4U1BA

Hsmetap in complex with (1-amino-2-propylpentyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u1bA00
2EVCA 1CHMA 2ADUA 3CTZA 4KM3A 4QR8A 2EVMA 5CNXA 4IKRA 4HXXA 3RVAA 4A6WA 3BIPA 1M35A 1YJ3A 2EVOA 4S2RP 2B3HA 1C24A 2GG2A 2GG3A 3MATA 1BN5A 1WKMA 3IG4A 1PV9A 2HOWA 4IKUA 2DFIA 2BWVA 1JAWA 2BWUA 2BWXA 4IDYA 1KQ0A 1WBQA 1Y1NA 3FMRA 2B3KA 4U6ZA 2V3ZA 4U70A 5JFRA 4FLLA 4B28A 1B6AA 4FO8A 2BN7A 4FUKA 1QZYA 2OKNA 1R58A 3PKCA 4RZYA 4U69A 1XGOA 3D27A 1XGMA 4U1BA 4U76A 1YW9A 3MR1A 2Q93A 1C23A 1KQ9A 1YVMA 2GU7A 1XNZA 2BWYA 4FLJA 4R60A 5D6EA 2V3YA 4OOKA 2P99A 3IU8A 4U6EA 1C21A 2IW2A 3CB5A 2GA2A 4EGEA 5FCFA 3Q6DA 1O0XA 4A6VA 2NQ6A 4S01A 1QXZA 4U75A 3L24A 1A16A 3IU7A 2GGBA 3FMQA 4U73A 4Z7MA 4ZWPA 4IU6A 4MATA 4U6JA 1WLRA 2B3LA 3FM3A 1MATA 4PNCA 3TAVA 2GG9A 2BWTA 1C27A 5JI6A 2GGCA 2BHAA 2BWSA 2Q92A 3CB6A 4IKTA 1W7VA 1R5GA 5CDEA 3BIQA 1N51A 4U6WA 2BHCA 2ZSGA 4RZZA 4FLIA 3BITA 2Q8KA 3PKDA 2GG5A 1YW7A 4FO7A 1C22A 2P9AA 2Q96A 1WL6A 1B59A 2GZ5A 2GG7A 2GTXA 4ZWOA 2BWWA 1WL9A 3S6BA 5FCHA 4IECA 3L7GA 4IKSA 2GU5A 2BB7A 1W2MA 2Q95A 2Q94A 4IF7A 1KP0A 4FKCA 4U71A 5CIKA 2BHBA 1YW8A 2EA4A 2V3XA 3IU9A 4U6CA 3MX6A 1WN1A 2OAZA 1R5HA 2BHDA 5JHUA 4S2TP 3PKAA 2BH3A 4FLKA 4ZWUA 3RORA 5CLSA 1WY2A 3PKBA 5CDLA 5CDVA 5D6FA 4S00A 1QXYA 3TB5A 2G6PA 2GG8A 2EA2A 4IPAA 1XGNA 2GU4A 2NQ7A 2P98A 2GU6A 2V6CA 4PV4A 4RGZ1 1XGSA 1BOAA 5E5BA 5CE6A 4ZNGA 2GG0A 3PKEA 2MATA 1QXWA 4JUQA
chains in the Genus database with same CATH superfamily
2EVCA 1CHMA 2ADUA 3CTZA 4KM3A 4QR8A 2EVMA 5CNXA 4IKRA 4HXXA 3RVAA 4A6WA 3BIPA 1M35A 1YJ3A 2EVOA 4S2RP 2B3HA 1C24A 2GG2A 2GG3A 3MATA 1BN5A 1WKMA 3IG4A 1PV9A 2HOWA 4IKUA 2DFIA 2BWVA 1JAWA 2BWUA 2BWXA 4IDYA 1KQ0A 1WBQA 1Y1NA 3FMRA 2B3KA 4U6ZA 2V3ZA 4U70A 5JFRA 4FLLA 4B28A 1B6AA 4FO8A 2BN7A 4FUKA 1QZYA 2OKNA 1R58A 3PKCA 4RZYA 4U69A 1XGOA 3D27A 1XGMA 4U1BA 4U76A 1YW9A 3MR1A 2Q93A 1C23A 1KQ9A 1YVMA 2GU7A 1XNZA 2BWYA 4FLJA 4R60A 5D6EA 2V3YA 4OOKA 2P99A 3IU8A 4U6EA 1C21A 2IW2A 3CB5A 2GA2A 4EGEA 5FCFA 3Q6DA 1O0XA 4A6VA 2NQ6A 4S01A 1QXZA 4U75A 