2Q93A

E. coli methionine aminopeptidase mn-form with inhibitor b21
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 83
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q93A00
4ZNGA 4ZWPA 1WKMA 1YJ3A 3Q6DA 3PKCA 2Q94A 4S01A 2Q92A 2OAZA 2GG5A 2EA4A 3RVAA 1JAWA 2BWYA 4FO8A 4IDYA 1W7VA 4FLJA 2GU5A 1C21A 1YVMA 4FKCA 3MR1A 4IKUA 4IPAA 1R58A 3MATA 1QXYA 3IU8A 5JHUA 4S2RP 2GG3A 1KP0A 4ZWOA 3PKBA 4FO7A 1KQ0A 4QR8A 1XGSA 4R60A 3BIPA 5CLSA 5CNXA 1WL9A 1Y1NA 1KQ9A 2GA2A 3TB5A 4S00A 4U6WA 2BHBA 1WLRA 4U69A 5E5BA 4A6VA 2GTXA 2GG0A 1C23A 2V3XA 2GU4A 2G6PA 1QXZA 2EA2A 4IU6A 1BOAA 1C22A 4IF7A 2NQ6A 2Q93A 1XNZA 4Z7MA 3CTZA 1C27A 2OKNA 2BHDA 2DFIA 1WN1A 2Q8KA 4IKSA 1WY2A 3IU9A 3CB5A 2GG9A 1WBQA 4HXXA 4U70A 4U1BA 5CDVA 1XGNA 4JUQA 1BN5A 4RZYA 4U6CA 2Q95A 2IW2A 3FMRA 4U6JA 1C24A 4FLLA 2NQ7A 1YW7A 2GG7A 2BWWA 5CDEA 1M35A 3TAVA 2MATA 2GGBA 2EVOA 3S6BA 4U6EA 5CDLA 4EGEA 4IECA 1A16A 4IKRA 2HOWA 4PNCA 4U71A 4S2TP 5D6FA 3FMQA 4KM3A 5FCFA 1YW9A 2GGCA 5CIKA 2V3YA 1O0XA 2P98A 2BWVA 3FM3A 2BH3A 1WL6A 2BB7A 3BIQA 1QZYA 1B6AA 2B3LA 2ADUA 2BWUA 3L7GA 4FLIA 4IKTA 3CB6A 4MATA 2GG8A 2V3ZA 1CHMA 4FUKA 2GU6A 4U73A 2BHAA 4ZWUA 3D27A 1W2MA 1N51A 3L24A 5JFRA 4PV4A 4RZZA 5D6EA 4U75A 1XGOA 2GG2A 5CE6A 4B28A 1XGMA 1YW8A 2B3KA 2ZSGA 5FCHA 5JI6A 2BHCA 3BITA 1B59A 2BN7A 3PKEA 4U76A 3RORA 2BWSA 2P99A 2V6CA 1MATA 4A6WA 2BWTA 2EVCA 1R5GA 3MX6A 4OOKA 1QXWA 2Q96A 3IU7A 4RGZ1 1PV9A 2B3HA 3IG4A 2BWXA 2EVMA 4FLKA 3PKDA 2GZ5A 3PKAA 4U6ZA 2P9AA 1R5HA 2GU7A
chains in the Genus database with same CATH superfamily
4ZNGA 4ZWPA 1WKMA 1YJ3A 3Q6DA 3PKCA 2Q94A 4S01A 2Q92A 2OAZA 2GG5A 2EA4A 3RVAA 1JAWA 2BWYA 4FO8A 4IDYA 1W7VA 4FLJA 2GU5A 1C21A 1YVMA 4FKCA 3MR1A 4IKUA 4IPAA 1R58A 3MATA 1QXYA 3IU8A 5JHUA 4S2RP 2GG3A 1KP0A 4ZWOA 3PKBA 4FO7A 1KQ0A 4QR8A 1XGSA 4R60A 3BIPA 5CLSA 5CNXA 1WL9A 1Y1NA 1KQ9A 2GA2A 3TB5A 4S00A 4U6WA 2BHBA 1WLRA 4U69A 5E5BA 4A6VA 2GTXA 2GG0A 1C23A 2V3XA 2GU4A 2G6PA 1QXZA 2EA2A 4IU6A 1BOAA 1C22A 4IF7A 2NQ6A 2Q93A 1XNZA 4Z7MA 3CTZA 1C27A 2OKNA 2BHDA 2DFIA 1WN1A 2Q8KA 4IKSA 1WY2A 