2Q93A

E. coli methionine aminopeptidase mn-form with inhibitor b21
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 83
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q93A00
1KQ0A 2BWXA 5CDEA 3PKAA 2P99A 1WKMA 4FLIA 4FUKA 5CDVA 1WL9A 1XGMA 3BIQA 4FO7A 1B59A 2BWVA 2GG7A 4U6EA 3IU8A 3RVAA 2GTXA 4IU6A 2Q8KA 4ZWOA 1MATA 3D27A 3L24A 3MX6A 3CB5A 3BITA 1QXYA 2EA4A 4RZYA 4S2RP 1B6AA 1C21A 4A6VA 4RZZA 3Q6DA 1XGOA 4IKSA 4U6JA 1O0XA 4IECA 1C22A 3PKBA 3BIPA 2BWSA 4U69A 2Q95A 1JAWA 4U70A 2Q94A 2GGBA 2BHDA 2GG3A 3MR1A 4MATA 2BHCA 2GG8A 2G6PA 2GG5A 1R5HA 5CE6A 3MATA 4IKTA 4KM3A 4U75A 1Y1NA 1WL6A 3IG4A 5CNXA 1XNZA 3L7GA 3IU7A 2NQ7A 5D6EA 4HXXA 4U6ZA 1KQ9A 2ZSGA 1YVMA 1R58A 2GU5A 1QXZA 1XGNA 3TB5A 4QR8A 2BWWA 2BHBA 2GGCA 1BOAA 5D6FA 4U76A 1M35A 4B28A 1W2MA 1YW9A 2MATA 2P9AA 2EVMA 4FKCA 4R60A 1C24A 4IDYA 2BWTA 1N51A 2IW2A 1WLRA 4U73A 4U71A 3IU9A 2GG0A 1WN1A 2GA2A 2NQ6A 2V6CA 3PKEA 4ZWUA 1WBQA 2B3KA 3FMRA 4OOKA 4RGZ1 5E5BA 2BWYA 5JFRA 4U1BA 1YW7A 5FCHA 2HOWA 1YW8A 2DFIA 5JHUA 4PNCA 3FMQA 4FO8A 3RORA 4FLLA 3CTZA 1R5GA 3PKCA 2EA2A 2BN7A 4FLJA 4JUQA 1PV9A 4Z7MA 3S6BA 2Q96A 2GU4A 2V3XA 1W7VA 4IPAA 4EGEA 4S00A 3CB6A 5CIKA 4IKUA 2GU6A 1YJ3A 4PV4A 1C27A 1WY2A 4IKRA 4A6WA 2GG9A 3FM3A 1BN5A 4U6CA 2EVCA 5FCFA 4ZNGA 1QXWA 2GZ5A 2Q93A 2BWUA 1XGSA 1QZYA 2EVOA 5JI6A 2P98A 2OKNA 4ZWPA 5CDLA 1KP0A 4IF7A 2GU7A 2BB7A 2BHAA 2Q92A 2ADUA 4S01A 2B3LA 4S2TP 4U6WA 2V3YA 1C23A 4FLKA 2B3HA 2BH3A 3TAVA 2OAZA 3PKDA 2V3ZA 5CLSA 1A16A 2GG2A 1CHMA
chains in the Genus database with same CATH superfamily
1KQ0A 2BWXA 5CDEA 3PKAA 2P99A 1WKMA 4FLIA 4FUKA 5CDVA 1WL9A 1XGMA 3BIQA 4FO7A 1B59A 2BWVA 2GG7A 4U6EA 3IU8A 3RVAA 2GTXA 4IU6A 2Q8KA 4ZWOA 1MATA 3D27A 3L24A 3MX6A 3CB5A 3BITA 1QXYA 2EA4A 4RZYA 4S2RP 1B6AA 1C21A 4A6VA 4RZZA 3Q6DA 1XGOA 4IKSA 4U6JA 1O0XA 4IECA 1C22A 3PKBA 3BIPA 2BWSA 4U69A 2Q95A 1JAWA 4U70A 2Q94A 2GGBA 2BHDA 2GG3A 3MR1A 4MATA 2BHCA 2GG8A 2G6PA 2GG5A 1R5HA 5CE6A 3MATA 4IKTA 4KM3A 4U75A 1Y1NA 1WL6A 3IG4A 5CNXA 1XNZA 3L7GA 3IU7A 2NQ7A 5D6EA 4HXXA 4U6ZA 1KQ9A 2ZSGA 1YVMA 