2Q93A

E. coli methionine aminopeptidase mn-form with inhibitor b21
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 83
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q93A00
1KP0A 3L24A 1QXWA 3IU7A 5CDVA 4U69A 4FUKA 2BWXA 5JFRA 4FLJA 2Q92A 3L7GA 3PKEA 4U6WA 4FLKA 1N51A 1XNZA 1WL6A 4JUQA 4FO7A 2GG9A 4IPAA 3IG4A 5CNXA 2Q94A 3IU8A 3PKCA 4IU6A 2EVCA 2BHDA 3BIQA 5JI6A 4U1BA 2GGCA 3Q6DA 4U75A 1YVMA 3RVAA 2GG8A 1BOAA 2IW2A 2BWVA 4IKSA 5CDLA 2GU6A 1W7VA 1KQ0A 3PKBA 1WKMA 1KQ9A 4U6EA 4HXXA 2NQ7A 2DFIA 3FM3A 1R58A 2GG0A 4IECA 2Q8KA 1XGOA 5D6EA 3PKDA 5CLSA 2V6CA 2P9AA 3BITA 4IKTA 1PV9A 4IDYA 1C22A 2BH3A 2GU4A 4KM3A 4S2RP 2BWSA 2HOWA 4S01A 4U6ZA 1WBQA 3D27A 4U73A 1XGSA 4IF7A 1MATA 1WY2A 3MATA 2GU7A 4MATA 2B3LA 3FMQA 2GG7A 4FKCA 3RORA 2OAZA 4ZWUA 4B28A 4QR8A 2V3YA 4U6JA 5JHUA 1JAWA 1B59A 1YW7A 3CB6A 4PV4A 4IKRA 4ZNGA 4EGEA 5FCFA 2EA4A 1YW8A 3MX6A 2EVOA 1A16A 3CB5A 3PKAA 2GG3A 2Q93A 3S6BA 3TB5A 2G6PA 4FLIA 4FO8A 4RGZ1 3CTZA 1WL9A 2EA2A 4ZWPA 4RZYA 1YJ3A 2V3ZA 2BHAA 2Q95A 2P98A 1O0XA 1R5HA 3IU9A 1W2MA 2ADUA 5FCHA 2GA2A 5CIKA 2OKNA 1WLRA 4FLLA 2BHBA 1B6AA 1QXZA 2ZSGA 4S2TP 4A6WA 2BWTA 1Y1NA 2GZ5A 2EVMA 2B3HA 1XGNA 2P99A 2MATA 2BB7A 5CDEA 2BWUA 4IKUA 2Q96A 1C24A 1YW9A 2GG5A 1CHMA 4ZWOA 4RZZA 2BWWA 4A6VA 3FMRA 5E5BA 2GG2A 4U70A 1C21A 2BHCA 2GTXA 2GGBA 3BIPA 1QXYA 1C23A 2B3KA 4S00A 4U76A 1R5GA 4U71A 1M35A 1C27A 1XGMA 2BN7A 4R60A 4PNCA 4U6CA 4Z7MA 5CE6A 3TAVA 2BWYA 2GU5A 2V3XA 1WN1A 3MR1A 5D6FA 4OOKA 1BN5A 2NQ6A 1QZYA
chains in the Genus database with same CATH superfamily
1KP0A 3L24A 1QXWA 3IU7A 5CDVA 4U69A 4FUKA 2BWXA 5JFRA 4FLJA 2Q92A 3L7GA 3PKEA 4U6WA 4FLKA 1N51A 1XNZA 1WL6A 4JUQA 4FO7A 2GG9A 4IPAA 3IG4A 5CNXA 2Q94A 3IU8A 3PKCA 4IU6A 2EVCA 2BHDA 3BIQA 5JI6A 4U1BA 2GGCA 3Q6DA 4U75A 1YVMA 3RVAA 2GG8A 1BOAA 2IW2A 2BWVA 4IKSA 5CDLA 2GU6A 1W7VA 1KQ0A 3PKBA 1WKMA 1KQ9A 4U6EA 4HXXA 2NQ7A 2DFIA 3FM3A 1R58A 2GG0A 4IECA 2Q8KA 1XGOA 5D6EA 3PKDA 5CLSA 2V6CA 2P9AA 3BITA 4IKTA 1PV9A 4IDYA 1C22A 2BH3A 2GU4A 4KM3A 4S2RP 2BWSA 2HOWA 4S01A 4U6ZA 1WBQA 3D27A 4U73A 