4U1BA

Hsmetap in complex with (1-amino-2-propylpentyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u1bA00
3RORA 2B3LA 1YW9A 2B3KA 2DFIA 2GU6A 1WY2A 3PKDA 2GZ5A 4A6VA 4FLJA 3BIPA 1YW7A 3MX6A 4B28A 2BWYA 4ZWUA 2HOWA 2BB7A 2BH3A 1YJ3A 2BWSA 3MATA 4S00A 4U6CA 5JI6A 2IW2A 3CTZA 4U6JA 2Q94A 1N51A 5CNXA 1WLRA 2OAZA 3FM3A 4MATA 4ZNGA 3TB5A 4IDYA 1A16A 2P99A 5JFRA 2GTXA 2BN7A 1C27A 2P98A 4FO7A 4R60A 1WL9A 1WL6A 2BHCA 2EVOA 4FLLA 1QXWA 1R5GA 1PV9A 1M35A 2GG8A 3BIQA 2EA4A 4U73A 4U6WA 1QXYA 5CIKA 5CDEA 2BWWA 1C24A 2EA2A 3L24A 1KQ9A 1XGNA 4U70A 3S6BA 5JHUA 2Q8KA 1W2MA 2EVCA 4Z7MA 1XGMA 2BWTA 4FUKA 3IU9A 4RGZ1 2ZSGA 4RZYA 2Q92A 4IF7A 4KM3A 4IKRA 2G6PA 1XGOA 4U1BA 4JUQA 3TAVA 1QZYA 2NQ7A 4IKTA 2ADUA 3FMQA 2GA2A 2GU5A 2GU4A 4PNCA 4U6ZA 2GG2A 2V3ZA 4FLIA 3PKBA 1XNZA 2GGCA 1BOAA 3IU7A 4ZWPA 1WKMA 4ZWOA 4U69A 3PKAA 1C21A 3IG4A 2V3YA 2V3XA 2BWXA 4U76A 4S2TP 5D6FA 2V6CA 1Y1NA 4FO8A 1R58A 5CDVA 4U71A 4IECA 1B59A 1KQ0A 2GG0A 5CE6A 5D6EA 1MATA 1R5HA 2NQ6A 2OKNA 5FCHA 2GG5A 4IU6A 1C23A 3RVAA 1WBQA 3D27A 2GU7A 2Q95A 3CB6A 3IU8A 4EGEA 2GGBA 4OOKA 5CLSA 2BHAA 5CDLA 1WN1A 3L7GA 2B3HA 1CHMA 1YW8A 2Q96A 2GG9A 2EVMA 4IKUA 4S2RP 4IKSA 3MR1A 3Q6DA 1BN5A 1O0XA 5E5BA 1QXZA 3PKEA 4U6EA 1W7VA 2MATA 3BITA 1JAWA 4FKCA 2P9AA 2BHDA 2BWUA 4FLKA 1KP0A 2GG7A 2GG3A 4QR8A 4U75A 4HXXA 5FCFA 3CB5A 1B6AA 1YVMA 4PV4A 4RZZA 2BWVA 2Q93A 4IPAA 3PKCA 3FMRA 4A6WA 1XGSA 4S01A 2BHBA 1C22A
chains in the Genus database with same CATH superfamily
3RORA 2B3LA 1YW9A 2B3KA 2DFIA 2GU6A 1WY2A 3PKDA 2GZ5A 4A6VA 4FLJA 3BIPA 1YW7A 3MX6A 4B28A 2BWYA 4ZWUA 2HOWA 2BB7A 2BH3A 1YJ3A 2BWSA 3MATA 4S00A 4U6CA 5JI6A 2IW2A 3CTZA 4U6JA 2Q94A 1N51A 5CNXA 1WLRA 2OAZA 3FM3A 4MATA 4ZNGA 3TB5A 4IDYA 1A16A 2P99A 5JFRA 2GTXA 2BN7A 1C27A 2P98A 4FO7A 4R60A 1WL9A 1WL6A 2BHCA 2EVOA 4FLLA 1QXWA 1R5GA 1PV9A 1M35A 2GG8A 3BIQA 2EA4A 4U73A 4U6WA 1QXYA 5CIKA 5CDEA 2BWWA 1C24A 2EA2A 3L24A 1KQ9A 1XGNA 4U70A 3S6BA 5JHUA 2Q8KA 1W2MA 2EVCA 4Z7MA 1XGMA 2BWTA 4FUKA 3IU9A 4RGZ1 2ZSGA 4RZYA 2Q92A 4IF7A 4KM3A 4IKRA 2G6PA 