3IU9A 3CB5A 2GG9A 1WBQA 4HXXA 4U70A 4U1BA 5CDVA 1XGNA 4JUQA 1BN5A 4RZYA 4U6CA 2Q95A 2IW2A 3FMRA 4U6JA 1C24A 4FLLA 2NQ7A 1YW7A 2GG7A 2BWWA 5CDEA 1M35A 3TAVA 2MATA 2GGBA 2EVOA 3S6BA 4U6EA 5CDLA 4EGEA 4IECA 1A16A 4IKRA 2HOWA 4PNCA 4U71A 4S2TP 5D6FA 3FMQA 4KM3A 5FCFA 1YW9A 2GGCA 5CIKA 2V3YA 1O0XA 2P98A 2BWVA 3FM3A 2BH3A 1WL6A 2BB7A 3BIQA 1QZYA 1B6AA 2B3LA 2ADUA 2BWUA 3L7GA 4FLIA 4IKTA 3CB6A 4MATA 2GG8A 2V3ZA 1CHMA 4FUKA 2GU6A 4U73A 2BHAA 4ZWUA 3D27A 1W2MA 1N51A 3L24A 5JFRA 4PV4A 4RZZA 5D6EA 4U75A 1XGOA 2GG2A 5CE6A 4B28A 1XGMA 1YW8A 2B3KA 2ZSGA 5FCHA 5JI6A 2BHCA 3BITA 1B59A 2BN7A 3PKEA 4U76A 3RORA 2BWSA 2P99A 2V6CA 1MATA 4A6WA 2BWTA 2EVCA 1R5GA 3MX6A 4OOKA 1QXWA 2Q96A 3IU7A 4RGZ1 1PV9A 2B3HA 3IG4A 2BWXA 2EVMA 4FLKA 3PKDA 2GZ5A 3PKAA 4U6ZA 2P9AA 1R5HA 2GU7A
chains in the Genus database with same CATH topology
4ZNGA 4ZWPA 1WKMA 1YJ3A 3Q6DA 3PKCA 2Q94A 4S01A 2Q92A 2OAZA 2GG5A 2EA4A 3RVAA 1JAWA 2BWYA 4FO8A 4IDYA 1W7VA 4FLJA 2GU5A 1C21A 1YVMA 4FKCA 3MR1A 4IKUA 4IPAA 1R58A 3MATA 1QXYA 3IU8A 5JHUA 4S2RP 2GG3A 1KP0A 4ZWOA 3PKBA 4FO7A 1KQ0A 4QR8A 1XGSA 4R60A 3BIPA 5CLSA 5CNXA 1WL9A 1Y1NA 1KQ9A 2GA2A 3TB5A 4S00A 4U6WA 2BHBA 1WLRA 4U69A 5E5BA 4A6VA 2GTXA 2GG0A 1C23A 2V3XA 2GU4A 2G6PA 1QXZA 2EA2A 4IU6A 1BOAA 1C22A 4IF7A 2NQ6A 2Q93A 1XNZA 4Z7MA 3CTZA 1C27A 2OKNA 2BHDA 2DFIA 1WN1A 2Q8KA 4IKSA 1WY2A 3IU9A 3CB5A 2GG9A 1WBQA 4HXXA 4U70A 4U1BA 5CDVA 1XGNA 4JUQA 1BN5A 4RZYA 4U6CA 2Q95A 2IW2A 3FMRA 4U6JA 1C24A 4FLLA 2NQ7A 1YW7A 2GG7A 2BWWA 5CDEA 1M35A 3TAVA 2MATA 2GGBA 2EVOA 3S6BA 4U6EA 5CDLA 4EGEA 4IECA 1A16A 4IKRA 2HOWA 4PNCA 4U71A 4S2TP 5D6FA 3FMQA 4KM3A 5FCFA 1YW9A 2GGCA 5CIKA 2V3YA 1O0XA 2P98A 2BWVA 3FM3A 2BH3A 1WL6A 2BB7A 3BIQA 1QZYA 1B6AA 2B3LA 2ADUA 2BWUA 3L7GA 4FLIA 4IKTA 3CB6A 4MATA 2GG8A 2V3ZA 1CHMA 4FUKA 2GU6A 4U73A 2BHAA 4ZWUA 3D27A 1W2MA 1N51A 3L24A 5JFRA 4PV4A 4RZZA 5D6EA 4U75A 1XGOA 2GG2A 5CE6A 4B28A 1XGMA 1YW8A 2B3KA 2ZSGA 5FCHA 5JI6A 2BHCA 3BITA 1B59A 2BN7A 3PKEA 4U76A 3RORA 2BWSA 2P99A 2V6CA 1MATA 4A6WA 2BWTA 2EVCA 1R5GA 3MX6A 4OOKA 1QXWA 