2Q93A

E. coli methionine aminopeptidase mn-form with inhibitor b21
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 83
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q93A00
4IF7A 1R58A 4RZZA 1C21A 1C24A 3L7GA 4RGZ1 3PKEA 1WKMA 3BIPA 2IW2A 1XNZA 1WL9A 4MATA 4QR8A 1YJ3A 2NQ7A 2Q95A 2GGCA 2GA2A 2BHBA 4U73A 2GG9A 1KP0A 4FO8A 4U70A 2GG8A 4IKUA 4U71A 2BHAA 2P9AA 3PKAA 4U76A 4JUQA 2Q93A 2GU5A 4S00A 2BWTA 2GU7A 2Q92A 2GG3A 2DFIA 1KQ0A 3FMRA 2BH3A 2GU4A 2OKNA 1QXZA 4U6WA 5CNXA 2BWUA 3PKDA 3TB5A 5D6EA 4U6JA 1M35A 4IDYA 3BITA 4R60A 1C27A 1YW9A 5JI6A 4OOKA 4FKCA 1N51A 2BHCA 2GGBA 2GG5A 4IKTA 1BN5A 1XGOA 2Q96A 5CDLA 1B6AA 2EA2A 4FO7A 1WLRA 2GTXA 3MR1A 4A6WA 5CDVA 2OAZA 1W7VA 1WN1A 4S2RP 4U6EA 4U69A 3S6BA 4EGEA 1R5GA 4PNCA 3CB6A 5CLSA 4PV4A 5CIKA 2MATA 5FCHA 5JFRA 5CDEA 1Y1NA 2BN7A 2GG0A 2V6CA 1C23A 1BOAA 2V3YA 2V3ZA 3IU9A 3MATA 1MATA 1WL6A 5D6FA 2BWXA 3PKCA 1KQ9A 2ZSGA 4HXXA 2BWVA 2EA4A 1YW7A 2P99A 2GG2A 2BWSA 4IECA 2Q8KA 2EVOA 4FLKA 4S2TP 3FMQA 2B3LA 3D27A 1XGNA 2NQ6A 1XGSA 2HOWA 4KM3A 3MX6A 4IKSA 2Q94A 1QZYA 1R5HA 1YW8A 1O0XA 5FCFA 1YVMA 3FM3A 4IKRA 3BIQA 3Q6DA 3RVAA 4IU6A 2GZ5A 1QXWA 1B59A 4FLIA 2B3KA 3RORA 4A6VA 4U6CA 1C22A 4U75A 4U6ZA 1JAWA 1QXYA 4Z7MA 1CHMA 1W2MA 4S01A 2EVMA 1WBQA 2BHDA 2EVCA 4ZWPA 4IPAA 1XGMA 2V3XA 3IU7A 3L24A 3IU8A 3CB5A 3PKBA 4RZYA 4ZWOA 4ZNGA 3CTZA 2G6PA 4FLJA 2BWWA 2GU6A 2ADUA 2BB7A 4ZWUA 3TAVA 5E5BA 5CE6A 2BWYA 4FLLA 4FUKA 1PV9A 4B28A 4U1BA 2B3HA 2GG7A 1A16A 1WY2A 2P98A 3IG4A 5JHUA
chains in the Genus database with same CATH superfamily
4IF7A 1R58A 4RZZA 1C21A 1C24A 3L7GA 4RGZ1 3PKEA 1WKMA 3BIPA 2IW2A 1XNZA 1WL9A 4MATA 4QR8A 1YJ3A 2NQ7A 2Q95A 2GGCA 2GA2A 2BHBA 4U73A 2GG9A 1KP0A 4FO8A 4U70A 2GG8A 4IKUA 4U71A 2BHAA 2P9AA 3PKAA 4U76A 4JUQA 2Q93A 2GU5A 4S00A 2BWTA 2GU7A 2Q92A 2GG3A 2DFIA 1KQ0A 3FMRA 2BH3A 2GU4A 2OKNA 1QXZA 4U6WA 5CNXA 2BWUA 3PKDA 3TB5A 5D6EA 4U6JA 1M35A 4IDYA 3BITA 4R60A 1C27A 1YW9A 5JI6A 4OOKA 4FKCA 1N51A 2BHCA 2GGBA 2GG5A 4IKTA 1BN5A 1XGOA 2Q96A 5CDLA 1B6AA 2EA2A 4FO7A 1WLRA 2GTXA 3MR1A 4A6WA 5CDVA 