1XGOA 4U1BA 4JUQA 3TAVA 1QZYA 2NQ7A 4IKTA 2ADUA 3FMQA 2GA2A 2GU5A 2GU4A 4PNCA 4U6ZA 2GG2A 2V3ZA 4FLIA 3PKBA 1XNZA 2GGCA 1BOAA 3IU7A 4ZWPA 1WKMA 4ZWOA 4U69A 3PKAA 1C21A 3IG4A 2V3YA 2V3XA 2BWXA 4U76A 4S2TP 5D6FA 2V6CA 1Y1NA 4FO8A 1R58A 5CDVA 4U71A 4IECA 1B59A 1KQ0A 2GG0A 5CE6A 5D6EA 1MATA 1R5HA 2NQ6A 2OKNA 5FCHA 2GG5A 4IU6A 1C23A 3RVAA 1WBQA 3D27A 2GU7A 2Q95A 3CB6A 3IU8A 4EGEA 2GGBA 4OOKA 5CLSA 2BHAA 5CDLA 1WN1A 3L7GA 2B3HA 1CHMA 1YW8A 2Q96A 2GG9A 2EVMA 4IKUA 4S2RP 4IKSA 3MR1A 3Q6DA 1BN5A 1O0XA 5E5BA 1QXZA 3PKEA 4U6EA 1W7VA 2MATA 3BITA 1JAWA 4FKCA 2P9AA 2BHDA 2BWUA 4FLKA 1KP0A 2GG7A 2GG3A 4QR8A 4U75A 4HXXA 5FCFA 3CB5A 1B6AA 1YVMA 4PV4A 4RZZA 2BWVA 2Q93A 4IPAA 3PKCA 3FMRA 4A6WA 1XGSA 4S01A 2BHBA 1C22A
chains in the Genus database with same CATH topology
3RORA 2B3LA 1YW9A 2B3KA 2DFIA 2GU6A 1WY2A 3PKDA 2GZ5A 4A6VA 4FLJA 3BIPA 1YW7A 3MX6A 4B28A 2BWYA 4ZWUA 2HOWA 2BB7A 2BH3A 1YJ3A 2BWSA 3MATA 4S00A 4U6CA 5JI6A 2IW2A 3CTZA 4U6JA 2Q94A 1N51A 5CNXA 1WLRA 2OAZA 3FM3A 4MATA 4ZNGA 3TB5A 4IDYA 1A16A 2P99A 5JFRA 2GTXA 2BN7A 1C27A 2P98A 4FO7A 4R60A 1WL9A 1WL6A 2BHCA 2EVOA 4FLLA 1QXWA 1R5GA 1PV9A 1M35A 2GG8A 3BIQA 2EA4A 4U73A 4U6WA 1QXYA 5CIKA 5CDEA 2BWWA 1C24A 2EA2A 3L24A 1KQ9A 1XGNA 4U70A 3S6BA 5JHUA 2Q8KA 1W2MA 2EVCA 4Z7MA 1XGMA 2BWTA 4FUKA 3IU9A 4RGZ1 2ZSGA 4RZYA 2Q92A 4IF7A 4KM3A 4IKRA 2G6PA 1XGOA 4U1BA 4JUQA 3TAVA 1QZYA 2NQ7A 4IKTA 2ADUA 3FMQA 2GA2A 2GU5A 2GU4A 4PNCA 4U6ZA 2GG2A 2V3ZA 4FLIA 3PKBA 1XNZA 2GGCA 1BOAA 3IU7A 4ZWPA 1WKMA 4ZWOA 4U69A 3PKAA 1C21A 3IG4A 2V3YA 2V3XA 2BWXA 4U76A 4S2TP 5D6FA 2V6CA 1Y1NA 4FO8A 1R58A 5CDVA 4U71A 4IECA 1B59A 1KQ0A 2GG0A 5CE6A 5D6EA 1MATA 1R5HA 2NQ6A 2OKNA 5FCHA 2GG5A 4IU6A 1C23A 3RVAA 1WBQA 3D27A 2GU7A 2Q95A 3CB6A 3IU8A 4EGEA 2GGBA 4OOKA 5CLSA 2BHAA 5CDLA 1WN1A 3L7GA 2B3HA 1CHMA 1YW8A 2Q96A 2GG9A 2EVMA 4IKUA 4S2RP 4IKSA 3MR1A 3Q6DA 1BN5A 1O0XA 5E5BA 1QXZA 3PKEA 4U6EA 1W7VA 2MATA 3BITA 1JAWA 4FKCA 2P9AA 2BHDA 2BWUA 4FLKA 1KP0A 2GG7A 2GG3A 4QR8A 4U75A 4HXXA 5FCFA 3CB5A 1B6AA 1YVMA 4PV4A 4RZZA 2BWVA 2Q93A 