2Q8KA 3PKAA 2P98A 2BHBA 4R60A 2EVCA 5E5BA 1WLRA 2B3LA 3BIPA 5D6FA 3L24A 4U6WA 4IPAA 4KM3A 4U73A 3PKCA 5CNXA 2BWTA 1WN1A 1C22A 4PNCA 4FUKA 2OAZA 2ZSGA 4U76A 4S00A 1Y1NA 4FLJA 4ZWUA 1XGNA 4Z7MA 5JHUA 2EA4A 2BWYA 3PKDA 1M35A 1QXZA 1WL6A 4FO7A 2GTXA 5JI6A 1N51A 2Q96A 1XGMA 1W7VA 2EA2A 2Q94A 1BOAA 4FO8A 4U70A 2V3ZA 1XGSA 4IU6A 3TAVA 2GG5A 5FCHA 3Q6DA 2BWWA 1C23A 2V6CA 1YVMA 2GG8A 2Q93A
chains in the Genus database with same CATH topology
5CDLA 4FLLA 3BITA 4ZNGA 1YW7A 5JFRA 4S2RP 3CB5A 4ZWPA 2GG9A 2GU5A 2BB7A 2V3XA 1QXWA 2V3YA 5CLSA 2ADUA 4A6WA 3IU8A 1C27A 1PV9A 3MATA 1A16A 4FLIA 1WBQA 1QZYA 2P99A 3FM3A 4OOKA 2GU4A 2BWXA 2BWUA 2DFIA 4U69A 1QXYA 4IKRA 5CDVA 2Q95A 1JAWA 1WKMA 2BWSA 4U6CA 2BWVA 1C21A 2Q92A 1B59A 2MATA 3D27A 3FMQA 4S2TP 3PKEA 1MATA 1R58A 1YJ3A 1BN5A 1O0XA 3IU7A 2IW2A 1B6AA 4PV4A 2BHCA 2EVOA 2GA2A 4U1BA 4FLKA 1YW9A 2GGCA 3L7GA 4IECA 2BHDA 4RGZ1 1C24A 2G6PA 1WY2A 2P9AA 4IKUA 1KQ9A 1YW8A 3MX6A 4JUQA 2GZ5A 3RORA 4HXXA 1KQ0A 2GU7A 4RZZA 4RZYA 3S6BA 3RVAA 5D6EA 2B3HA 4IF7A 2HOWA 2EVMA 4IKSA 1W2MA 2BHAA 2OKNA 4MATA 4U6EA 3TB5A 4U71A 1R5GA 2GGBA 1XGOA 4EGEA 1KP0A 4QR8A 4S01A 2BH3A 2B3KA 1CHMA 1XNZA 4FKCA 3MR1A 4U75A 4A6VA 1R5HA 2GG2A 3IG4A 2GG7A 4U6ZA 2GG0A 5CIKA 2GU6A 4B28A 3PKBA 2NQ7A 2GG3A 1WL9A 2NQ6A 5FCFA 3IU9A 3FMRA 2BN7A 3CTZA 4IDYA 4U6JA 4IKTA 5CE6A 3CB6A 5CDEA 3BIQA 4ZWOA 2Q8KA 3PKAA 2P98A 2BHBA 4R60A 2EVCA 5E5BA 1WLRA 2B3LA 3BIPA 5D6FA 3L24A 4U6WA 4IPAA 4KM3A 4U73A 3PKCA 5CNXA 2BWTA 1WN1A 1C22A 4PNCA 4FUKA 2OAZA 2ZSGA 4U76A 4S00A 1Y1NA 4FLJA 4ZWUA 1XGNA 4Z7MA 5JHUA 2EA4A 2BWYA 3PKDA 1M35A 1QXZA 1WL6A 4FO7A 2GTXA 5JI6A 1N51A 2Q96A 1XGMA 1W7VA 2EA2A 2Q94A 1BOAA 4FO8A 4U70A 2V3ZA 1XGSA 4IU6A 3TAVA 2GG5A 5FCHA 3Q6DA 2BWWA 1C23A 2V6CA 1YVMA 2GG8A 2Q93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CDL A;  4FLL A;  3BIT A;  4ZNG A;  1YW7 A;  5JFR A;  4S2R P;  3CB5 A;  4ZWP A;  2GG9 A;  2GU5 A;  2BB7 A;  2V3X A;  1QXW A;  2V3Y A;  5CLS A;  