2OAZA 1W7VA 1WN1A 4S2RP 4U6EA 4U69A 3S6BA 4EGEA 1R5GA 4PNCA 3CB6A 5CLSA 4PV4A 5CIKA 2MATA 5FCHA 5JFRA 5CDEA 1Y1NA 2BN7A 2GG0A 2V6CA 1C23A 1BOAA 2V3YA 2V3ZA 3IU9A 3MATA 1MATA 1WL6A 5D6FA 2BWXA 3PKCA 1KQ9A 2ZSGA 4HXXA 2BWVA 2EA4A 1YW7A 2P99A 2GG2A 2BWSA 4IECA 2Q8KA 2EVOA 4FLKA 4S2TP 3FMQA 2B3LA 3D27A 1XGNA 2NQ6A 1XGSA 2HOWA 4KM3A 3MX6A 4IKSA 2Q94A 1QZYA 1R5HA 1YW8A 1O0XA 5FCFA 1YVMA 3FM3A 4IKRA 3BIQA 3Q6DA 3RVAA 4IU6A 2GZ5A 1QXWA 1B59A 4FLIA 2B3KA 3RORA 4A6VA 4U6CA 1C22A 4U75A 4U6ZA 1JAWA 1QXYA 4Z7MA 1CHMA 1W2MA 4S01A 2EVMA 1WBQA 2BHDA 2EVCA 4ZWPA 4IPAA 1XGMA 2V3XA 3IU7A 3L24A 3IU8A 3CB5A 3PKBA 4RZYA 4ZWOA 4ZNGA 3CTZA 2G6PA 4FLJA 2BWWA 2GU6A 2ADUA 2BB7A 4ZWUA 3TAVA 5E5BA 5CE6A 2BWYA 4FLLA 4FUKA 1PV9A 4B28A 4U1BA 2B3HA 2GG7A 1A16A 1WY2A 2P98A 3IG4A 5JHUA
chains in the Genus database with same CATH topology
4IF7A 1R58A 4RZZA 1C21A 1C24A 3L7GA 4RGZ1 3PKEA 1WKMA 3BIPA 2IW2A 1XNZA 1WL9A 4MATA 4QR8A 1YJ3A 2NQ7A 2Q95A 2GGCA 2GA2A 2BHBA 4U73A 2GG9A 1KP0A 4FO8A 4U70A 2GG8A 4IKUA 4U71A 2BHAA 2P9AA 3PKAA 4U76A 4JUQA 2Q93A 2GU5A 4S00A 2BWTA 2GU7A 2Q92A 2GG3A 2DFIA 1KQ0A 3FMRA 2BH3A 2GU4A 2OKNA 1QXZA 4U6WA 5CNXA 2BWUA 3PKDA 3TB5A 5D6EA 4U6JA 1M35A 4IDYA 3BITA 4R60A 1C27A 1YW9A 5JI6A 4OOKA 4FKCA 1N51A 2BHCA 2GGBA 2GG5A 4IKTA 1BN5A 1XGOA 2Q96A 5CDLA 1B6AA 2EA2A 4FO7A 1WLRA 2GTXA 3MR1A 4A6WA 5CDVA 2OAZA 1W7VA 1WN1A 4S2RP 4U6EA 4U69A 3S6BA 4EGEA 1R5GA 4PNCA 3CB6A 5CLSA 4PV4A 5CIKA 2MATA 5FCHA 5JFRA 5CDEA 1Y1NA 2BN7A 2GG0A 2V6CA 1C23A 1BOAA 2V3YA 2V3ZA 3IU9A 3MATA 1MATA 1WL6A 5D6FA 2BWXA 3PKCA 1KQ9A 2ZSGA 4HXXA 2BWVA 2EA4A 1YW7A 2P99A 2GG2A 2BWSA 4IECA 2Q8KA 2EVOA 4FLKA 4S2TP 3FMQA 2B3LA 3D27A 1XGNA 2NQ6A 1XGSA 2HOWA 4KM3A 3MX6A 4IKSA 2Q94A 1QZYA 1R5HA 1YW8A 1O0XA 5FCFA 1YVMA 3FM3A 4IKRA 3BIQA 3Q6DA 3RVAA 4IU6A 2GZ5A 1QXWA 1B59A 4FLIA 2B3KA 3RORA 4A6VA 4U6CA 1C22A 4U75A 4U6ZA 1JAWA 1QXYA 4Z7MA 1CHMA 1W2MA 4S01A 2EVMA 1WBQA 2BHDA 2EVCA 4ZWPA 4IPAA 1XGMA 2V3XA 3IU7A 3L24A 3IU8A 3CB5A 3PKBA 4RZYA 4ZWOA 4ZNGA 3CTZA 2G6PA 4FLJA 2BWWA 2GU6A 2ADUA 2BB7A 4ZWUA 