1R58A 2GU5A 1QXZA 1XGNA 3TB5A 4QR8A 2BWWA 2BHBA 2GGCA 1BOAA 5D6FA 4U76A 1M35A 4B28A 1W2MA 1YW9A 2MATA 2P9AA 2EVMA 4FKCA 4R60A 1C24A 4IDYA 2BWTA 1N51A 2IW2A 1WLRA 4U73A 4U71A 3IU9A 2GG0A 1WN1A 2GA2A 2NQ6A 2V6CA 3PKEA 4ZWUA 1WBQA 2B3KA 3FMRA 4OOKA 4RGZ1 5E5BA 2BWYA 5JFRA 4U1BA 1YW7A 5FCHA 2HOWA 1YW8A 2DFIA 5JHUA 4PNCA 3FMQA 4FO8A 3RORA 4FLLA 3CTZA 1R5GA 3PKCA 2EA2A 2BN7A 4FLJA 4JUQA 1PV9A 4Z7MA 3S6BA 2Q96A 2GU4A 2V3XA 1W7VA 4IPAA 4EGEA 4S00A 3CB6A 5CIKA 4IKUA 2GU6A 1YJ3A 4PV4A 1C27A 1WY2A 4IKRA 4A6WA 2GG9A 3FM3A 1BN5A 4U6CA 2EVCA 5FCFA 4ZNGA 1QXWA 2GZ5A 2Q93A 2BWUA 1XGSA 1QZYA 2EVOA 5JI6A 2P98A 2OKNA 4ZWPA 5CDLA 1KP0A 4IF7A 2GU7A 2BB7A 2BHAA 2Q92A 2ADUA 4S01A 2B3LA 4S2TP 4U6WA 2V3YA 1C23A 4FLKA 2B3HA 2BH3A 3TAVA 2OAZA 3PKDA 2V3ZA 5CLSA 1A16A 2GG2A 1CHMA
chains in the Genus database with same CATH topology
1KQ0A 2BWXA 5CDEA 3PKAA 2P99A 1WKMA 4FLIA 4FUKA 5CDVA 1WL9A 1XGMA 3BIQA 4FO7A 1B59A 2BWVA 2GG7A 4U6EA 3IU8A 3RVAA 2GTXA 4IU6A 2Q8KA 4ZWOA 1MATA 3D27A 3L24A 3MX6A 3CB5A 3BITA 1QXYA 2EA4A 4RZYA 4S2RP 1B6AA 1C21A 4A6VA 4RZZA 3Q6DA 1XGOA 4IKSA 4U6JA 1O0XA 4IECA 1C22A 3PKBA 3BIPA 2BWSA 4U69A 2Q95A 1JAWA 4U70A 2Q94A 2GGBA 2BHDA 2GG3A 3MR1A 4MATA 2BHCA 2GG8A 2G6PA 2GG5A 1R5HA 5CE6A 3MATA 4IKTA 4KM3A 4U75A 1Y1NA 1WL6A 3IG4A 5CNXA 1XNZA 3L7GA 3IU7A 2NQ7A 5D6EA 4HXXA 4U6ZA 1KQ9A 2ZSGA 1YVMA 1R58A 2GU5A 1QXZA 1XGNA 3TB5A 4QR8A 2BWWA 2BHBA 2GGCA 1BOAA 5D6FA 4U76A 1M35A 4B28A 1W2MA 1YW9A 2MATA 2P9AA 2EVMA 4FKCA 4R60A 1C24A 4IDYA 2BWTA 1N51A 2IW2A 1WLRA 4U73A 4U71A 3IU9A 2GG0A 1WN1A 2GA2A 2NQ6A 2V6CA 3PKEA 4ZWUA 1WBQA 2B3KA 3FMRA 4OOKA 4RGZ1 5E5BA 2BWYA 5JFRA 4U1BA 1YW7A 5FCHA 2HOWA 1YW8A 2DFIA 5JHUA 4PNCA 3FMQA 4FO8A 3RORA 4FLLA 3CTZA 1R5GA 3PKCA 2EA2A 2BN7A 4FLJA 4JUQA 1PV9A 4Z7MA 3S6BA 2Q96A 2GU4A 2V3XA 1W7VA 4IPAA 4EGEA 4S00A 3CB6A 5CIKA 4IKUA 2GU6A 1YJ3A 4PV4A 1C27A 1WY2A 4IKRA 4A6WA 2GG9A 3FM3A 1BN5A 4U6CA 2EVCA 5FCFA 4ZNGA 1QXWA 2GZ5A 2Q93A 2BWUA 1XGSA 1QZYA 2EVOA 5JI6A 2P98A 2OKNA 4ZWPA 5CDLA 1KP0A 4IF7A 2GU7A 2BB7A 2BHAA 2Q92A 2ADUA 4S01A 