2ADU A;  4A6W A;  3IU8 A;  1C27 A;  1PV9 A;  3MAT A;  1A16 A;  4FLI A;  1WBQ A;  1QZY A;  2P99 A;  3FM3 A;  4OOK A;  2GU4 A;  2BWX A;  2BWU A;  2DFI A;  4U69 A;  1QXY A;  4IKR A;  5CDV A;  2Q95 A;  1JAW A;  1WKM A;  2BWS A;  4U6C A;  2BWV A;  1C21 A;  2Q92 A;  1B59 A;  2MAT A;  3D27 A;  3FMQ A;  4S2T P;  3PKE A;  1MAT A;  1R58 A;  1YJ3 A;  1BN5 A;  1O0X A;  3IU7 A;  2IW2 A;  1B6A A;  4PV4 A;  2BHC A;  2EVO A;  2GA2 A;  4U1B A;  4FLK A;  1YW9 A;  2GGC A;  3L7G A;  4IEC A;  2BHD A;  4RGZ 1;  1C24 A;  2G6P A;  1WY2 A;  2P9A A;  4IKU A;  1KQ9 A;  1YW8 A;  3MX6 A;  4JUQ A;  2GZ5 A;  3ROR A;  4HXX A;  1KQ0 A;  2GU7 A;  4RZZ A;  4RZY A;  3S6B A;  3RVA A;  5D6E A;  2B3H A;  4IF7 A;  2HOW A;  2EVM A;  4IKS A;  1W2M A;  2BHA A;  2OKN A;  4MAT A;  4U6E A;  3TB5 A;  4U71 A;  1R5G A;  2GGB A;  1XGO A;  4EGE A;  1KP0 A;  4QR8 A;  4S01 A;  2BH3 A;  2B3K A;  1CHM A;  1XNZ A;  4FKC A;  3MR1 A;  4U75 A;  4A6V A;  1R5H A;  2GG2 A;  3IG4 A;  2GG7 A;  4U6Z A;  2GG0 A;  5CIK A;  2GU6 A;  4B28 A;  3PKB A;  2NQ7 A;  2GG3 A;  1WL9 A;  2NQ6 A;  5FCF A;  3IU9 A;  3FMR A;  2BN7 A;  3CTZ A;  4IDY A;  4U6J A;  4IKT A;  5CE6 A;  3CB6 A;  5CDE A;  3BIQ A;  4ZWO A;  2Q8K A;  3PKA A;  2P98 A;  2BHB A;  4R60 A;  2EVC A;  5E5B A;  1WLR A;  2B3L A;  3BIP A;  5D6F A;  3L24 A;  4U6W A;  4IPA A;  4KM3 A;  4U73 A;  3PKC A;  5CNX A;  2BWT A;  1WN1 A;  1C22 A;  4PNC A;  4FUK A;  2OAZ A;  2ZSG A;  4U76 A;  4S00 A;  1Y1N A;  4FLJ A;  4ZWU A;  1XGN A;  4Z7M A;  5JHU A;  2EA4 A;  2BWY A;  3PKD A;  1M35 A;  1QXZ A;  1WL6 A;  4FO7 A;  2GTX A;  5JI6 A;  1N51 A;  2Q96 A;  1XGM A;  1W7V A;  2EA2 A;  2Q94 A;  1BOA A;  4FO8 A;  4U70 A;  2V3Z A;  1XGS A;  4IU6 A;  3TAV A;  2GG5 A;  5FCH A;  3Q6D A;  2BWW A;  1C23 A;  2V6C A;  1YVM A;  2GG8 A;  2Q93 A; 
#chains in the Genus database with same CATH topology