4IPAA 3PKCA 3FMRA 4A6WA 1XGSA 4S01A 2BHBA 1C22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ROR A;  2B3L A;  1YW9 A;  2B3K A;  2DFI A;  2GU6 A;  1WY2 A;  3PKD A;  2GZ5 A;  4A6V A;  4FLJ A;  3BIP A;  1YW7 A;  3MX6 A;  4B28 A;  2BWY A;  4ZWU A;  2HOW A;  2BB7 A;  2BH3 A;  1YJ3 A;  2BWS A;  3MAT A;  4S00 A;  4U6C A;  5JI6 A;  2IW2 A;  3CTZ A;  4U6J A;  2Q94 A;  1N51 A;  5CNX A;  1WLR A;  2OAZ A;  3FM3 A;  4MAT A;  4ZNG A;  3TB5 A;  4IDY A;  1A16 A;  2P99 A;  5JFR A;  2GTX A;  2BN7 A;  1C27 A;  2P98 A;  4FO7 A;  4R60 A;  1WL9 A;  1WL6 A;  2BHC A;  2EVO A;  4FLL A;  1QXW A;  1R5G A;  1PV9 A;  1M35 A;  2GG8 A;  3BIQ A;  2EA4 A;  4U73 A;  4U6W A;  1QXY A;  5CIK A;  5CDE A;  2BWW A;  1C24 A;  2EA2 A;  3L24 A;  1KQ9 A;  1XGN A;  4U70 A;  3S6B A;  5JHU A;  2Q8K A;  1W2M A;  2EVC A;  4Z7M A;  1XGM A;  2BWT A;  4FUK A;  3IU9 A;  4RGZ 1;  2ZSG A;  4RZY A;  2Q92 A;  4IF7 A;  4KM3 A;  4IKR A;  2G6P A;  1XGO A;  4U1B A;  4JUQ A;  3TAV A;  1QZY A;  2NQ7 A;  4IKT A;  2ADU A;  3FMQ A;  2GA2 A;  2GU5 A;  2GU4 A;  4PNC A;  4U6Z A;  2GG2 A;  2V3Z A;  4FLI A;  3PKB A;  1XNZ A;  2GGC A;  1BOA A;  3IU7 A;  4ZWP A;  1WKM A;  4ZWO A;  4U69 A;  3PKA A;  1C21 A;  3IG4 A;  2V3Y A;  2V3X A;  2BWX A;  4U76 A;  4S2T P;  5D6F A;  2V6C A;  1Y1N A;  4FO8 A;  1R58 A;  5CDV A;  4U71 A;  4IEC A;  1B59 A;  1KQ0 A;  2GG0 A;  5CE6 A;  5D6E A;  1MAT A;  1R5H A;  2NQ6 A;  2OKN A;  5FCH A;  2GG5 A;  4IU6 A;  1C23 A;  3RVA A;  1WBQ A;  3D27 A;  2GU7 A;  2Q95 A;  3CB6 A;  3IU8 A;  4EGE A;  2GGB A;  4OOK A;  5CLS A;  2BHA A;  5CDL A;  1WN1 A;  3L7G A;  2B3H A;  1CHM A;  1YW8 A;  2Q96 A;  2GG9 A;  2EVM A;  4IKU A;  4S2R P;  4IKS A;  3MR1 A;  3Q6D A;  1BN5 A;  1O0X A;  5E5B A;  1QXZ A;  3PKE A;  4U6E A;  1W7V A;  2MAT A;  3BIT A;  1JAW A;  4FKC A;  2P9A A;  2BHD A;  2BWU A;  4FLK A;  1KP0 A;  2GG7 A;  2GG3 A;  4QR8 A;  4U75 A;  4HXX A;  5FCF A;  3CB5 A;  1B6A A;  1YVM A;  4PV4 A;  4RZZ A;  2BWV A;  2Q93 A;  4IPA A;  3PKC A;  3FMR A;  4A6W A;  1XGS A;  4S01 A;  2BHB A;  1C22 A; 
