1YVMA

E. coli methionine aminopeptidase in complex with thiabendazole
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metal Ions as Cofactors for the Binding of Inhibitors to Methionine Aminopeptidase: A Critical View of the Relevance of In Vitro Metalloenzyme Assays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1yvmA00
3CTZA 1A16A 4KM3A 1B6AA 3TB5A 2GG8A 3IG4A 4A6WA 1XGNA 1B59A 4IPAA 2Q94A 2BN7A 4U73A 1CHMA 2NQ7A 4JUQA 4IKSA 2EVCA 2GG5A 2B3KA 2NQ6A 4U75A 3CB6A 2V3ZA 3FMRA 4OOKA 4U6EA 5CIKA 4R60A 4IU6A 1YW8A 3Q6DA 1KQ0A 1WKMA 4ZWOA 3PKCA 1N51A 2V3XA 2GG3A 1BN5A 2ADUA 4HXXA 5FCFA 4U70A 5CLSA 2P9AA 4U6WA 4IKUA 4FKCA 2EA4A 1QZYA 2DFIA 1O0XA 3L7GA 3IU8A 4ZWUA 3MATA 1C22A 2IW2A 2EVOA 3D27A 3IU9A 1M35A 1WL9A 2Q96A 3PKDA 4FLIA 4A6VA 2B3LA 4IF7A 5CDLA 2BWWA 2GG7A 2BWYA 2BH3A 2BWTA 2MATA 5D6EA 4FLJA 4MATA 2Q93A 4IKRA 1XGMA 4B28A 1R5GA 2V3YA 1QXWA 1KP0A 2P99A 2EVMA 5CDEA 4S2RP 4U1BA 2GG9A 3BIPA 3MX6A 5CDVA 4U6ZA 5CE6A 2P98A 1W2MA 4IECA 2BWSA 1YVMA 2BWVA 2GZ5A 2Q8KA 2GU5A 2G6PA 4RGZ1 1YW9A 5D6FA 1JAWA 4PV4A 5JI6A 4FUKA 4U71A 2GG2A 2OAZA 4Z7MA 5JHUA 2GG0A 1YJ3A 2BHBA 1PV9A 3PKEA 3FM3A 2V6CA 2GU4A 2GGBA 4FO7A 4PNCA 1C27A 3L24A 3FMQA 2OKNA 4S00A 1WL6A 1WBQA 2HOWA 1C24A 1QXYA 1R58A 2GTXA 2EA2A 3PKBA 2Q92A 2B3HA 1KQ9A 3BIQA 4S2TP 1Y1NA 4U6JA 1BOAA 4S01A 1YW7A 1QXZA 3PKAA 4U69A 5FCHA 2ZSGA 3MR1A 2Q95A 1XGSA 3RORA 1C23A 5JFRA 4IDYA 4IKTA 1WY2A 4FLKA 3BITA 4FO8A 2BHDA 4ZWPA 2BWUA 2GU7A 2GGCA 4FLLA 4EGEA 3CB5A 1XNZA 3TAVA 3S6BA 4QR8A 3RVAA 1W7VA 2BWXA 3IU7A 1XGOA 1C21A 4RZZA 1WLRA 2GA2A 2GU6A 1R5HA 2BB7A 4RZYA 4ZNGA 4U76A 5E5BA 1WN1A 4U6CA 5CNXA 2BHCA 2BHAA 1MATA
chains in the Genus database with same CATH superfamily