1XGSA 4IF7A 1MATA 1WY2A 3MATA 2GU7A 4MATA 2B3LA 3FMQA 2GG7A 4FKCA 3RORA 2OAZA 4ZWUA 4B28A 4QR8A 2V3YA 4U6JA 5JHUA 1JAWA 1B59A 1YW7A 3CB6A 4PV4A 4IKRA 4ZNGA 4EGEA 5FCFA 2EA4A 1YW8A 3MX6A 2EVOA 1A16A 3CB5A 3PKAA 2GG3A 2Q93A 3S6BA 3TB5A 2G6PA 4FLIA 4FO8A 4RGZ1 3CTZA 1WL9A 2EA2A 4ZWPA 4RZYA 1YJ3A 2V3ZA 2BHAA 2Q95A 2P98A 1O0XA 1R5HA 3IU9A 1W2MA 2ADUA 5FCHA 2GA2A 5CIKA 2OKNA 1WLRA 4FLLA 2BHBA 1B6AA 1QXZA 2ZSGA 4S2TP 4A6WA 2BWTA 1Y1NA 2GZ5A 2EVMA 2B3HA 1XGNA 2P99A 2MATA 2BB7A 5CDEA 2BWUA 4IKUA 2Q96A 1C24A 1YW9A 2GG5A 1CHMA 4ZWOA 4RZZA 2BWWA 4A6VA 3FMRA 5E5BA 2GG2A 4U70A 1C21A 2BHCA 2GTXA 2GGBA 3BIPA 1QXYA 1C23A 2B3KA 4S00A 4U76A 1R5GA 4U71A 1M35A 1C27A 1XGMA 2BN7A 4R60A 4PNCA 4U6CA 4Z7MA 5CE6A 3TAVA 2BWYA 2GU5A 2V3XA 1WN1A 3MR1A 5D6FA 4OOKA 1BN5A 2NQ6A 1QZYA
chains in the Genus database with same CATH topology
1KP0A 3L24A 1QXWA 3IU7A 5CDVA 4U69A 4FUKA 2BWXA 5JFRA 4FLJA 2Q92A 3L7GA 3PKEA 4U6WA 4FLKA 1N51A 1XNZA 1WL6A 4JUQA 4FO7A 2GG9A 4IPAA 3IG4A 5CNXA 2Q94A 3IU8A 3PKCA 4IU6A 2EVCA 2BHDA 3BIQA 5JI6A 4U1BA 2GGCA 3Q6DA 4U75A 1YVMA 3RVAA 2GG8A 1BOAA 2IW2A 2BWVA 4IKSA 5CDLA 2GU6A 1W7VA 1KQ0A 3PKBA 1WKMA 1KQ9A 4U6EA 4HXXA 2NQ7A 2DFIA 3FM3A 1R58A 2GG0A 4IECA 2Q8KA 1XGOA 5D6EA 3PKDA 5CLSA 2V6CA 2P9AA 3BITA 4IKTA 1PV9A 4IDYA 1C22A 2BH3A 2GU4A 4KM3A 4S2RP 2BWSA 2HOWA 4S01A 4U6ZA 1WBQA 3D27A 4U73A 1XGSA 4IF7A 1MATA 1WY2A 3MATA 2GU7A 4MATA 2B3LA 3FMQA 2GG7A 4FKCA 3RORA 2OAZA 4ZWUA 4B28A 4QR8A 2V3YA 4U6JA 5JHUA 1JAWA 1B59A 1YW7A 3CB6A 4PV4A 4IKRA 4ZNGA 4EGEA 5FCFA 2EA4A 1YW8A 3MX6A 2EVOA 1A16A 3CB5A 3PKAA 2GG3A 2Q93A 3S6BA 3TB5A 2G6PA 4FLIA 4FO8A 4RGZ1 3CTZA 1WL9A 2EA2A 4ZWPA 4RZYA 1YJ3A 2V3ZA 2BHAA 2Q95A 2P98A 1O0XA 1R5HA 3IU9A 1W2MA 2ADUA 5FCHA 2GA2A 5CIKA 2OKNA 1WLRA 4FLLA 2BHBA 1B6AA 1QXZA 2ZSGA 4S2TP 4A6WA 2BWTA 1Y1NA 2GZ5A 2EVMA 2B3HA 1XGNA 2P99A 2MATA 2BB7A 5CDEA 2BWUA 4IKUA 2Q96A 1C24A 1YW9A 2GG5A 1CHMA 4ZWOA 4RZZA 2BWWA 4A6VA 3FMRA 5E5BA 2GG2A 4U70A 1C21A 2BHCA 2GTXA 2GGBA 3BIPA 1QXYA 1C23A 2B3KA 4S00A 4U76A 1R5GA 4U71A 1M35A 1C27A 1XGMA 2BN7A 4R60A 