2B3LA 4S2TP 4U6WA 2V3YA 1C23A 4FLKA 2B3HA 2BH3A 3TAVA 2OAZA 3PKDA 2V3ZA 5CLSA 1A16A 2GG2A 1CHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ0 A;  2BWX A;  5CDE A;  3PKA A;  2P99 A;  1WKM A;  4FLI A;  4FUK A;  5CDV A;  1WL9 A;  1XGM A;  3BIQ A;  4FO7 A;  1B59 A;  2BWV A;  2GG7 A;  4U6E A;  3IU8 A;  3RVA A;  2GTX A;  4IU6 A;  2Q8K A;  4ZWO A;  1MAT A;  3D27 A;  3L24 A;  3MX6 A;  3CB5 A;  3BIT A;  1QXY A;  2EA4 A;  4RZY A;  4S2R P;  1B6A A;  1C21 A;  4A6V A;  4RZZ A;  3Q6D A;  1XGO A;  4IKS A;  4U6J A;  1O0X A;  4IEC A;  1C22 A;  3PKB A;  3BIP A;  2BWS A;  4U69 A;  2Q95 A;  1JAW A;  4U70 A;  2Q94 A;  2GGB A;  2BHD A;  2GG3 A;  3MR1 A;  4MAT A;  2BHC A;  2GG8 A;  2G6P A;  2GG5 A;  1R5H A;  5CE6 A;  3MAT A;  4IKT A;  4KM3 A;  4U75 A;  1Y1N A;  1WL6 A;  3IG4 A;  5CNX A;  1XNZ A;  3L7G A;  3IU7 A;  2NQ7 A;  5D6E A;  4HXX A;  4U6Z A;  1KQ9 A;  2ZSG A;  1YVM A;  1R58 A;  2GU5 A;  1QXZ A;  1XGN A;  3TB5 A;  4QR8 A;  2BWW A;  2BHB A;  2GGC A;  1BOA A;  5D6F A;  4U76 A;  1M35 A;  4B28 A;  1W2M A;  1YW9 A;  2MAT A;  2P9A A;  2EVM A;  4FKC A;  4R60 A;  1C24 A;  4IDY A;  2BWT A;  1N51 A;  2IW2 A;  1WLR A;  4U73 A;  4U71 A;  3IU9 A;  2GG0 A;  1WN1 A;  2GA2 A;  2NQ6 A;  2V6C A;  3PKE A;  4ZWU A;  1WBQ A;  2B3K A;  3FMR A;  4OOK A;  4RGZ 1;  5E5B A;  2BWY A;  5JFR A;  4U1B A;  1YW7 A;  5FCH A;  2HOW A;  1YW8 A;  2DFI A;  5JHU A;  4PNC A;  3FMQ A;  4FO8 A;  3ROR A;  4FLL A;  3CTZ A;  1R5G A;  3PKC A;  2EA2 A;  2BN7 A;  4FLJ A;  4JUQ A;  1PV9 A;  4Z7M A;  3S6B A;  2Q96 A;  2GU4 A;  2V3X A;  1W7V A;  4IPA A;  4EGE A;  4S00 A;  3CB6 A;  5CIK A;  4IKU A;  2GU6 A;  1YJ3 A;  4PV4 A;  1C27 A;  1WY2 A;  4IKR A;  4A6W A;  2GG9 A;  3FM3 A;  1BN5 A;  4U6C A;  2EVC A;  5FCF A;  4ZNG A;  1QXW A;  2GZ5 A;  2Q93 A;  2BWU A;  1XGS A;  1QZY A;  2EVO A;  5JI6 A;  2P98 A;  2OKN A;  4ZWP A;  5CDL A;  1KP0 A;  4IF7 A;  2GU7 A;  2BB7 A;  2BHA A;  2Q92 A;  2ADU A;  4S01 A;  2B3L A;  4S2T P;  4U6W A;  2V3Y A;  1C23 A;  4FLK A;  2B3H A;  2BH3 A;  3TAV A;  2OAZ A;  3PKD A;  2V3Z A;  5CLS A;  1A16 A;  2GG2 A;  1CHM A; 