3CTZA 1A16A 4KM3A 1B6AA 3TB5A 2GG8A 3IG4A 4A6WA 1XGNA 1B59A 4IPAA 2Q94A 2BN7A 4U73A 1CHMA 2NQ7A 4JUQA 4IKSA 2EVCA 2GG5A 2B3KA 2NQ6A 4U75A 3CB6A 2V3ZA 3FMRA 4OOKA 4U6EA 5CIKA 4R60A 4IU6A 1YW8A 3Q6DA 1KQ0A 1WKMA 4ZWOA 3PKCA 1N51A 2V3XA 2GG3A 1BN5A 2ADUA 4HXXA 5FCFA 4U70A 5CLSA 2P9AA 4U6WA 4IKUA 4FKCA 2EA4A 1QZYA 2DFIA 1O0XA 3L7GA 3IU8A 4ZWUA 3MATA 1C22A 2IW2A 2EVOA 3D27A 3IU9A 1M35A 1WL9A 2Q96A 3PKDA 4FLIA 4A6VA 2B3LA 4IF7A 5CDLA 2BWWA 2GG7A 2BWYA 2BH3A 2BWTA 2MATA 5D6EA 4FLJA 4MATA 2Q93A 4IKRA 1XGMA 4B28A 1R5GA 2V3YA 1QXWA 1KP0A 2P99A 2EVMA 5CDEA 4S2RP 4U1BA 2GG9A 3BIPA 3MX6A 5CDVA 4U6ZA 5CE6A 2P98A 1W2MA 4IECA 2BWSA 1YVMA 2BWVA 2GZ5A 2Q8KA 2GU5A 2G6PA 4RGZ1 1YW9A 5D6FA 1JAWA 4PV4A 5JI6A 4FUKA 4U71A 2GG2A 2OAZA 4Z7MA 5JHUA 2GG0A 1YJ3A 2BHBA 1PV9A 3PKEA 3FM3A 2V6CA 2GU4A 2GGBA 4FO7A 4PNCA 1C27A 3L24A 3FMQA 2OKNA 4S00A 1WL6A 1WBQA 2HOWA 1C24A 1QXYA 1R58A 2GTXA 2EA2A 3PKBA 2Q92A 2B3HA 1KQ9A 3BIQA 4S2TP 1Y1NA 4U6JA 1BOAA 4S01A 1YW7A 1QXZA 3PKAA 4U69A 5FCHA 2ZSGA 3MR1A 2Q95A 1XGSA 3RORA 1C23A 5JFRA 4IDYA 4IKTA 1WY2A 4FLKA 3BITA 4FO8A 2BHDA 4ZWPA 2BWUA 2GU7A 2GGCA 4FLLA 4EGEA 3CB5A 1XNZA 3TAVA 3S6BA 4QR8A 3RVAA 1W7VA 2BWXA 3IU7A 1XGOA 1C21A 4RZZA 1WLRA 2GA2A 2GU6A 1R5HA 2BB7A 4RZYA 4ZNGA 4U76A 5E5BA 1WN1A 4U6CA 5CNXA 2BHCA 2BHAA 1MATA
chains in the Genus database with same CATH topology
3CTZA 1A16A 4KM3A 1B6AA 3TB5A 2GG8A 3IG4A 4A6WA 1XGNA 1B59A 4IPAA 2Q94A 2BN7A 4U73A 1CHMA 2NQ7A 4JUQA 4IKSA 2EVCA 2GG5A 2B3KA 2NQ6A 4U75A 3CB6A 2V3ZA 3FMRA 4OOKA 4U6EA 5CIKA 4R60A 4IU6A 1YW8A 3Q6DA 1KQ0A 1WKMA 4ZWOA 3PKCA 1N51A 2V3XA 2GG3A 1BN5A 2ADUA 4HXXA 5FCFA 4U70A 5CLSA 2P9AA 4U6WA 4IKUA 4FKCA 2EA4A 1QZYA 2DFIA 1O0XA 3L7GA 3IU8A 4ZWUA 3MATA 1C22A 2IW2A 2EVOA 3D27A 3IU9A 1M35A 1WL9A 2Q96A 3PKDA 4FLIA 4A6VA 2B3LA 4IF7A 5CDLA 2BWWA 2GG7A 2BWYA 2BH3A 2BWTA 2MATA 5D6EA 4FLJA 4MATA 2Q93A 4IKRA 1XGMA 4B28A 1R5GA 2V3YA 1QXWA 1KP0A 2P99A 2EVMA 5CDEA 4S2RP 4U1BA 2GG9A 3BIPA 3MX6A 5CDVA 4U6ZA 5CE6A 2P98A 1W2MA 4IECA 2BWSA 1YVMA 2BWVA 2GZ5A 2Q8KA 2GU5A 2G6PA 4RGZ1 1YW9A 5D6FA 1JAWA 4PV4A 5JI6A 4FUKA 4U71A 2GG2A 2OAZA 4Z7MA 5JHUA 