4PNCA 4U6CA 4Z7MA 5CE6A 3TAVA 2BWYA 2GU5A 2V3XA 1WN1A 3MR1A 5D6FA 4OOKA 1BN5A 2NQ6A 1QZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KP0 A;  3L24 A;  1QXW A;  3IU7 A;  5CDV A;  4U69 A;  4FUK A;  2BWX A;  5JFR A;  4FLJ A;  2Q92 A;  3L7G A;  3PKE A;  4U6W A;  4FLK A;  1N51 A;  1XNZ A;  1WL6 A;  4JUQ A;  4FO7 A;  2GG9 A;  4IPA A;  3IG4 A;  5CNX A;  2Q94 A;  3IU8 A;  3PKC A;  4IU6 A;  2EVC A;  2BHD A;  3BIQ A;  5JI6 A;  4U1B A;  2GGC A;  3Q6D A;  4U75 A;  1YVM A;  3RVA A;  2GG8 A;  1BOA A;  2IW2 A;  2BWV A;  4IKS A;  5CDL A;  2GU6 A;  1W7V A;  1KQ0 A;  3PKB A;  1WKM A;  1KQ9 A;  4U6E A;  4HXX A;  2NQ7 A;  2DFI A;  3FM3 A;  1R58 A;  2GG0 A;  4IEC A;  2Q8K A;  1XGO A;  5D6E A;  3PKD A;  5CLS A;  2V6C A;  2P9A A;  3BIT A;  4IKT A;  1PV9 A;  4IDY A;  1C22 A;  2BH3 A;  2GU4 A;  4KM3 A;  4S2R P;  2BWS A;  2HOW A;  4S01 A;  4U6Z A;  1WBQ A;  3D27 A;  4U73 A;  1XGS A;  4IF7 A;  1MAT A;  1WY2 A;  3MAT A;  2GU7 A;  4MAT A;  2B3L A;  3FMQ A;  2GG7 A;  4FKC A;  3ROR A;  2OAZ A;  4ZWU A;  4B28 A;  4QR8 A;  2V3Y A;  4U6J A;  5JHU A;  1JAW A;  1B59 A;  1YW7 A;  3CB6 A;  4PV4 A;  4IKR A;  4ZNG A;  4EGE A;  5FCF A;  2EA4 A;  1YW8 A;  3MX6 A;  2EVO A;  1A16 A;  3CB5 A;  3PKA A;  2GG3 A;  2Q93 A;  3S6B A;  3TB5 A;  2G6P A;  4FLI A;  4FO8 A;  4RGZ 1;  3CTZ A;  1WL9 A;  2EA2 A;  4ZWP A;  4RZY A;  1YJ3 A;  2V3Z A;  2BHA A;  2Q95 A;  2P98 A;  1O0X A;  1R5H A;  3IU9 A;  1W2M A;  2ADU A;  5FCH A;  2GA2 A;  5CIK A;  2OKN A;  1WLR A;  4FLL A;  2BHB A;  1B6A A;  1QXZ A;  2ZSG A;  4S2T P;  4A6W A;  2BWT A;  1Y1N A;  2GZ5 A;  2EVM A;  2B3H A;  1XGN A;  2P99 A;  2MAT A;  2BB7 A;  5CDE A;  2BWU A;  4IKU A;  2Q96 A;  1C24 A;  1YW9 A;  2GG5 A;  1CHM A;  4ZWO A;  4RZZ A;  2BWW A;  4A6V A;  3FMR A;  5E5B A;  2GG2 A;  4U70 A;  1C21 A;  2BHC A;  2GTX A;  2GGB A;  3BIP A;  1QXY A;  1C23 A;  2B3K A;  4S00 A;  4U76 A;  1R5G A;  4U71 A;  1M35 A;  1C27 A;  1XGM A;  2BN7 A;  4R60 A;  4PNC A;  4U6C A;  4Z7M A;  5CE6 A;  3TAV A;  2BWY A;  2GU5 A;  2V3X A;  1WN1 A;  3MR1 A;  5D6F A;  4OOK A;  1BN5 A;  2NQ6 A;  1QZY A; 
