4U1BA

Hsmetap in complex with (1-amino-2-propylpentyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u1bA00
3MR1A 4RGZ1 2ADUA 4A6VA 5CE6A 1BN5A 2MATA 2GU5A 5CNXA 1C21A 1C22A 5JHUA 2P9AA 1QXWA 4IECA 1W7VA 5CLSA 5FCHA 5FCFA 2P98A 3L7GA 4ZWUA 5D6EA 3IU8A 2NQ6A 2Q93A 4U6CA 1XGNA 5JI6A 1WKMA 2BWYA 1WN1A 2V3YA 4Z7MA 2GGBA 1YVMA 4RZZA 4IKSA 5CDLA 1KP0A 4IDYA 4S00A 2Q96A 1XGOA 2GGCA 3BIQA 4A6WA 3CTZA 3RORA 2G6PA 1QXYA 3BITA 2V3ZA 2NQ7A 1A16A 4B28A 3IU7A 2GG9A 2BWVA 4U6JA 4IKUA 2GU7A 4OOKA 1YJ3A 4S2TP 1R58A 3BIPA 4FLIA 4S2RP 1WL6A 2BH3A 2V6CA 3PKCA 1R5HA 2GU4A 2P99A 4U71A 1M35A 1XNZA 2Q95A 4U69A 2BWTA 2EA2A 2BWWA 2EVCA 4FO7A 4ZNGA 2Q92A 1B59A 2B3KA 4FUKA 4IU6A 5D6FA 2GG0A 2BWSA 4U75A 5JFRA 1WL9A 2GU6A 3FM3A 3TAVA 3MX6A 2EVOA 1C27A 4U6ZA 2EVMA 2HOWA 4IPAA 1XGMA 2GG5A 3FMRA 4FLKA 3PKDA 1XGSA 2IW2A 2OAZA 3L24A 4FLJA 4ZWPA 2Q8KA 3S6BA 2BHDA 4MATA 2BWXA 3RVAA 2OKNA 3CB6A 1JAWA 3PKBA 2GZ5A 3MATA 4U70A 4HXXA 4R60A 4S01A 2GG7A 2ZSGA 2GG2A 1YW8A 3IU9A 1KQ0A 4PNCA 4U6EA 2BN7A 3PKAA 2B3HA 1QXZA 4RZYA 3CB5A 3IG4A 3FMQA 4FO8A 2BWUA 5E5BA 3D27A 1KQ9A 2Q94A 1C23A 5CDVA 1N51A 5CDEA 4EGEA 1O0XA 2DFIA 4FKCA 2EA4A 4FLLA 1B6AA 4PV4A 3PKEA 1QZYA 1W2MA 4ZWOA 3TB5A 2GG3A 1R5GA 1C24A 2GA2A 1WLRA 2BHBA 4QR8A 4IKRA 4U76A 1PV9A 4U1BA 2BB7A 2BHAA 2GTXA 5CIKA 2B3LA 3Q6DA 4IKTA 4IF7A 1CHMA 1WBQA 2V3XA 1YW9A 4U6WA 4KM3A 4U73A 1YW7A 4JUQA 1WY2A 1BOAA 1Y1NA 2GG8A 1MATA 2BHCA
chains in the Genus database with same CATH superfamily
3MR1A 4RGZ1 2ADUA 4A6VA 5CE6A 1BN5A 2MATA 2GU5A 5CNXA 1C21A 1C22A 5JHUA 2P9AA 1QXWA 4IECA 1W7VA 5CLSA 5FCHA 5FCFA 2P98A 3L7GA 4ZWUA 5D6EA 3IU8A 2NQ6A 2Q93A 4U6CA 1XGNA 5JI6A 1WKMA 2BWYA 1WN1A 2V3YA 4Z7MA 2GGBA 1YVMA 4RZZA 4IKSA 5CDLA 1KP0A 4IDYA 4S00A 2Q96A 1XGOA 2GGCA 3BIQA 4A6WA 3CTZA 3RORA 2G6PA 1QXYA 3BITA 2V3ZA 2NQ7A 1A16A 4B28A 3IU7A 2GG9A 2BWVA 4U6JA 4IKUA 2GU7A 4OOKA 1YJ3A 4S2TP 1R58A 3BIPA 4FLIA 4S2RP 1WL6A 2BH3A 2V6CA 3PKCA 1R5HA 2GU4A 2P99A 4U71A 1M35A 1XNZA 2Q95A 4U69A 2BWTA 2EA2A 2BWWA 2EVCA 4FO7A 4ZNGA 2Q92A 1B59A 2B3KA 