 5CDL A;  4FLL A;  3BIT A;  4ZNG A;  1YW7 A;  5JFR A;  4S2R P;  3CB5 A;  4ZWP A;  2GG9 A;  2GU5 A;  2BB7 A;  2V3X A;  1QXW A;  2V3Y A;  5CLS A;  2ADU A;  4A6W A;  3IU8 A;  1C27 A;  1PV9 A;  3MAT A;  1A16 A;  4FLI A;  1WBQ A;  1QZY A;  2P99 A;  3FM3 A;  4OOK A;  2GU4 A;  2BWX A;  2BWU A;  2DFI A;  4U69 A;  1QXY A;  4IKR A;  5CDV A;  2Q95 A;  1JAW A;  1WKM A;  2BWS A;  4U6C A;  2BWV A;  1C21 A;  2Q92 A;  1B59 A;  2MAT A;  3D27 A;  3FMQ A;  4S2T P;  3PKE A;  1MAT A;  1R58 A;  1YJ3 A;  1BN5 A;  1O0X A;  3IU7 A;  2IW2 A;  1B6A A;  4PV4 A;  2BHC A;  2EVO A;  2GA2 A;  4U1B A;  4FLK A;  1YW9 A;  2GGC A;  3L7G A;  4IEC A;  2BHD A;  4RGZ 1;  1C24 A;  2G6P A;  1WY2 A;  2P9A A;  4IKU A;  1KQ9 A;  1YW8 A;  3MX6 A;  4JUQ A;  2GZ5 A;  3ROR A;  4HXX A;  1KQ0 A;  2GU7 A;  4RZZ A;  4RZY A;  3S6B A;  3RVA A;  5D6E A;  2B3H A;  4IF7 A;  2HOW A;  2EVM A;  4IKS A;  1W2M A;  2BHA A;  2OKN A;  4MAT A;  4U6E A;  3TB5 A;  4U71 A;  1R5G A;  2GGB A;  1XGO A;  4EGE A;  1KP0 A;  4QR8 A;  4S01 A;  2BH3 A;  2B3K A;  1CHM A;  1XNZ A;  4FKC A;  3MR1 A;  4U75 A;  4A6V A;  1R5H A;  2GG2 A;  3IG4 A;  2GG7 A;  4U6Z A;  2GG0 A;  5CIK A;  2GU6 A;  4B28 A;  3PKB A;  2NQ7 A;  2GG3 A;  1WL9 A;  2NQ6 A;  5FCF A;  3IU9 A;  3FMR A;  2BN7 A;  3CTZ A;  4IDY A;  4U6J A;  4IKT A;  5CE6 A;  3CB6 A;  5CDE A;  3BIQ A;  4ZWO A;  2Q8K A;  3PKA A;  2P98 A;  2BHB A;  4R60 A;  2EVC A;  5E5B A;  1WLR A;  2B3L A;  3BIP A;  5D6F A;  3L24 A;  4U6W A;  4IPA A;  4KM3 A;  4U73 A;  3PKC A;  5CNX A;  2BWT A;  1WN1 A;  1C22 A;  4PNC A;  4FUK A;  2OAZ A;  2ZSG A;  4U76 A;  4S00 A;  1Y1N A;  4FLJ A;  4ZWU A;  1XGN A;  4Z7M A;  5JHU A;  2EA4 A;  2BWY A;  3PKD A;  1M35 A;  1QXZ A;  1WL6 A;  4FO7 A;  2GTX A;  5JI6 A;  1N51 A;  2Q96 A;  1XGM A;  1W7V A;  2EA2 A;  2Q94 A;  1BOA A;  4FO8 A;  4U70 A;  2V3Z A;  1XGS A;  4IU6 A;  3TAV A;  2GG5 A;  5FCH A;  3Q6D A;  2BWW A;  1C23 A;  2V6C A;  1YVM A;  2GG8 A;  2Q93 A; 
#chains in the Genus database with same CATH homology