3L24A 1A16A 3IU7A 2GGBA 3FMQA 4U73A 4Z7MA 4ZWPA 4IU6A 4MATA 4U6JA 1WLRA 2B3LA 3FM3A 1MATA 4PNCA 3TAVA 2GG9A 2BWTA 1C27A 5JI6A 2GGCA 2BHAA 2BWSA 2Q92A 3CB6A 4IKTA 1W7VA 1R5GA 5CDEA 3BIQA 1N51A 4U6WA 2BHCA 2ZSGA 4RZZA 4FLIA 3BITA 2Q8KA 3PKDA 2GG5A 1YW7A 4FO7A 1C22A 2P9AA 2Q96A 1WL6A 1B59A 2GZ5A 2GG7A 2GTXA 4ZWOA 2BWWA 1WL9A 3S6BA 5FCHA 4IECA 3L7GA 4IKSA 2GU5A 2BB7A 1W2MA 2Q95A 2Q94A 4IF7A 1KP0A 4FKCA 4U71A 5CIKA 2BHBA 1YW8A 2EA4A 2V3XA 3IU9A 4U6CA 3MX6A 1WN1A 2OAZA 1R5HA 2BHDA 5JHUA 4S2TP 3PKAA 2BH3A 4FLKA 4ZWUA 3RORA 5CLSA 1WY2A 3PKBA 5CDLA 5CDVA 5D6FA 4S00A 1QXYA 3TB5A 2G6PA 2GG8A 2EA2A 4IPAA 1XGNA 2GU4A 2NQ7A 2P98A 2GU6A 2V6CA 4PV4A 4RGZ1 1XGSA 1BOAA 5E5BA 5CE6A 4ZNGA 2GG0A 3PKEA 2MATA 1QXWA 4JUQA
chains in the Genus database with same CATH topology
2EVCA 1CHMA 2ADUA 3CTZA 4KM3A 4QR8A 2EVMA 5CNXA 4IKRA 4HXXA 3RVAA 4A6WA 3BIPA 1M35A 1YJ3A 2EVOA 4S2RP 2B3HA 1C24A 2GG2A 2GG3A 3MATA 1BN5A 1WKMA 3IG4A 1PV9A 2HOWA 4IKUA 2DFIA 2BWVA 1JAWA 2BWUA 2BWXA 4IDYA 1KQ0A 1WBQA 1Y1NA 3FMRA 2B3KA 4U6ZA 2V3ZA 4U70A 5JFRA 4FLLA 4B28A 1B6AA 4FO8A 2BN7A 4FUKA 1QZYA 2OKNA 1R58A 3PKCA 4RZYA 4U69A 1XGOA 3D27A 1XGMA 4U1BA 4U76A 1YW9A 3MR1A 2Q93A 1C23A 1KQ9A 1YVMA 2GU7A 1XNZA 2BWYA 4FLJA 4R60A 5D6EA 2V3YA 4OOKA 2P99A 3IU8A 4U6EA 1C21A 2IW2A 3CB5A 2GA2A 4EGEA 5FCFA 3Q6DA 1O0XA 4A6VA 2NQ6A 4S01A 1QXZA 4U75A 3L24A 1A16A 3IU7A 2GGBA 3FMQA 4U73A 4Z7MA 4ZWPA 4IU6A 4MATA 4U6JA 1WLRA 2B3LA 3FM3A 1MATA 4PNCA 3TAVA 2GG9A 2BWTA 1C27A 5JI6A 2GGCA 2BHAA 2BWSA 2Q92A 3CB6A 4IKTA 1W7VA 1R5GA 5CDEA 3BIQA 1N51A 4U6WA 2BHCA 2ZSGA 4RZZA 4FLIA 3BITA 2Q8KA 3PKDA 2GG5A 1YW7A 4FO7A 1C22A 2P9AA 2Q96A 1WL6A 1B59A 2GZ5A 2GG7A 2GTXA 4ZWOA 2BWWA 1WL9A 3S6BA 5FCHA 4IECA 3L7GA 4IKSA 2GU5A 2BB7A 1W2MA 2Q95A 2Q94A 4IF7A 1KP0A 4FKCA 4U71A 5CIKA 2BHBA 1YW8A 2EA4A 2V3XA 3IU9A 4U6CA 3MX6A 1WN1A 2OAZA 1R5HA 2BHDA 5JHUA 4S2TP 3PKAA 2BH3A 4FLKA 4ZWUA 3RORA 5CLSA 1WY2A 3PKBA 5CDLA 5CDVA 5D6FA 4S00A 1QXYA 3TB5A 2G6PA 2GG8A 2EA2A 4IPAA 1XGNA 2GU4A 2NQ7A 2P98A 2GU6A 2V6CA 4PV4A 4RGZ1 1XGSA 1BOAA 