4FUKA 4IU6A 5D6FA 2GG0A 2BWSA 4U75A 5JFRA 1WL9A 2GU6A 3FM3A 3TAVA 3MX6A 2EVOA 1C27A 4U6ZA 2EVMA 2HOWA 4IPAA 1XGMA 2GG5A 3FMRA 4FLKA 3PKDA 1XGSA 2IW2A 2OAZA 3L24A 4FLJA 4ZWPA 2Q8KA 3S6BA 2BHDA 4MATA 2BWXA 3RVAA 2OKNA 3CB6A 1JAWA 3PKBA 2GZ5A 3MATA 4U70A 4HXXA 4R60A 4S01A 2GG7A 2ZSGA 2GG2A 1YW8A 3IU9A 1KQ0A 4PNCA 4U6EA 2BN7A 3PKAA 2B3HA 1QXZA 4RZYA 3CB5A 3IG4A 3FMQA 4FO8A 2BWUA 5E5BA 3D27A 1KQ9A 2Q94A 1C23A 5CDVA 1N51A 5CDEA 4EGEA 1O0XA 2DFIA 4FKCA 2EA4A 4FLLA 1B6AA 4PV4A 3PKEA 1QZYA 1W2MA 4ZWOA 3TB5A 2GG3A 1R5GA 1C24A 2GA2A 1WLRA 2BHBA 4QR8A 4IKRA 4U76A 1PV9A 4U1BA 2BB7A 2BHAA 2GTXA 5CIKA 2B3LA 3Q6DA 4IKTA 4IF7A 1CHMA 1WBQA 2V3XA 1YW9A 4U6WA 4KM3A 4U73A 1YW7A 4JUQA 1WY2A 1BOAA 1Y1NA 2GG8A 1MATA 2BHCA
chains in the Genus database with same CATH topology
3MR1A 4RGZ1 2ADUA 4A6VA 5CE6A 1BN5A 2MATA 2GU5A 5CNXA 1C21A 1C22A 5JHUA 2P9AA 1QXWA 4IECA 1W7VA 5CLSA 5FCHA 5FCFA 2P98A 3L7GA 4ZWUA 5D6EA 3IU8A 2NQ6A 2Q93A 4U6CA 1XGNA 5JI6A 1WKMA 2BWYA 1WN1A 2V3YA 4Z7MA 2GGBA 1YVMA 4RZZA 4IKSA 5CDLA 1KP0A 4IDYA 4S00A 2Q96A 1XGOA 2GGCA 3BIQA 4A6WA 3CTZA 3RORA 2G6PA 1QXYA 3BITA 2V3ZA 2NQ7A 1A16A 4B28A 3IU7A 2GG9A 2BWVA 4U6JA 4IKUA 2GU7A 4OOKA 1YJ3A 4S2TP 1R58A 3BIPA 4FLIA 4S2RP 1WL6A 2BH3A 2V6CA 3PKCA 1R5HA 2GU4A 2P99A 4U71A 1M35A 1XNZA 2Q95A 4U69A 2BWTA 2EA2A 2BWWA 2EVCA 4FO7A 4ZNGA 2Q92A 1B59A 2B3KA 4FUKA 4IU6A 5D6FA 2GG0A 2BWSA 4U75A 5JFRA 1WL9A 2GU6A 3FM3A 3TAVA 3MX6A 2EVOA 1C27A 4U6ZA 2EVMA 2HOWA 4IPAA 1XGMA 2GG5A 3FMRA 4FLKA 3PKDA 1XGSA 2IW2A 2OAZA 3L24A 4FLJA 4ZWPA 2Q8KA 3S6BA 2BHDA 4MATA 2BWXA 3RVAA 2OKNA 3CB6A 1JAWA 3PKBA 2GZ5A 3MATA 4U70A 4HXXA 4R60A 4S01A 2GG7A 2ZSGA 2GG2A 1YW8A 3IU9A 1KQ0A 4PNCA 4U6EA 2BN7A 3PKAA 2B3HA 1QXZA 4RZYA 3CB5A 3IG4A 3FMQA 4FO8A 2BWUA 5E5BA 3D27A 1KQ9A 2Q94A 1C23A 5CDVA 1N51A 5CDEA 4EGEA 1O0XA 2DFIA 4FKCA 2EA4A 4FLLA 1B6AA 4PV4A 3PKEA 1QZYA 1W2MA 4ZWOA 3TB5A 2GG3A 1R5GA 1C24A 2GA2A 1WLRA 2BHBA 4QR8A 4IKRA 4U76A 1PV9A 4U1BA 2BB7A 2BHAA 2GTXA 5CIKA 2B3LA 3Q6DA 4IKTA 4IF7A 1CHMA 1WBQA 2V3XA 1YW9A 4U6WA 4KM3A 4U73A 