 5CDL A;  4FLL A;  3BIT A;  4ZNG A;  1YW7 A;  5JFR A;  4S2R P;  3CB5 A;  4ZWP A;  2GG9 A;  2GU5 A;  2BB7 A;  2V3X A;  1QXW A;  2V3Y A;  5CLS A;  2ADU A;  4A6W A;  3IU8 A;  1C27 A;  1PV9 A;  3MAT A;  1A16 A;  4FLI A;  1WBQ A;  1QZY A;  2P99 A;  3FM3 A;  4OOK A;  2GU4 A;  2BWX A;  2BWU A;  2DFI A;  4U69 A;  1QXY A;  4IKR A;  5CDV A;  2Q95 A;  1JAW A;  1WKM A;  2BWS A;  4U6C A;  2BWV A;  1C21 A;  2Q92 A;  1B59 A;  2MAT A;  3D27 A;  3FMQ A;  4S2T P;  3PKE A;  1MAT A;  1R58 A;  1YJ3 A;  1BN5 A;  1O0X A;  3IU7 A;  2IW2 A;  1B6A A;  4PV4 A;  2BHC A;  2EVO A;  2GA2 A;  4U1B A;  4FLK A;  1YW9 A;  2GGC A;  3L7G A;  4IEC A;  2BHD A;  4RGZ 1;  1C24 A;  2G6P A;  1WY2 A;  2P9A A;  4IKU A;  1KQ9 A;  1YW8 A;  3MX6 A;  4JUQ A;  2GZ5 A;  3ROR A;  4HXX A;  1KQ0 A;  2GU7 A;  4RZZ A;  4RZY A;  3S6B A;  3RVA A;  5D6E A;  2B3H A;  4IF7 A;  2HOW A;  2EVM A;  4IKS A;  1W2M A;  2BHA A;  2OKN A;  4MAT A;  4U6E A;  3TB5 A;  4U71 A;  1R5G A;  2GGB A;  1XGO A;  4EGE A;  1KP0 A;  4QR8 A;  4S01 A;  2BH3 A;  2B3K A;  1CHM A;  1XNZ A;  4FKC A;  3MR1 A;  4U75 A;  4A6V A;  1R5H A;  2GG2 A;  3IG4 A;  2GG7 A;  4U6Z A;  2GG0 A;  5CIK A;  2GU6 A;  4B28 A;  3PKB A;  2NQ7 A;  2GG3 A;  1WL9 A;  2NQ6 A;  5FCF A;  3IU9 A;  3FMR A;  2BN7 A;  3CTZ A;  4IDY A;  4U6J A;  4IKT A;  5CE6 A;  3CB6 A;  5CDE A;  3BIQ A;  4ZWO A;  2Q8K A;  3PKA A;  2P98 A;  2BHB A;  4R60 A;  2EVC A;  5E5B A;  1WLR A;  2B3L A;  3BIP A;  5D6F A;  3L24 A;  4U6W A;  4IPA A;  4KM3 A;  4U73 A;  3PKC A;  5CNX A;  2BWT A;  1WN1 A;  1C22 A;  4PNC A;  4FUK A;  2OAZ A;  2ZSG A;  4U76 A;  4S00 A;  1Y1N A;  4FLJ A;  4ZWU A;  1XGN A;  4Z7M A;  5JHU A;  2EA4 A;  2BWY A;  3PKD A;  1M35 A;  1QXZ A;  1WL6 A;  4FO7 A;  2GTX A;  5JI6 A;  1N51 A;  2Q96 A;  1XGM A;  1W7V A;  2EA2 A;  2Q94 A;  1BOA A;  4FO8 A;  4U70 A;  2V3Z A;  1XGS A;  4IU6 A;  3TAV A;  2GG5 A;  5FCH A;  3Q6D A;  2BWW A;  1C23 A;  2V6C A;  1YVM A;  2GG8 A;  2Q93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...