#chains in the Genus database with same CATH topology
 3ROR A;  2B3L A;  1YW9 A;  2B3K A;  2DFI A;  2GU6 A;  1WY2 A;  3PKD A;  2GZ5 A;  4A6V A;  4FLJ A;  3BIP A;  1YW7 A;  3MX6 A;  4B28 A;  2BWY A;  4ZWU A;  2HOW A;  2BB7 A;  2BH3 A;  1YJ3 A;  2BWS A;  3MAT A;  4S00 A;  4U6C A;  5JI6 A;  2IW2 A;  3CTZ A;  4U6J A;  2Q94 A;  1N51 A;  5CNX A;  1WLR A;  2OAZ A;  3FM3 A;  4MAT A;  4ZNG A;  3TB5 A;  4IDY A;  1A16 A;  2P99 A;  5JFR A;  2GTX A;  2BN7 A;  1C27 A;  2P98 A;  4FO7 A;  4R60 A;  1WL9 A;  1WL6 A;  2BHC A;  2EVO A;  4FLL A;  1QXW A;  1R5G A;  1PV9 A;  1M35 A;  2GG8 A;  3BIQ A;  2EA4 A;  4U73 A;  4U6W A;  1QXY A;  5CIK A;  5CDE A;  2BWW A;  1C24 A;  2EA2 A;  3L24 A;  1KQ9 A;  1XGN A;  4U70 A;  3S6B A;  5JHU A;  2Q8K A;  1W2M A;  2EVC A;  4Z7M A;  1XGM A;  2BWT A;  4FUK A;  3IU9 A;  4RGZ 1;  2ZSG A;  4RZY A;  2Q92 A;  4IF7 A;  4KM3 A;  4IKR A;  2G6P A;  1XGO A;  4U1B A;  4JUQ A;  3TAV A;  1QZY A;  2NQ7 A;  4IKT A;  2ADU A;  3FMQ A;  2GA2 A;  2GU5 A;  2GU4 A;  4PNC A;  4U6Z A;  2GG2 A;  2V3Z A;  4FLI A;  3PKB A;  1XNZ A;  2GGC A;  1BOA A;  3IU7 A;  4ZWP A;  1WKM A;  4ZWO A;  4U69 A;  3PKA A;  1C21 A;  3IG4 A;  2V3Y A;  2V3X A;  2BWX A;  4U76 A;  4S2T P;  5D6F A;  2V6C A;  1Y1N A;  4FO8 A;  1R58 A;  5CDV A;  4U71 A;  4IEC A;  1B59 A;  1KQ0 A;  2GG0 A;  5CE6 A;  5D6E A;  1MAT A;  1R5H A;  2NQ6 A;  2OKN A;  5FCH A;  2GG5 A;  4IU6 A;  1C23 A;  3RVA A;  1WBQ A;  3D27 A;  2GU7 A;  2Q95 A;  3CB6 A;  3IU8 A;  4EGE A;  2GGB A;  4OOK A;  5CLS A;  2BHA A;  5CDL A;  1WN1 A;  3L7G A;  2B3H A;  1CHM A;  1YW8 A;  2Q96 A;  2GG9 A;  2EVM A;  4IKU A;  4S2R P;  4IKS A;  3MR1 A;  3Q6D A;  1BN5 A;  1O0X A;  5E5B A;  1QXZ A;  3PKE A;  4U6E A;  1W7V A;  2MAT A;  3BIT A;  1JAW A;  4FKC A;  2P9A A;  2BHD A;  2BWU A;  4FLK A;  1KP0 A;  2GG7 A;  2GG3 A;  4QR8 A;  4U75 A;  4HXX A;  5FCF A;  3CB5 A;  1B6A A;  1YVM A;  4PV4 A;  4RZZ A;  2BWV A;  2Q93 A;  4IPA A;  3PKC A;  3FMR A;  4A6W A;  1XGS A;  4S01 A;  2BHB A;  1C22 A; 