2Q96A 3IU7A 4RGZ1 1PV9A 2B3HA 3IG4A 2BWXA 2EVMA 4FLKA 3PKDA 2GZ5A 3PKAA 4U6ZA 2P9AA 1R5HA 2GU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNG A;  4ZWP A;  1WKM A;  1YJ3 A;  3Q6D A;  3PKC A;  2Q94 A;  4S01 A;  2Q92 A;  2OAZ A;  2GG5 A;  2EA4 A;  3RVA A;  1JAW A;  2BWY A;  4FO8 A;  4IDY A;  1W7V A;  4FLJ A;  2GU5 A;  1C21 A;  1YVM A;  4FKC A;  3MR1 A;  4IKU A;  4IPA A;  1R58 A;  3MAT A;  1QXY A;  3IU8 A;  5JHU A;  4S2R P;  2GG3 A;  1KP0 A;  4ZWO A;  3PKB A;  4FO7 A;  1KQ0 A;  4QR8 A;  1XGS A;  4R60 A;  3BIP A;  5CLS A;  5CNX A;  1WL9 A;  1Y1N A;  1KQ9 A;  2GA2 A;  3TB5 A;  4S00 A;  4U6W A;  2BHB A;  1WLR A;  4U69 A;  5E5B A;  4A6V A;  2GTX A;  2GG0 A;  1C23 A;  2V3X A;  2GU4 A;  2G6P A;  1QXZ A;  2EA2 A;  4IU6 A;  1BOA A;  1C22 A;  4IF7 A;  2NQ6 A;  2Q93 A;  1XNZ A;  4Z7M A;  3CTZ A;  1C27 A;  2OKN A;  2BHD A;  2DFI A;  1WN1 A;  2Q8K A;  4IKS A;  1WY2 A;  3IU9 A;  3CB5 A;  2GG9 A;  1WBQ A;  4HXX A;  4U70 A;  4U1B A;  5CDV A;  1XGN A;  4JUQ A;  1BN5 A;  4RZY A;  4U6C A;  2Q95 A;  2IW2 A;  3FMR A;  4U6J A;  1C24 A;  4FLL A;  2NQ7 A;  1YW7 A;  2GG7 A;  2BWW A;  5CDE A;  1M35 A;  3TAV A;  2MAT A;  2GGB A;  2EVO A;  3S6B A;  4U6E A;  5CDL A;  4EGE A;  4IEC A;  1A16 A;  4IKR A;  2HOW A;  4PNC A;  4U71 A;  4S2T P;  5D6F A;  3FMQ A;  4KM3 A;  5FCF A;  1YW9 A;  2GGC A;  5CIK A;  2V3Y A;  1O0X A;  2P98 A;  2BWV A;  3FM3 A;  2BH3 A;  1WL6 A;  2BB7 A;  3BIQ A;  1QZY A;  1B6A A;  2B3L A;  2ADU A;  2BWU A;  3L7G A;  4FLI A;  4IKT A;  3CB6 A;  4MAT A;  2GG8 A;  2V3Z A;  1CHM A;  4FUK A;  2GU6 A;  4U73 A;  2BHA A;  4ZWU A;  3D27 A;  1W2M A;  1N51 A;  3L24 A;  5JFR A;  4PV4 A;  4RZZ A;  5D6E A;  4U75 A;  1XGO A;  2GG2 A;  5CE6 A;  4B28 A;  1XGM A;  1YW8 A;  2B3K A;  2ZSG A;  5FCH A;  5JI6 A;  2BHC A;  3BIT A;  1B59 A;  2BN7 A;  3PKE A;  4U76 A;  3ROR A;  2BWS A;  2P99 A;  2V6C A;  1MAT A;  4A6W A;  2BWT A;  2EVC A;  1R5G A;  3MX6 A;  4OOK A;  1QXW A;  2Q96 A;  3IU7 A;  4RGZ 1;  1PV9 A;  2B3H A;  3IG4 A;  2BWX A;  2EVM A;  4FLK A;  3PKD A;  2GZ5 A;  3PKA A;  4U6Z A;  2P9A A;  1R5H A;  2GU7 A; 