#chains in the Genus database with same CATH topology
 1KP0 A;  3L24 A;  1QXW A;  3IU7 A;  5CDV A;  4U69 A;  4FUK A;  2BWX A;  5JFR A;  4FLJ A;  2Q92 A;  3L7G A;  3PKE A;  4U6W A;  4FLK A;  1N51 A;  1XNZ A;  1WL6 A;  4JUQ A;  4FO7 A;  2GG9 A;  4IPA A;  3IG4 A;  5CNX A;  2Q94 A;  3IU8 A;  3PKC A;  4IU6 A;  2EVC A;  2BHD A;  3BIQ A;  5JI6 A;  4U1B A;  2GGC A;  3Q6D A;  4U75 A;  1YVM A;  3RVA A;  2GG8 A;  1BOA A;  2IW2 A;  2BWV A;  4IKS A;  5CDL A;  2GU6 A;  1W7V A;  1KQ0 A;  3PKB A;  1WKM A;  1KQ9 A;  4U6E A;  4HXX A;  2NQ7 A;  2DFI A;  3FM3 A;  1R58 A;  2GG0 A;  4IEC A;  2Q8K A;  1XGO A;  5D6E A;  3PKD A;  5CLS A;  2V6C A;  2P9A A;  3BIT A;  4IKT A;  1PV9 A;  4IDY A;  1C22 A;  2BH3 A;  2GU4 A;  4KM3 A;  4S2R P;  2BWS A;  2HOW A;  4S01 A;  4U6Z A;  1WBQ A;  3D27 A;  4U73 A;  1XGS A;  4IF7 A;  1MAT A;  1WY2 A;  3MAT A;  2GU7 A;  4MAT A;  2B3L A;  3FMQ A;  2GG7 A;  4FKC A;  3ROR A;  2OAZ A;  4ZWU A;  4B28 A;  4QR8 A;  2V3Y A;  4U6J A;  5JHU A;  1JAW A;  1B59 A;  1YW7 A;  3CB6 A;  4PV4 A;  4IKR A;  4ZNG A;  4EGE A;  5FCF A;  2EA4 A;  1YW8 A;  3MX6 A;  2EVO A;  1A16 A;  3CB5 A;  3PKA A;  2GG3 A;  2Q93 A;  3S6B A;  3TB5 A;  2G6P A;  4FLI A;  4FO8 A;  4RGZ 1;  3CTZ A;  1WL9 A;  2EA2 A;  4ZWP A;  4RZY A;  1YJ3 A;  2V3Z A;  2BHA A;  2Q95 A;  2P98 A;  1O0X A;  1R5H A;  3IU9 A;  1W2M A;  2ADU A;  5FCH A;  2GA2 A;  5CIK A;  2OKN A;  1WLR A;  4FLL A;  2BHB A;  1B6A A;  1QXZ A;  2ZSG A;  4S2T P;  4A6W A;  2BWT A;  1Y1N A;  2GZ5 A;  2EVM A;  2B3H A;  1XGN A;  2P99 A;  2MAT A;  2BB7 A;  5CDE A;  2BWU A;  4IKU A;  2Q96 A;  1C24 A;  1YW9 A;  2GG5 A;  1CHM A;  4ZWO A;  4RZZ A;  2BWW A;  4A6V A;  3FMR A;  5E5B A;  2GG2 A;  4U70 A;  1C21 A;  2BHC A;  2GTX A;  2GGB A;  3BIP A;  1QXY A;  1C23 A;  2B3K A;  4S00 A;  4U76 A;  1R5G A;  4U71 A;  1M35 A;  1C27 A;  1XGM A;  2BN7 A;  4R60 A;  4PNC A;  4U6C A;  4Z7M A;  5CE6 A;  3TAV A;  2BWY A;  2GU5 A;  2V3X A;  1WN1 A;  3MR1 A;  5D6F A;  4OOK A;  1BN5 A;  2NQ6 A;  1QZY A; 