2GG0A 1YJ3A 2BHBA 1PV9A 3PKEA 3FM3A 2V6CA 2GU4A 2GGBA 4FO7A 4PNCA 1C27A 3L24A 3FMQA 2OKNA 4S00A 1WL6A 1WBQA 2HOWA 1C24A 1QXYA 1R58A 2GTXA 2EA2A 3PKBA 2Q92A 2B3HA 1KQ9A 3BIQA 4S2TP 1Y1NA 4U6JA 1BOAA 4S01A 1YW7A 1QXZA 3PKAA 4U69A 5FCHA 2ZSGA 3MR1A 2Q95A 1XGSA 3RORA 1C23A 5JFRA 4IDYA 4IKTA 1WY2A 4FLKA 3BITA 4FO8A 2BHDA 4ZWPA 2BWUA 2GU7A 2GGCA 4FLLA 4EGEA 3CB5A 1XNZA 3TAVA 3S6BA 4QR8A 3RVAA 1W7VA 2BWXA 3IU7A 1XGOA 1C21A 4RZZA 1WLRA 2GA2A 2GU6A 1R5HA 2BB7A 4RZYA 4ZNGA 4U76A 5E5BA 1WN1A 4U6CA 5CNXA 2BHCA 2BHAA 1MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTZ A;  1A16 A;  4KM3 A;  1B6A A;  3TB5 A;  2GG8 A;  3IG4 A;  4A6W A;  1XGN A;  1B59 A;  4IPA A;  2Q94 A;  2BN7 A;  4U73 A;  1CHM A;  2NQ7 A;  4JUQ A;  4IKS A;  2EVC A;  2GG5 A;  2B3K A;  2NQ6 A;  4U75 A;  3CB6 A;  2V3Z A;  3FMR A;  4OOK A;  4U6E A;  5CIK A;  4R60 A;  4IU6 A;  1YW8 A;  3Q6D A;  1KQ0 A;  1WKM A;  4ZWO A;  3PKC A;  1N51 A;  2V3X A;  2GG3 A;  1BN5 A;  2ADU A;  4HXX A;  5FCF A;  4U70 A;  5CLS A;  2P9A A;  4U6W A;  4IKU A;  4FKC A;  2EA4 A;  1QZY A;  2DFI A;  1O0X A;  3L7G A;  3IU8 A;  4ZWU A;  3MAT A;  1C22 A;  2IW2 A;  2EVO A;  3D27 A;  3IU9 A;  1M35 A;  1WL9 A;  2Q96 A;  3PKD A;  4FLI A;  4A6V A;  2B3L A;  4IF7 A;  5CDL A;  2BWW A;  2GG7 A;  2BWY A;  2BH3 A;  2BWT A;  2MAT A;  5D6E A;  4FLJ A;  4MAT A;  2Q93 A;  4IKR A;  1XGM A;  4B28 A;  1R5G A;  2V3Y A;  1QXW A;  1KP0 A;  2P99 A;  2EVM A;  5CDE A;  4S2R P;  4U1B A;  2GG9 A;  3BIP A;  3MX6 A;  5CDV A;  4U6Z A;  5CE6 A;  2P98 A;  1W2M A;  4IEC A;  2BWS A;  1YVM A;  2BWV A;  2GZ5 A;  2Q8K A;  2GU5 A;  2G6P A;  4RGZ 1;  1YW9 A;  5D6F A;  1JAW A;  4PV4 A;  5JI6 A;  4FUK A;  4U71 A;  2GG2 A;  2OAZ A;  4Z7M A;  5JHU A;  2GG0 A;  1YJ3 A;  2BHB A;  1PV9 A;  3PKE A;  3FM3 A;  2V6C A;  2GU4 A;  2GGB A;  4FO7 A;  4PNC A;  1C27 A;  3L24 A;  3FMQ A;  2OKN A;  4S00 A;  1WL6 A;  1WBQ A;  2HOW A;  