#chains in the Genus database with same CATH topology
 4ZNG A;  4ZWP A;  1WKM A;  1YJ3 A;  3Q6D A;  3PKC A;  2Q94 A;  4S01 A;  2Q92 A;  2OAZ A;  2GG5 A;  2EA4 A;  3RVA A;  1JAW A;  2BWY A;  4FO8 A;  4IDY A;  1W7V A;  4FLJ A;  2GU5 A;  1C21 A;  1YVM A;  4FKC A;  3MR1 A;  4IKU A;  4IPA A;  1R58 A;  3MAT A;  1QXY A;  3IU8 A;  5JHU A;  4S2R P;  2GG3 A;  1KP0 A;  4ZWO A;  3PKB A;  4FO7 A;  1KQ0 A;  4QR8 A;  1XGS A;  4R60 A;  3BIP A;  5CLS A;  5CNX A;  1WL9 A;  1Y1N A;  1KQ9 A;  2GA2 A;  3TB5 A;  4S00 A;  4U6W A;  2BHB A;  1WLR A;  4U69 A;  5E5B A;  4A6V A;  2GTX A;  2GG0 A;  1C23 A;  2V3X A;  2GU4 A;  2G6P A;  1QXZ A;  2EA2 A;  4IU6 A;  1BOA A;  1C22 A;  4IF7 A;  2NQ6 A;  2Q93 A;  1XNZ A;  4Z7M A;  3CTZ A;  1C27 A;  2OKN A;  2BHD A;  2DFI A;  1WN1 A;  2Q8K A;  4IKS A;  1WY2 A;  3IU9 A;  3CB5 A;  2GG9 A;  1WBQ A;  4HXX A;  4U70 A;  4U1B A;  5CDV A;  1XGN A;  4JUQ A;  1BN5 A;  4RZY A;  4U6C A;  2Q95 A;  2IW2 A;  3FMR A;  4U6J A;  1C24 A;  4FLL A;  2NQ7 A;  1YW7 A;  2GG7 A;  2BWW A;  5CDE A;  1M35 A;  3TAV A;  2MAT A;  2GGB A;  2EVO A;  3S6B A;  4U6E A;  5CDL A;  4EGE A;  4IEC A;  1A16 A;  4IKR A;  2HOW A;  4PNC A;  4U71 A;  4S2T P;  5D6F A;  3FMQ A;  4KM3 A;  5FCF A;  1YW9 A;  2GGC A;  5CIK A;  2V3Y A;  1O0X A;  2P98 A;  2BWV A;  3FM3 A;  2BH3 A;  1WL6 A;  2BB7 A;  3BIQ A;  1QZY A;  1B6A A;  2B3L A;  2ADU A;  2BWU A;  3L7G A;  4FLI A;  4IKT A;  3CB6 A;  4MAT A;  2GG8 A;  2V3Z A;  1CHM A;  4FUK A;  2GU6 A;  4U73 A;  2BHA A;  4ZWU A;  3D27 A;  1W2M A;  1N51 A;  3L24 A;  5JFR A;  4PV4 A;  4RZZ A;  5D6E A;  4U75 A;  1XGO A;  2GG2 A;  5CE6 A;  4B28 A;  1XGM A;  1YW8 A;  2B3K A;  2ZSG A;  5FCH A;  5JI6 A;  2BHC A;  3BIT A;  1B59 A;  2BN7 A;  3PKE A;  4U76 A;  3ROR A;  2BWS A;  2P99 A;  2V6C A;  1MAT A;  4A6W A;  2BWT A;  2EVC A;  1R5G A;  3MX6 A;  4OOK A;  1QXW A;  2Q96 A;  3IU7 A;  4RGZ 1;  1PV9 A;  2B3H A;  3IG4 A;  2BWX A;  2EVM A;  4FLK A;  3PKD A;  2GZ5 A;  3PKA A;  4U6Z A;  2P9A A;  1R5H A;  2GU7 A; 