3TAVA 5E5BA 5CE6A 2BWYA 4FLLA 4FUKA 1PV9A 4B28A 4U1BA 2B3HA 2GG7A 1A16A 1WY2A 2P98A 3IG4A 5JHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF7 A;  1R58 A;  4RZZ A;  1C21 A;  1C24 A;  3L7G A;  4RGZ 1;  3PKE A;  1WKM A;  3BIP A;  2IW2 A;  1XNZ A;  1WL9 A;  4MAT A;  4QR8 A;  1YJ3 A;  2NQ7 A;  2Q95 A;  2GGC A;  2GA2 A;  2BHB A;  4U73 A;  2GG9 A;  1KP0 A;  4FO8 A;  4U70 A;  2GG8 A;  4IKU A;  4U71 A;  2BHA A;  2P9A A;  3PKA A;  4U76 A;  4JUQ A;  2Q93 A;  2GU5 A;  4S00 A;  2BWT A;  2GU7 A;  2Q92 A;  2GG3 A;  2DFI A;  1KQ0 A;  3FMR A;  2BH3 A;  2GU4 A;  2OKN A;  1QXZ A;  4U6W A;  5CNX A;  2BWU A;  3PKD A;  3TB5 A;  5D6E A;  4U6J A;  1M35 A;  4IDY A;  3BIT A;  4R60 A;  1C27 A;  1YW9 A;  5JI6 A;  4OOK A;  4FKC A;  1N51 A;  2BHC A;  2GGB A;  2GG5 A;  4IKT A;  1BN5 A;  1XGO A;  2Q96 A;  5CDL A;  1B6A A;  2EA2 A;  4FO7 A;  1WLR A;  2GTX A;  3MR1 A;  4A6W A;  5CDV A;  2OAZ A;  1W7V A;  1WN1 A;  4S2R P;  4U6E A;  4U69 A;  3S6B A;  4EGE A;  1R5G A;  4PNC A;  3CB6 A;  5CLS A;  4PV4 A;  5CIK A;  2MAT A;  5FCH A;  5JFR A;  5CDE A;  1Y1N A;  2BN7 A;  2GG0 A;  2V6C A;  1C23 A;  1BOA A;  2V3Y A;  2V3Z A;  3IU9 A;  3MAT A;  1MAT A;  1WL6 A;  5D6F A;  2BWX A;  3PKC A;  1KQ9 A;  2ZSG A;  4HXX A;  2BWV A;  2EA4 A;  1YW7 A;  2P99 A;  2GG2 A;  2BWS A;  4IEC A;  2Q8K A;  2EVO A;  4FLK A;  4S2T P;  3FMQ A;  2B3L A;  3D27 A;  1XGN A;  2NQ6 A;  1XGS A;  2HOW A;  4KM3 A;  3MX6 A;  4IKS A;  2Q94 A;  1QZY A;  1R5H A;  1YW8 A;  1O0X A;  5FCF A;  1YVM A;  3FM3 A;  4IKR A;  3BIQ A;  3Q6D A;  3RVA A;  4IU6 A;  2GZ5 A;  1QXW A;  1B59 A;  4FLI A;  2B3K A;  3ROR A;  4A6V A;  4U6C A;  1C22 A;  4U75 A;  4U6Z A;  1JAW A;  1QXY A;  4Z7M A;  1CHM A;  1W2M A;  4S01 A;  2EVM A;  1WBQ A;  2BHD A;  2EVC A;  4ZWP A;  4IPA A;  1XGM A;  2V3X A;  3IU7 A;  3L24 A;  3IU8 A;  3CB5 A;  3PKB A;  4RZY A;  4ZWO A;  4ZNG A;  3CTZ A;  2G6P A;  4FLJ A;  2BWW A;  2GU6 A;  2ADU A;  2BB7 A;  4ZWU A;  3TAV A;  5E5B A;  5CE6 A;  2BWY A;  4FLL A;  4FUK A;  1PV9 A;  4B28 A;  4U1B A;  2B3H A;  2GG7 A;  1A16 A;  1WY2 A;  2P98 A;  3IG4 A;  5JHU A; 