1C24 A;  1QXY A;  1R58 A;  2GTX A;  2EA2 A;  3PKB A;  2Q92 A;  2B3H A;  1KQ9 A;  3BIQ A;  4S2T P;  1Y1N A;  4U6J A;  1BOA A;  4S01 A;  1YW7 A;  1QXZ A;  3PKA A;  4U69 A;  5FCH A;  2ZSG A;  3MR1 A;  2Q95 A;  1XGS A;  3ROR A;  1C23 A;  5JFR A;  4IDY A;  4IKT A;  1WY2 A;  4FLK A;  3BIT A;  4FO8 A;  2BHD A;  4ZWP A;  2BWU A;  2GU7 A;  2GGC A;  4FLL A;  4EGE A;  3CB5 A;  1XNZ A;  3TAV A;  3S6B A;  4QR8 A;  3RVA A;  1W7V A;  2BWX A;  3IU7 A;  1XGO A;  1C21 A;  4RZZ A;  1WLR A;  2GA2 A;  2GU6 A;  1R5H A;  2BB7 A;  4RZY A;  4ZNG A;  4U76 A;  5E5B A;  1WN1 A;  4U6C A;  5CNX A;  2BHC A;  2BHA A;  1MAT A; 
#chains in the Genus database with same CATH topology
 3CTZ A;  1A16 A;  4KM3 A;  1B6A A;  3TB5 A;  2GG8 A;  3IG4 A;  4A6W A;  1XGN A;  1B59 A;  4IPA A;  2Q94 A;  2BN7 A;  4U73 A;  1CHM A;  2NQ7 A;  4JUQ A;  4IKS A;  2EVC A;  2GG5 A;  2B3K A;  2NQ6 A;  4U75 A;  3CB6 A;  2V3Z A;  3FMR A;  4OOK A;  4U6E A;  5CIK A;  4R60 A;  4IU6 A;  1YW8 A;  3Q6D A;  1KQ0 A;  1WKM A;  4ZWO A;  3PKC A;  1N51 A;  2V3X A;  2GG3 A;  1BN5 A;  2ADU A;  4HXX A;  5FCF A;  4U70 A;  5CLS A;  2P9A A;  4U6W A;  4IKU A;  4FKC A;  2EA4 A;  1QZY A;  2DFI A;  1O0X A;  3L7G A;  3IU8 A;  4ZWU A;  3MAT A;  1C22 A;  2IW2 A;  2EVO A;  3D27 A;  3IU9 A;  1M35 A;  1WL9 A;  2Q96 A;  3PKD A;  4FLI A;  4A6V A;  2B3L A;  4IF7 A;  5CDL A;  2BWW A;  2GG7 A;  2BWY A;  2BH3 A;  2BWT A;  2MAT A;  5D6E A;  4FLJ A;  4MAT A;  2Q93 A;  4IKR A;  1XGM A;  4B28 A;  1R5G A;  2V3Y A;  1QXW A;  1KP0 A;  2P99 A;  2EVM A;  5CDE A;  4S2R P;  4U1B A;  2GG9 A;  3BIP A;  3MX6 A;  5CDV A;  4U6Z A;  5CE6 A;  2P98 A;  1W2M A;  4IEC A;  2BWS A;  1YVM A;  2BWV A;  2GZ5 A;  2Q8K A;  2GU5 A;  2G6P A;  4RGZ 1;  1YW9 A;  5D6F A;  1JAW A;  4PV4 A;  5JI6 A;  4FUK A;  4U71 A;  2GG2 A;  2OAZ A;  4Z7M A;  5JHU A;  2GG0 A;  1YJ3 A;  2BHB A;  1PV9 A;  3PKE A;  3FM3 A;  2V6C A;  2GU4 A;  2GGB