#chains in the Genus database with same CATH homology
 4ZNG A;  4ZWP A;  1WKM A;  1YJ3 A;  3Q6D A;  3PKC A;  2Q94 A;  4S01 A;  2Q92 A;  2OAZ A;  2GG5 A;  2EA4 A;  3RVA A;  1JAW A;  2BWY A;  4FO8 A;  4IDY A;  1W7V A;  4FLJ A;  2GU5 A;  1C21 A;  1YVM A;  4FKC A;  3MR1 A;  4IKU A;  4IPA A;  1R58 A;  3MAT A;  1QXY A;  3IU8 A;  5JHU A;  4S2R P;  2GG3 A;  1KP0 A;  4ZWO A;  3PKB A;  4FO7 A;  1KQ0 A;  4QR8 A;  1XGS A;  4R60 A;  3BIP A;  5CLS A;  5CNX A;  1WL9 A;  1Y1N A;  1KQ9 A;  2GA2 A;  3TB5 A;  4S00 A;  4U6W A;  2BHB A;  1WLR A;  4U69 A;  5E5B A;  4A6V A;  2GTX A;  2GG0 A;  1C23 A;  2V3X A;  2GU4 A;  2G6P A;  1QXZ A;  2EA2 A;  4IU6 A;  1BOA A;  1C22 A;  4IF7 A;  2NQ6 A;  2Q93 A;  1XNZ A;  4Z7M A;  3CTZ A;  1C27 A;  2OKN A;  2BHD A;  2DFI A;  1WN1 A;  2Q8K A;  4IKS A;  1WY2 A;  3IU9 A;  3CB5 A;  2GG9 A;  1WBQ A;  4HXX A;  4U70 A;  4U1B A;  5CDV A;  1XGN A;  4JUQ A;  1BN5 A;  4RZY A;  4U6C A;  2Q95 A;  2IW2 A;  3FMR A;  4U6J A;  1C24 A;  4FLL A;  2NQ7 A;  1YW7 A;  2GG7 A;  2BWW A;  5CDE A;  1M35 A;  3TAV A;  2MAT A;  2GGB A;  2EVO A;  3S6B A;  4U6E A;  5CDL A;  4EGE A;  4IEC A;  1A16 A;  4IKR A;  2HOW A;  4PNC A;  4U71 A;  4S2T P;  5D6F A;  3FMQ A;  4KM3 A;  5FCF A;  1YW9 A;  2GGC A;  5CIK A;  2V3Y A;  1O0X A;  2P98 A;  2BWV A;  3FM3 A;  2BH3 A;  1WL6 A;  2BB7 A;  3BIQ A;  1QZY A;  1B6A A;  2B3L A;  2ADU A;  2BWU A;  3L7G A;  4FLI A;  4IKT A;  3CB6 A;  4MAT A;  2GG8 A;  2V3Z A;  1CHM A;  4FUK A;  2GU6 A;  4U73 A;  2BHA A;  4ZWU A;  3D27 A;  1W2M A;  1N51 A;  3L24 A;  5JFR A;  4PV4 A;  4RZZ A;  5D6E A;  4U75 A;  1XGO A;  2GG2 A;  5CE6 A;  4B28 A;  1XGM A;  1YW8 A;  2B3K A;  2ZSG A;  5FCH A;  5JI6 A;  2BHC A;  3BIT A;  1B59 A;  2BN7 A;  3PKE A;  4U76 A;  3ROR A;  2BWS A;  2P99 A;  2V6C A;  1MAT A;  4A6W A;  2BWT A;  2EVC A;  1R5G A;  3MX6 A;  4OOK A;  1QXW A;  2Q96 A;  3IU7 A;  4RGZ 1;  1PV9 A;  2B3H A;  3IG4 A;  2BWX A;  2EVM A;  4FLK A;  3PKD A;  2GZ5 A;  3PKA A;  4U6Z A;  2P9A A;  1R5H A;  2GU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...