#chains in the Genus database with same CATH topology
 4IF7 A;  1R58 A;  4RZZ A;  1C21 A;  1C24 A;  3L7G A;  4RGZ 1;  3PKE A;  1WKM A;  3BIP A;  2IW2 A;  1XNZ A;  1WL9 A;  4MAT A;  4QR8 A;  1YJ3 A;  2NQ7 A;  2Q95 A;  2GGC A;  2GA2 A;  2BHB A;  4U73 A;  2GG9 A;  1KP0 A;  4FO8 A;  4U70 A;  2GG8 A;  4IKU A;  4U71 A;  2BHA A;  2P9A A;  3PKA A;  4U76 A;  4JUQ A;  2Q93 A;  2GU5 A;  4S00 A;  2BWT A;  2GU7 A;  2Q92 A;  2GG3 A;  2DFI A;  1KQ0 A;  3FMR A;  2BH3 A;  2GU4 A;  2OKN A;  1QXZ A;  4U6W A;  5CNX A;  2BWU A;  3PKD A;  3TB5 A;  5D6E A;  4U6J A;  1M35 A;  4IDY A;  3BIT A;  4R60 A;  1C27 A;  1YW9 A;  5JI6 A;  4OOK A;  4FKC A;  1N51 A;  2BHC A;  2GGB A;  2GG5 A;  4IKT A;  1BN5 A;  1XGO A;  2Q96 A;  5CDL A;  1B6A A;  2EA2 A;  4FO7 A;  1WLR A;  2GTX A;  3MR1 A;  4A6W A;  5CDV A;  2OAZ A;  1W7V A;  1WN1 A;  4S2R P;  4U6E A;  4U69 A;  3S6B A;  4EGE A;  1R5G A;  4PNC A;  3CB6 A;  5CLS A;  4PV4 A;  5CIK A;  2MAT A;  5FCH A;  5JFR A;  5CDE A;  1Y1N A;  2BN7 A;  2GG0 A;  2V6C A;  1C23 A;  1BOA A;  2V3Y A;  2V3Z A;  3IU9 A;  3MAT A;  1MAT A;  1WL6 A;  5D6F A;  2BWX A;  3PKC A;  1KQ9 A;  2ZSG A;  4HXX A;  2BWV A;  2EA4 A;  1YW7 A;  2P99 A;  2GG2 A;  2BWS A;  4IEC A;  2Q8K A;  2EVO A;  4FLK A;  4S2T P;  3FMQ A;  2B3L A;  3D27 A;  1XGN A;  2NQ6 A;  1XGS A;  2HOW A;  4KM3 A;  3MX6 A;  4IKS A;  2Q94 A;  1QZY A;  1R5H A;  1YW8 A;  1O0X A;  5FCF A;  1YVM A;  3FM3 A;  4IKR A;  3BIQ A;  3Q6D A;  3RVA A;  4IU6 A;  2GZ5 A;  1QXW A;  1B59 A;  4FLI A;  2B3K A;  3ROR A;  4A6V A;  4U6C A;  1C22 A;  4U75 A;  4U6Z A;  1JAW A;  1QXY A;  4Z7M A;  1CHM A;  1W2M A;  4S01 A;  2EVM A;  1WBQ A;  2BHD A;  2EVC A;  4ZWP A;  4IPA A;  1XGM A;  2V3X A;  3IU7 A;  3L24 A;  3IU8 A;  3CB5 A;  3PKB A;  4RZY A;  4ZWO A;  4ZNG A;  3CTZ A;  2G6P A;  4FLJ A;  2BWW A;  2GU6 A;  2ADU A;  2BB7 A;  4ZWU A;  3TAV A;  5E5B A;  5CE6 A;  2BWY A;  4FLL A;  4FUK A;  1PV9 A;  4B28 A;  4U1B A;  2B3H A;  2GG7 A;  1A16 A;  1WY2 A;  2P98 A;  3IG4 A;  5JHU A; 