#chains in the Genus database with same CATH topology
 1KQ0 A;  2BWX A;  5CDE A;  3PKA A;  2P99 A;  1WKM A;  4FLI A;  4FUK A;  5CDV A;  1WL9 A;  1XGM A;  3BIQ A;  4FO7 A;  1B59 A;  2BWV A;  2GG7 A;  4U6E A;  3IU8 A;  3RVA A;  2GTX A;  4IU6 A;  2Q8K A;  4ZWO A;  1MAT A;  3D27 A;  3L24 A;  3MX6 A;  3CB5 A;  3BIT A;  1QXY A;  2EA4 A;  4RZY A;  4S2R P;  1B6A A;  1C21 A;  4A6V A;  4RZZ A;  3Q6D A;  1XGO A;  4IKS A;  4U6J A;  1O0X A;  4IEC A;  1C22 A;  3PKB A;  3BIP A;  2BWS A;  4U69 A;  2Q95 A;  1JAW A;  4U70 A;  2Q94 A;  2GGB A;  2BHD A;  2GG3 A;  3MR1 A;  4MAT A;  2BHC A;  2GG8 A;  2G6P A;  2GG5 A;  1R5H A;  5CE6 A;  3MAT A;  4IKT A;  4KM3 A;  4U75 A;  1Y1N A;  1WL6 A;  3IG4 A;  5CNX A;  1XNZ A;  3L7G A;  3IU7 A;  2NQ7 A;  5D6E A;  4HXX A;  4U6Z A;  1KQ9 A;  2ZSG A;  1YVM A;  1R58 A;  2GU5 A;  1QXZ A;  1XGN A;  3TB5 A;  4QR8 A;  2BWW A;  2BHB A;  2GGC A;  1BOA A;  5D6F A;  4U76 A;  1M35 A;  4B28 A;  1W2M A;  1YW9 A;  2MAT A;  2P9A A;  2EVM A;  4FKC A;  4R60 A;  1C24 A;  4IDY A;  2BWT A;  1N51 A;  2IW2 A;  1WLR A;  4U73 A;  4U71 A;  3IU9 A;  2GG0 A;  1WN1 A;  2GA2 A;  2NQ6 A;  2V6C A;  3PKE A;  4ZWU A;  1WBQ A;  2B3K A;  3FMR A;  4OOK A;  4RGZ 1;  5E5B A;  2BWY A;  5JFR A;  4U1B A;  1YW7 A;  5FCH A;  2HOW A;  1YW8 A;  2DFI A;  5JHU A;  4PNC A;  3FMQ A;  4FO8 A;  3ROR A;  4FLL A;  3CTZ A;  1R5G A;  3PKC A;  2EA2 A;  2BN7 A;  4FLJ A;  4JUQ A;  1PV9 A;  4Z7M A;  3S6B A;  2Q96 A;  2GU4 A;  2V3X A;  1W7V A;  4IPA A;  4EGE A;  4S00 A;  3CB6 A;  5CIK A;  4IKU A;  2GU6 A;  1YJ3 A;  4PV4 A;  1C27 A;  1WY2 A;  4IKR A;  4A6W A;  2GG9 A;  3FM3 A;  1BN5 A;  4U6C A;  2EVC A;  5FCF A;  4ZNG A;  1QXW A;  2GZ5 A;  2Q93 A;  2BWU A;  1XGS A;  1QZY A;  2EVO A;  5JI6 A;  2P98 A;  2OKN A;  4ZWP A;  5CDL A;  1KP0 A;  4IF7 A;  2GU7 A;  2BB7 A;  2BHA A;  2Q92 A;  2ADU A;  4S01 A;  2B3L A;  4S2T P;  4U6W A;  2V3Y A;  1C23 A;  4FLK A;  2B3H A;  2BH3 A;  3TAV A;  2OAZ A;  3PKD A;  2V3Z A;  5CLS A;  1A16 A;  2GG2 A;  1CHM A; 