1YW7A 4JUQA 1WY2A 1BOAA 1Y1NA 2GG8A 1MATA 2BHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MR1 A;  4RGZ 1;  2ADU A;  4A6V A;  5CE6 A;  1BN5 A;  2MAT A;  2GU5 A;  5CNX A;  1C21 A;  1C22 A;  5JHU A;  2P9A A;  1QXW A;  4IEC A;  1W7V A;  5CLS A;  5FCH A;  5FCF A;  2P98 A;  3L7G A;  4ZWU A;  5D6E A;  3IU8 A;  2NQ6 A;  2Q93 A;  4U6C A;  1XGN A;  5JI6 A;  1WKM A;  2BWY A;  1WN1 A;  2V3Y A;  4Z7M A;  2GGB A;  1YVM A;  4RZZ A;  4IKS A;  5CDL A;  1KP0 A;  4IDY A;  4S00 A;  2Q96 A;  1XGO A;  2GGC A;  3BIQ A;  4A6W A;  3CTZ A;  3ROR A;  2G6P A;  1QXY A;  3BIT A;  2V3Z A;  2NQ7 A;  1A16 A;  4B28 A;  3IU7 A;  2GG9 A;  2BWV A;  4U6J A;  4IKU A;  2GU7 A;  4OOK A;  1YJ3 A;  4S2T P;  1R58 A;  3BIP A;  4FLI A;  4S2R P;  1WL6 A;  2BH3 A;  2V6C A;  3PKC A;  1R5H A;  2GU4 A;  2P99 A;  4U71 A;  1M35 A;  1XNZ A;  2Q95 A;  4U69 A;  2BWT A;  2EA2 A;  2BWW A;  2EVC A;  4FO7 A;  4ZNG A;  2Q92 A;  1B59 A;  2B3K A;  4FUK A;  4IU6 A;  5D6F A;  2GG0 A;  2BWS A;  4U75 A;  5JFR A;  1WL9 A;  2GU6 A;  3FM3 A;  3TAV A;  3MX6 A;  2EVO A;  1C27 A;  4U6Z A;  2EVM A;  2HOW A;  4IPA A;  1XGM A;  2GG5 A;  3FMR A;  4FLK A;  3PKD A;  1XGS A;  2IW2 A;  2OAZ A;  3L24 A;  4FLJ A;  4ZWP A;  2Q8K A;  3S6B A;  2BHD A;  4MAT A;  2BWX A;  3RVA A;  2OKN A;  3CB6 A;  1JAW A;  3PKB A;  2GZ5 A;  3MAT A;  4U70 A;  4HXX A;  4R60 A;  4S01 A;  2GG7 A;  2ZSG A;  2GG2 A;  1YW8 A;  3IU9 A;  1KQ0 A;  4PNC A;  4U6E A;  2BN7 A;  3PKA A;  2B3H A;  1QXZ A;  4RZY A;  3CB5 A;  3IG4 A;  3FMQ A;  4FO8 A;  2BWU A;  5E5B A;  3D27 A;  1KQ9 A;  2Q94 A;  1C23 A;  5CDV A;  1N51 A;  5CDE A;  4EGE A;  1O0X A;  2DFI A;  4FKC A;  2EA4 A;  4FLL A;  1B6A A;  4PV4 A;  3PKE A;  1QZY A;  1W2M A;  4ZWO A;  3TB5 A;  2GG3 A;  1R5G A;  1C24 A;  2GA2 A;  1WLR A;  2BHB A;  4QR8 A;  4IKR A;  4U76 A;  1PV9 A;  4U1B A;  2BB7 A;  2BHA A;  2GTX A;  5CIK A;  2B3L A;  3Q6D A;  4IKT A;  4IF7 A;  1CHM A;  1WBQ A;  2V3X A;  1YW9 A;  4U6W A;  4KM3 A;  4U73 A;  1YW7 A;  4JUQ A;  1WY2 A;  1BOA A;  1Y1N A;  2GG8 A;  1MAT A;  2BHC A; 