#chains in the Genus database with same CATH homology
 1KP0 A;  3L24 A;  1QXW A;  3IU7 A;  5CDV A;  4U69 A;  4FUK A;  2BWX A;  5JFR A;  4FLJ A;  2Q92 A;  3L7G A;  3PKE A;  4U6W A;  4FLK A;  1N51 A;  1XNZ A;  1WL6 A;  4JUQ A;  4FO7 A;  2GG9 A;  4IPA A;  3IG4 A;  5CNX A;  2Q94 A;  3IU8 A;  3PKC A;  4IU6 A;  2EVC A;  2BHD A;  3BIQ A;  5JI6 A;  4U1B A;  2GGC A;  3Q6D A;  4U75 A;  1YVM A;  3RVA A;  2GG8 A;  1BOA A;  2IW2 A;  2BWV A;  4IKS A;  5CDL A;  2GU6 A;  1W7V A;  1KQ0 A;  3PKB A;  1WKM A;  1KQ9 A;  4U6E A;  4HXX A;  2NQ7 A;  2DFI A;  3FM3 A;  1R58 A;  2GG0 A;  4IEC A;  2Q8K A;  1XGO A;  5D6E A;  3PKD A;  5CLS A;  2V6C A;  2P9A A;  3BIT A;  4IKT A;  1PV9 A;  4IDY A;  1C22 A;  2BH3 A;  2GU4 A;  4KM3 A;  4S2R P;  2BWS A;  2HOW A;  4S01 A;  4U6Z A;  1WBQ A;  3D27 A;  4U73 A;  1XGS A;  4IF7 A;  1MAT A;  1WY2 A;  3MAT A;  2GU7 A;  4MAT A;  2B3L A;  3FMQ A;  2GG7 A;  4FKC A;  3ROR A;  2OAZ A;  4ZWU A;  4B28 A;  4QR8 A;  2V3Y A;  4U6J A;  5JHU A;  1JAW A;  1B59 A;  1YW7 A;  3CB6 A;  4PV4 A;  4IKR A;  4ZNG A;  4EGE A;  5FCF A;  2EA4 A;  1YW8 A;  3MX6 A;  2EVO A;  1A16 A;  3CB5 A;  3PKA A;  2GG3 A;  2Q93 A;  3S6B A;  3TB5 A;  2G6P A;  4FLI A;  4FO8 A;  4RGZ 1;  3CTZ A;  1WL9 A;  2EA2 A;  4ZWP A;  4RZY A;  1YJ3 A;  2V3Z A;  2BHA A;  2Q95 A;  2P98 A;  1O0X A;  1R5H A;  3IU9 A;  1W2M A;  2ADU A;  5FCH A;  2GA2 A;  5CIK A;  2OKN A;  1WLR A;  4FLL A;  2BHB A;  1B6A A;  1QXZ A;  2ZSG A;  4S2T P;  4A6W A;  2BWT A;  1Y1N A;  2GZ5 A;  2EVM A;  2B3H A;  1XGN A;  2P99 A;  2MAT A;  2BB7 A;  5CDE A;  2BWU A;  4IKU A;  2Q96 A;  1C24 A;  1YW9 A;  2GG5 A;  1CHM A;  4ZWO A;  4RZZ A;  2BWW A;  4A6V A;  3FMR A;  5E5B A;  2GG2 A;  4U70 A;  1C21 A;  2BHC A;  2GTX A;  2GGB A;  3BIP A;  1QXY A;  1C23 A;  2B3K A;  4S00 A;  4U76 A;  1R5G A;  4U71 A;  1M35 A;  1C27 A;  1XGM A;  2BN7 A;  4R60 A;  4PNC A;  4U6C A;  4Z7M A;  5CE6 A;  3TAV A;  2BWY A;  2GU5 A;  2V3X A;  1WN1 A;  3MR1 A;  5D6F A;  4OOK A;  1BN5 A;  2NQ6 A;  1QZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...