#chains in the Genus database with same CATH homology
 1KQ0 A;  2BWX A;  5CDE A;  3PKA A;  2P99 A;  1WKM A;  4FLI A;  4FUK A;  5CDV A;  1WL9 A;  1XGM A;  3BIQ A;  4FO7 A;  1B59 A;  2BWV A;  2GG7 A;  4U6E A;  3IU8 A;  3RVA A;  2GTX A;  4IU6 A;  2Q8K A;  4ZWO A;  1MAT A;  3D27 A;  3L24 A;  3MX6 A;  3CB5 A;  3BIT A;  1QXY A;  2EA4 A;  4RZY A;  4S2R P;  1B6A A;  1C21 A;  4A6V A;  4RZZ A;  3Q6D A;  1XGO A;  4IKS A;  4U6J A;  1O0X A;  4IEC A;  1C22 A;  3PKB A;  3BIP A;  2BWS A;  4U69 A;  2Q95 A;  1JAW A;  4U70 A;  2Q94 A;  2GGB A;  2BHD A;  2GG3 A;  3MR1 A;  4MAT A;  2BHC A;  2GG8 A;  2G6P A;  2GG5 A;  1R5H A;  5CE6 A;  3MAT A;  4IKT A;  4KM3 A;  4U75 A;  1Y1N A;  1WL6 A;  3IG4 A;  5CNX A;  1XNZ A;  3L7G A;  3IU7 A;  2NQ7 A;  5D6E A;  4HXX A;  4U6Z A;  1KQ9 A;  2ZSG A;  1YVM A;  1R58 A;  2GU5 A;  1QXZ A;  1XGN A;  3TB5 A;  4QR8 A;  2BWW A;  2BHB A;  2GGC A;  1BOA A;  5D6F A;  4U76 A;  1M35 A;  4B28 A;  1W2M A;  1YW9 A;  2MAT A;  2P9A A;  2EVM A;  4FKC A;  4R60 A;  1C24 A;  4IDY A;  2BWT A;  1N51 A;  2IW2 A;  1WLR A;  4U73 A;  4U71 A;  3IU9 A;  2GG0 A;  1WN1 A;  2GA2 A;  2NQ6 A;  2V6C A;  3PKE A;  4ZWU A;  1WBQ A;  2B3K A;  3FMR A;  4OOK A;  4RGZ 1;  5E5B A;  2BWY A;  5JFR A;  4U1B A;  1YW7 A;  5FCH A;  2HOW A;  1YW8 A;  2DFI A;  5JHU A;  4PNC A;  3FMQ A;  4FO8 A;  3ROR A;  4FLL A;  3CTZ A;  1R5G A;  3PKC A;  2EA2 A;  2BN7 A;  4FLJ A;  4JUQ A;  1PV9 A;  4Z7M A;  3S6B A;  2Q96 A;  2GU4 A;  2V3X A;  1W7V A;  4IPA A;  4EGE A;  4S00 A;  3CB6 A;  5CIK A;  4IKU A;  2GU6 A;  1YJ3 A;  4PV4 A;  1C27 A;  1WY2 A;  4IKR A;  4A6W A;  2GG9 A;  3FM3 A;  1BN5 A;  4U6C A;  2EVC A;  5FCF A;  4ZNG A;  1QXW A;  2GZ5 A;  2Q93 A;  2BWU A;  1XGS A;  1QZY A;  2EVO A;  5JI6 A;  2P98 A;  2OKN A;  4ZWP A;  5CDL A;  1KP0 A;  4IF7 A;  2GU7 A;  2BB7 A;  2BHA A;  2Q92 A;  2ADU A;  4S01 A;  2B3L A;  4S2T P;  4U6W A;  2V3Y A;  1C23 A;  4FLK A;  2B3H A;  2BH3 A;  3TAV A;  2OAZ A;  3PKD A;  2V3Z A;  5CLS A;  1A16 A;  2GG2 A;  1CHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...