#chains in the Genus database with same CATH homology
 3ROR A;  2B3L A;  1YW9 A;  2B3K A;  2DFI A;  2GU6 A;  1WY2 A;  3PKD A;  2GZ5 A;  4A6V A;  4FLJ A;  3BIP A;  1YW7 A;  3MX6 A;  4B28 A;  2BWY A;  4ZWU A;  2HOW A;  2BB7 A;  2BH3 A;  1YJ3 A;  2BWS A;  3MAT A;  4S00 A;  4U6C A;  5JI6 A;  2IW2 A;  3CTZ A;  4U6J A;  2Q94 A;  1N51 A;  5CNX A;  1WLR A;  2OAZ A;  3FM3 A;  4MAT A;  4ZNG A;  3TB5 A;  4IDY A;  1A16 A;  2P99 A;  5JFR A;  2GTX A;  2BN7 A;  1C27 A;  2P98 A;  4FO7 A;  4R60 A;  1WL9 A;  1WL6 A;  2BHC A;  2EVO A;  4FLL A;  1QXW A;  1R5G A;  1PV9 A;  1M35 A;  2GG8 A;  3BIQ A;  2EA4 A;  4U73 A;  4U6W A;  1QXY A;  5CIK A;  5CDE A;  2BWW A;  1C24 A;  2EA2 A;  3L24 A;  1KQ9 A;  1XGN A;  4U70 A;  3S6B A;  5JHU A;  2Q8K A;  1W2M A;  2EVC A;  4Z7M A;  1XGM A;  2BWT A;  4FUK A;  3IU9 A;  4RGZ 1;  2ZSG A;  4RZY A;  2Q92 A;  4IF7 A;  4KM3 A;  4IKR A;  2G6P A;  1XGO A;  4U1B A;  4JUQ A;  3TAV A;  1QZY A;  2NQ7 A;  4IKT A;  2ADU A;  3FMQ A;  2GA2 A;  2GU5 A;  2GU4 A;  4PNC A;  4U6Z A;  2GG2 A;  2V3Z A;  4FLI A;  3PKB A;  1XNZ A;  2GGC A;  1BOA A;  3IU7 A;  4ZWP A;  1WKM A;  4ZWO A;  4U69 A;  3PKA A;  1C21 A;  3IG4 A;  2V3Y A;  2V3X A;  2BWX A;  4U76 A;  4S2T P;  5D6F A;  2V6C A;  1Y1N A;  4FO8 A;  1R58 A;  5CDV A;  4U71 A;  4IEC A;  1B59 A;  1KQ0 A;  2GG0 A;  5CE6 A;  5D6E A;  1MAT A;  1R5H A;  2NQ6 A;  2OKN A;  5FCH A;  2GG5 A;  4IU6 A;  1C23 A;  3RVA A;  1WBQ A;  3D27 A;  2GU7 A;  2Q95 A;  3CB6 A;  3IU8 A;  4EGE A;  2GGB A;  4OOK A;  5CLS A;  2BHA A;  5CDL A;  1WN1 A;  3L7G A;  2B3H A;  1CHM A;  1YW8 A;  2Q96 A;  2GG9 A;  2EVM A;  4IKU A;  4S2R P;  4IKS A;  3MR1 A;  3Q6D A;  1BN5 A;  1O0X A;  5E5B A;  1QXZ A;  3PKE A;  4U6E A;  1W7V A;  2MAT A;  3BIT A;  1JAW A;  4FKC A;  2P9A A;  2BHD A;  2BWU A;  4FLK A;  1KP0 A;  2GG7 A;  2GG3 A;  4QR8 A;  4U75 A;  4HXX A;  5FCF A;  3CB5 A;  1B6A A;  1YVM A;  4PV4 A;  4RZZ A;  2BWV A;  2Q93 A;  4IPA A;  3PKC A;  3FMR A;  4A6W A;  1XGS A;  4S01 A;  2BHB A;  1C22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...