#chains in the Genus database with same CATH topology
 3MR1 A;  4RGZ 1;  2ADU A;  4A6V A;  5CE6 A;  1BN5 A;  2MAT A;  2GU5 A;  5CNX A;  1C21 A;  1C22 A;  5JHU A;  2P9A A;  1QXW A;  4IEC A;  1W7V A;  5CLS A;  5FCH A;  5FCF A;  2P98 A;  3L7G A;  4ZWU A;  5D6E A;  3IU8 A;  2NQ6 A;  2Q93 A;  4U6C A;  1XGN A;  5JI6 A;  1WKM A;  2BWY A;  1WN1 A;  2V3Y A;  4Z7M A;  2GGB A;  1YVM A;  4RZZ A;  4IKS A;  5CDL A;  1KP0 A;  4IDY A;  4S00 A;  2Q96 A;  1XGO A;  2GGC A;  3BIQ A;  4A6W A;  3CTZ A;  3ROR A;  2G6P A;  1QXY A;  3BIT A;  2V3Z A;  2NQ7 A;  1A16 A;  4B28 A;  3IU7 A;  2GG9 A;  2BWV A;  4U6J A;  4IKU A;  2GU7 A;  4OOK A;  1YJ3 A;  4S2T P;  1R58 A;  3BIP A;  4FLI A;  4S2R P;  1WL6 A;  2BH3 A;  2V6C A;  3PKC A;  1R5H A;  2GU4 A;  2P99 A;  4U71 A;  1M35 A;  1XNZ A;  2Q95 A;  4U69 A;  2BWT A;  2EA2 A;  2BWW A;  2EVC A;  4FO7 A;  4ZNG A;  2Q92 A;  1B59 A;  2B3K A;  4FUK A;  4IU6 A;  5D6F A;  2GG0 A;  2BWS A;  4U75 A;  5JFR A;  1WL9 A;  2GU6 A;  3FM3 A;  3TAV A;  3MX6 A;  2EVO A;  1C27 A;  4U6Z A;  2EVM A;  2HOW A;  4IPA A;  1XGM A;  2GG5 A;  3FMR A;  4FLK A;  3PKD A;  1XGS A;  2IW2 A;  2OAZ A;  3L24 A;  4FLJ A;  4ZWP A;  2Q8K A;  3S6B A;  2BHD A;  4MAT A;  2BWX A;  3RVA A;  2OKN A;  3CB6 A;  1JAW A;  3PKB A;  2GZ5 A;  3MAT A;  4U70 A;  4HXX A;  4R60 A;  4S01 A;  2GG7 A;  2ZSG A;  2GG2 A;  1YW8 A;  3IU9 A;  1KQ0 A;  4PNC A;  4U6E A;  2BN7 A;  3PKA A;  2B3H A;  1QXZ A;  4RZY A;  3CB5 A;  3IG4 A;  3FMQ A;  4FO8 A;  2BWU A;  5E5B A;  3D27 A;  1KQ9 A;  2Q94 A;  1C23 A;  5CDV A;  1N51 A;  5CDE A;  4EGE A;  1O0X A;  2DFI A;  4FKC A;  2EA4 A;  4FLL A;  1B6A A;  4PV4 A;  3PKE A;  1QZY A;  1W2M A;  4ZWO A;  3TB5 A;  2GG3 A;  1R5G A;  1C24 A;  2GA2 A;  1WLR A;  2BHB A;  4QR8 A;  4IKR A;  4U76 A;  1PV9 A;  4U1B A;  2BB7 A;  2BHA A;  2GTX A;  5CIK A;  2B3L A;  3Q6D A;  4IKT A;  4IF7 A;  1CHM A;  1WBQ A;  2V3X A;  1YW9 A;  4U6W A;  4KM3 A;  4U73 A;  1YW7 A;  4JUQ A;  1WY2 A;  1BOA A;  1Y1N A;  2GG8 A;  1MAT A;  2BHC A; 