5E5BA 5CE6A 4ZNGA 2GG0A 3PKEA 2MATA 1QXWA 4JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVC A;  1CHM A;  2ADU A;  3CTZ A;  4KM3 A;  4QR8 A;  2EVM A;  5CNX A;  4IKR A;  4HXX A;  3RVA A;  4A6W A;  3BIP A;  1M35 A;  1YJ3 A;  2EVO A;  4S2R P;  2B3H A;  1C24 A;  2GG2 A;  2GG3 A;  3MAT A;  1BN5 A;  1WKM A;  3IG4 A;  1PV9 A;  2HOW A;  4IKU A;  2DFI A;  2BWV A;  1JAW A;  2BWU A;  2BWX A;  4IDY A;  1KQ0 A;  1WBQ A;  1Y1N A;  3FMR A;  2B3K A;  4U6Z A;  2V3Z A;  4U70 A;  5JFR A;  4FLL A;  4B28 A;  1B6A A;  4FO8 A;  2BN7 A;  4FUK A;  1QZY A;  2OKN A;  1R58 A;  3PKC A;  4RZY A;  4U69 A;  1XGO A;  3D27 A;  1XGM A;  4U1B A;  4U76 A;  1YW9 A;  3MR1 A;  2Q93 A;  1C23 A;  1KQ9 A;  1YVM A;  2GU7 A;  1XNZ A;  2BWY A;  4FLJ A;  4R60 A;  5D6E A;  2V3Y A;  4OOK A;  2P99 A;  3IU8 A;  4U6E A;  1C21 A;  2IW2 A;  3CB5 A;  2GA2 A;  4EGE A;  5FCF A;  3Q6D A;  1O0X A;  4A6V A;  2NQ6 A;  4S01 A;  1QXZ A;  4U75 A;  3L24 A;  1A16 A;  3IU7 A;  2GGB A;  3FMQ A;  4U73 A;  4Z7M A;  4ZWP A;  4IU6 A;  4MAT A;  4U6J A;  1WLR A;  2B3L A;  3FM3 A;  1MAT A;  4PNC A;  3TAV A;  2GG9 A;  2BWT A;  1C27 A;  5JI6 A;  2GGC A;  2BHA A;  2BWS A;  2Q92 A;  3CB6 A;  4IKT A;  1W7V A;  1R5G A;  5CDE A;  3BIQ A;  1N51 A;  4U6W A;  2BHC A;  2ZSG A;  4RZZ A;  4FLI A;  3BIT A;  2Q8K A;  3PKD A;  2GG5 A;  1YW7 A;  4FO7 A;  1C22 A;  2P9A A;  2Q96 A;  1WL6 A;  1B59 A;  2GZ5 A;  2GG7 A;  2GTX A;  4ZWO A;  2BWW A;  1WL9 A;  3S6B A;  5FCH A;  4IEC A;  3L7G A;  4IKS A;  2GU5 A;  2BB7 A;  1W2M A;  2Q95 A;  2Q94 A;  4IF7 A;  1KP0 A;  4FKC A;  4U71 A;  5CIK A;  2BHB A;  1YW8 A;  2EA4 A;  2V3X A;  3IU9 A;  4U6C A;  3MX6 A;  1WN1 A;  2OAZ A;  1R5H A;  2BHD A;  5JHU A;  4S2T P;  3PKA A;  2BH3 A;  4FLK A;  4ZWU A;  3ROR A;  5CLS A;  1WY2 A;  3PKB A;  5CDL A;  5CDV A;  5D6F A;  4S00 A;  1QXY A;  3TB5 A;  2G6P A;  2GG8 A;  2EA2 A;  4IPA A;  1XGN A;  2GU4 A;  2NQ7 A;  2P98 A;  2GU6 A;  2V6C A;  4PV4 A;  4RGZ 1;  1XGS A;  1BOA A;  5E5B A;  5CE6 A;  4ZNG A;  2GG0 A;  3PKE A;  2MAT A;  1QXW A;  4JUQ A; 