#chains in the Genus database with same CATH homology
 4IF7 A;  1R58 A;  4RZZ A;  1C21 A;  1C24 A;  3L7G A;  4RGZ 1;  3PKE A;  1WKM A;  3BIP A;  2IW2 A;  1XNZ A;  1WL9 A;  4MAT A;  4QR8 A;  1YJ3 A;  2NQ7 A;  2Q95 A;  2GGC A;  2GA2 A;  2BHB A;  4U73 A;  2GG9 A;  1KP0 A;  4FO8 A;  4U70 A;  2GG8 A;  4IKU A;  4U71 A;  2BHA A;  2P9A A;  3PKA A;  4U76 A;  4JUQ A;  2Q93 A;  2GU5 A;  4S00 A;  2BWT A;  2GU7 A;  2Q92 A;  2GG3 A;  2DFI A;  1KQ0 A;  3FMR A;  2BH3 A;  2GU4 A;  2OKN A;  1QXZ A;  4U6W A;  5CNX A;  2BWU A;  3PKD A;  3TB5 A;  5D6E A;  4U6J A;  1M35 A;  4IDY A;  3BIT A;  4R60 A;  1C27 A;  1YW9 A;  5JI6 A;  4OOK A;  4FKC A;  1N51 A;  2BHC A;  2GGB A;  2GG5 A;  4IKT A;  1BN5 A;  1XGO A;  2Q96 A;  5CDL A;  1B6A A;  2EA2 A;  4FO7 A;  1WLR A;  2GTX A;  3MR1 A;  4A6W A;  5CDV A;  2OAZ A;  1W7V A;  1WN1 A;  4S2R P;  4U6E A;  4U69 A;  3S6B A;  4EGE A;  1R5G A;  4PNC A;  3CB6 A;  5CLS A;  4PV4 A;  5CIK A;  2MAT A;  5FCH A;  5JFR A;  5CDE A;  1Y1N A;  2BN7 A;  2GG0 A;  2V6C A;  1C23 A;  1BOA A;  2V3Y A;  2V3Z A;  3IU9 A;  3MAT A;  1MAT A;  1WL6 A;  5D6F A;  2BWX A;  3PKC A;  1KQ9 A;  2ZSG A;  4HXX A;  2BWV A;  2EA4 A;  1YW7 A;  2P99 A;  2GG2 A;  2BWS A;  4IEC A;  2Q8K A;  2EVO A;  4FLK A;  4S2T P;  3FMQ A;  2B3L A;  3D27 A;  1XGN A;  2NQ6 A;  1XGS A;  2HOW A;  4KM3 A;  3MX6 A;  4IKS A;  2Q94 A;  1QZY A;  1R5H A;  1YW8 A;  1O0X A;  5FCF A;  1YVM A;  3FM3 A;  4IKR A;  3BIQ A;  3Q6D A;  3RVA A;  4IU6 A;  2GZ5 A;  1QXW A;  1B59 A;  4FLI A;  2B3K A;  3ROR A;  4A6V A;  4U6C A;  1C22 A;  4U75 A;  4U6Z A;  1JAW A;  1QXY A;  4Z7M A;  1CHM A;  1W2M A;  4S01 A;  2EVM A;  1WBQ A;  2BHD A;  2EVC A;  4ZWP A;  4IPA A;  1XGM A;  2V3X A;  3IU7 A;  3L24 A;  3IU8 A;  3CB5 A;  3PKB A;  4RZY A;  4ZWO A;  4ZNG A;  3CTZ A;  2G6P A;  4FLJ A;  2BWW A;  2GU6 A;  2ADU A;  2BB7 A;  4ZWU A;  3TAV A;  5E5B A;  5CE6 A;  2BWY A;  4FLL A;  4FUK A;  1PV9 A;  4B28 A;  4U1B A;  2B3H A;  2GG7 A;  1A16 A;  1WY2 A;  2P98 A;  3IG4 A;  5JHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...