#chains in the Genus database with same CATH homology
 3MR1 A;  4RGZ 1;  2ADU A;  4A6V A;  5CE6 A;  1BN5 A;  2MAT A;  2GU5 A;  5CNX A;  1C21 A;  1C22 A;  5JHU A;  2P9A A;  1QXW A;  4IEC A;  1W7V A;  5CLS A;  5FCH A;  5FCF A;  2P98 A;  3L7G A;  4ZWU A;  5D6E A;  3IU8 A;  2NQ6 A;  2Q93 A;  4U6C A;  1XGN A;  5JI6 A;  1WKM A;  2BWY A;  1WN1 A;  2V3Y A;  4Z7M A;  2GGB A;  1YVM A;  4RZZ A;  4IKS A;  5CDL A;  1KP0 A;  4IDY A;  4S00 A;  2Q96 A;  1XGO A;  2GGC A;  3BIQ A;  4A6W A;  3CTZ A;  3ROR A;  2G6P A;  1QXY A;  3BIT A;  2V3Z A;  2NQ7 A;  1A16 A;  4B28 A;  3IU7 A;  2GG9 A;  2BWV A;  4U6J A;  4IKU A;  2GU7 A;  4OOK A;  1YJ3 A;  4S2T P;  1R58 A;  3BIP A;  4FLI A;  4S2R P;  1WL6 A;  2BH3 A;  2V6C A;  3PKC A;  1R5H A;  2GU4 A;  2P99 A;  4U71 A;  1M35 A;  1XNZ A;  2Q95 A;  4U69 A;  2BWT A;  2EA2 A;  2BWW A;  2EVC A;  4FO7 A;  4ZNG A;  2Q92 A;  1B59 A;  2B3K A;  4FUK A;  4IU6 A;  5D6F A;  2GG0 A;  2BWS A;  4U75 A;  5JFR A;  1WL9 A;  2GU6 A;  3FM3 A;  3TAV A;  3MX6 A;  2EVO A;  1C27 A;  4U6Z A;  2EVM A;  2HOW A;  4IPA A;  1XGM A;  2GG5 A;  3FMR A;  4FLK A;  3PKD A;  1XGS A;  2IW2 A;  2OAZ A;  3L24 A;  4FLJ A;  4ZWP A;  2Q8K A;  3S6B A;  2BHD A;  4MAT A;  2BWX A;  3RVA A;  2OKN A;  3CB6 A;  1JAW A;  3PKB A;  2GZ5 A;  3MAT A;  4U70 A;  4HXX A;  4R60 A;  4S01 A;  2GG7 A;  2ZSG A;  2GG2 A;  1YW8 A;  3IU9 A;  1KQ0 A;  4PNC A;  4U6E A;  2BN7 A;  3PKA A;  2B3H A;  1QXZ A;  4RZY A;  3CB5 A;  3IG4 A;  3FMQ A;  4FO8 A;  2BWU A;  5E5B A;  3D27 A;  1KQ9 A;  2Q94 A;  1C23 A;  5CDV A;  1N51 A;  5CDE A;  4EGE A;  1O0X A;  2DFI A;  4FKC A;  2EA4 A;  4FLL A;  1B6A A;  4PV4 A;  3PKE A;  1QZY A;  1W2M A;  4ZWO A;  3TB5 A;  2GG3 A;  1R5G A;  1C24 A;  2GA2 A;  1WLR A;  2BHB A;  4QR8 A;  4IKR A;  4U76 A;  1PV9 A;  4U1B A;  2BB7 A;  2BHA A;  2GTX A;  5CIK A;  2B3L A;  3Q6D A;  4IKT A;  4IF7 A;  1CHM A;  1WBQ A;  2V3X A;  1YW9 A;  4U6W A;  4KM3 A;  4U73 A;  1YW7 A;  4JUQ A;  1WY2 A;  1BOA A;  1Y1N A;  2GG8 A;  1MAT A;  2BHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...