#chains in the Genus database with same CATH topology
 2EVC A;  1CHM A;  2ADU A;  3CTZ A;  4KM3 A;  4QR8 A;  2EVM A;  5CNX A;  4IKR A;  4HXX A;  3RVA A;  4A6W A;  3BIP A;  1M35 A;  1YJ3 A;  2EVO A;  4S2R P;  2B3H A;  1C24 A;  2GG2 A;  2GG3 A;  3MAT A;  1BN5 A;  1WKM A;  3IG4 A;  1PV9 A;  2HOW A;  4IKU A;  2DFI A;  2BWV A;  1JAW A;  2BWU A;  2BWX A;  4IDY A;  1KQ0 A;  1WBQ A;  1Y1N A;  3FMR A;  2B3K A;  4U6Z A;  2V3Z A;  4U70 A;  5JFR A;  4FLL A;  4B28 A;  1B6A A;  4FO8 A;  2BN7 A;  4FUK A;  1QZY A;  2OKN A;  1R58 A;  3PKC A;  4RZY A;  4U69 A;  1XGO A;  3D27 A;  1XGM A;  4U1B A;  4U76 A;  1YW9 A;  3MR1 A;  2Q93 A;  1C23 A;  1KQ9 A;  1YVM A;  2GU7 A;  1XNZ A;  2BWY A;  4FLJ A;  4R60 A;  5D6E A;  2V3Y A;  4OOK A;  2P99 A;  3IU8 A;  4U6E A;  1C21 A;  2IW2 A;  3CB5 A;  2GA2 A;  4EGE A;  5FCF A;  3Q6D A;  1O0X A;  4A6V A;  2NQ6 A;  4S01 A;  1QXZ A;  4U75 A;  3L24 A;  1A16 A;  3IU7 A;  2GGB A;  3FMQ A;  4U73 A;  4Z7M A;  4ZWP A;  4IU6 A;  4MAT A;  4U6J A;  1WLR A;  2B3L A;  3FM3 A;  1MAT A;  4PNC A;  3TAV A;  2GG9 A;  2BWT A;  1C27 A;  5JI6 A;  2GGC A;  2BHA A;  2BWS A;  2Q92 A;  3CB6 A;  4IKT A;  1W7V A;  1R5G A;  5CDE A;  3BIQ A;  1N51 A;  4U6W A;  2BHC A;  2ZSG A;  4RZZ A;  4FLI A;  3BIT A;  2Q8K A;  3PKD A;  2GG5 A;  1YW7 A;  4FO7 A;  1C22 A;  2P9A A;  2Q96 A;  1WL6 A;  1B59 A;  2GZ5 A;  2GG7 A;  2GTX A;  4ZWO A;  2BWW A;  1WL9 A;  3S6B A;  5FCH A;  4IEC A;  3L7G A;  4IKS A;  2GU5 A;  2BB7 A;  1W2M A;  2Q95 A;  2Q94 A;  4IF7 A;  1KP0 A;  4FKC A;  4U71 A;  5CIK A;  2BHB A;  1YW8 A;  2EA4 A;  2V3X A;  3IU9 A;  4U6C A;  3MX6 A;  1WN1 A;  2OAZ A;  1R5H A;  2BHD A;  5JHU A;  4S2T P;  3PKA A;  2BH3 A;  4FLK A;  4ZWU A;  3ROR A;  5CLS A;  1WY2 A;  3PKB A;  5CDL A;  5CDV A;  5D6F A;  4S00 A;  1QXY A;  3TB5 A;  2G6P A;  2GG8 A;  2EA2 A;  4IPA A;  1XGN A;  2GU4 A;  2NQ7 A;  2P98 A;  2GU6 A;  2V6C A;  4PV4 A;  4RGZ 1;  1XGS A;  1BOA A;  5E5B A;  5CE6 A;  4ZNG A;  2GG0 A;  3PKE A;  2MAT A;  1QXW A;  4JUQ A; 
#chains in the Genus database with same CATH homology
 2EVC A;  1CHM A;  2ADU A;  3CTZ A;  4KM3 A;  4QR8 A;  2EVM A;  5CNX A;  4IKR A;  4HXX A;  3RVA A;  4A6W A;  3BIP A;  1M35 A;  1YJ3 A;  2EVO A;  4S2R P;  2B3H A;  1C24 A;  2GG2 A;  2GG3 A;  3MAT A;  1BN5 A;  1WKM A;  3IG4 A;  1PV9 A;  2HOW A;  4IKU A;  2DFI A;  2BWV A;  1JAW A;  2BWU A;  2BWX A;  4IDY A;  1KQ0 A;  1WBQ A;  1Y1N A;  3FMR A;  2B3K A;  4U6Z A;  2V3Z A;  4U70 A;  5JFR A;  4FLL A;  4B28 A;  1B6A A;  4FO8 A;  2BN7 A;  4FUK A;  1QZY A;  2OKN A;  1R58 A;  3PKC A;  4RZY A;  4U69 A;  1XGO A;  3D27 A;  1XGM A;  4U1B A;  4U76 A;  1YW9 A;  3MR1 A;  2Q93 A;  1C23 A;  1KQ9 A;  1YVM A;  2GU7 A;  1XNZ A;  2BWY A;  4FLJ A;  4R60 A;  5D6E A;  2V3Y A;  4OOK A;  2P99 A;  3IU8 A;  4U6E A;  1C21 A;  2IW2 A;  3CB5 A;  2GA2 A;  4EGE A;  5FCF A;  3Q6D A;  1O0X A;  4A6V A;  2NQ6 A;  4S01 A;  1QXZ A;  4U75 A;  3L24 A;  1A16 A;  3IU7 A;  2GGB A;  3FMQ A;  4U73 A;  4Z7M A;  4ZWP A;  4IU6 A;  4MAT A;  4U6J A;  1WLR A;  2B3L A;  3FM3 A;  1MAT A;  4PNC A;  3TAV A;  2GG9 A;  2BWT A;  1C27 A;  5JI6 A;  2GGC A;  2BHA A;  2BWS A;  2Q92 A;  3CB6 A;  4IKT A;  1W7V A;  1R5G A;  5CDE A;  3BIQ A;  1N51 A;  4U6W A;  2BHC A;  2ZSG A;  4RZZ A;  4FLI A;  3BIT A;  2Q8K A;  3PKD A;  2GG5 A;  1YW7 A;  4FO7 A;  1C22 A;  2P9A A;  2Q96 A;  1WL6 A;  1B59 A;  2GZ5 A;  2GG7 A;  2GTX A;  4ZWO A;  2BWW A;  1WL9 A;  3S6B A;  5FCH A;  4IEC A;  3L7G A;  4IKS A;  2GU5 A;  2BB7 A;  1W2M A;  2Q95 A;  2Q94 A;  4IF7 A;  1KP0 A;  4FKC A;  4U71 A;  5CIK A;  2BHB A;  1YW8 A;  2EA4 A;  2V3X A;  3IU9 A;  4U6C A;  3MX6 A;  1WN1 A;  2OAZ A;  1R5H A;  2BHD A;  5JHU A;  4S2T P;  3PKA A;  2BH3 A;  4FLK A;  4ZWU A;  3ROR A;  5CLS A;  1WY2 A;  3PKB A;  5CDL A;  5CDV A;  5D6F A;  4S00 A;  1QXY A;  3TB5 A;  2G6P A;  2GG8 A;  2EA2 A;  4IPA A;  1XGN A;  2GU4 A;  2NQ7 A;  2P98 A;  2GU6 A;  2V6C A;  4PV4 A;  4RGZ 1;  1XGS A;  1BOA A;  5E5B A;  5CE6 A;  4ZNG A;  2GG0 A;  3PKE A;  2MAT A;  1QXW A;  4JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...