A;  4FO7 A;  4PNC A;  1C27 A;  3L24 A;  3FMQ A;  2OKN A;  4S00 A;  1WL6 A;  1WBQ A;  2HOW A;  1C24 A;  1QXY A;  1R58 A;  2GTX A;  2EA2 A;  3PKB A;  2Q92 A;  2B3H A;  1KQ9 A;  3BIQ A;  4S2T P;  1Y1N A;  4U6J A;  1BOA A;  4S01 A;  1YW7 A;  1QXZ A;  3PKA A;  4U69 A;  5FCH A;  2ZSG A;  3MR1 A;  2Q95 A;  1XGS A;  3ROR A;  1C23 A;  5JFR A;  4IDY A;  4IKT A;  1WY2 A;  4FLK A;  3BIT A;  4FO8 A;  2BHD A;  4ZWP A;  2BWU A;  2GU7 A;  2GGC A;  4FLL A;  4EGE A;  3CB5 A;  1XNZ A;  3TAV A;  3S6B A;  4QR8 A;  3RVA A;  1W7V A;  2BWX A;  3IU7 A;  1XGO A;  1C21 A;  4RZZ A;  1WLR A;  2GA2 A;  2GU6 A;  1R5H A;  2BB7 A;  4RZY A;  4ZNG A;  4U76 A;  5E5B A;  1WN1 A;  4U6C A;  5CNX A;  2BHC A;  2BHA A;  1MAT A; 
#chains in the Genus database with same CATH homology
 3CTZ A;  1A16 A;  4KM3 A;  1B6A A;  3TB5 A;  2GG8 A;  3IG4 A;  4A6W A;  1XGN A;  1B59 A;  4IPA A;  2Q94 A;  2BN7 A;  4U73 A;  1CHM A;  2NQ7 A;  4JUQ A;  4IKS A;  2EVC A;  2GG5 A;  2B3K A;  2NQ6 A;  4U75 A;  3CB6 A;  2V3Z A;  3FMR A;  4OOK A;  4U6E A;  5CIK A;  4R60 A;  4IU6 A;  1YW8 A;  3Q6D A;  1KQ0 A;  1WKM A;  4ZWO A;  3PKC A;  1N51 A;  2V3X A;  2GG3 A;  1BN5 A;  2ADU A;  4HXX A;  5FCF A;  4U70 A;  5CLS A;  2P9A A;  4U6W A;  4IKU A;  4FKC A;  2EA4 A;  1QZY A;  2DFI A;  1O0X A;  3L7G A;  3IU8 A;  4ZWU A;  3MAT A;  1C22 A;  2IW2 A;  2EVO A;  3D27 A;  3IU9 A;  1M35 A;  1WL9 A;  2Q96 A;  3PKD A;  4FLI A;  4A6V A;  2B3L A;  4IF7 A;  5CDL A;  2BWW A;  2GG7 A;  2BWY A;  2BH3 A;  2BWT A;  2MAT A;  5D6E A;  4FLJ A;  4MAT A;  2Q93 A;  4IKR A;  1XGM A;  4B28 A;  1R5G A;  2V3Y A;  1QXW A;  1KP0 A;  2P99 A;  2EVM A;  5CDE A;  4S2R P;  4U1B A;  2GG9 A;  3BIP A;  3MX6 A;  5CDV A;  4U6Z A;  5CE6 A;  2P98 A;  1W2M A;  4IEC A;  2BWS A;  1YVM A;  2BWV A;  2GZ5 A;  2Q8K A;  2GU5 A;  2G6P A;  4RGZ 1;  1YW9 A;  5D6F A;  1JAW A;  4PV4 A;  5JI6 A;  4FUK A;  4U71 A;  2GG2 A;  2OAZ A;  4Z7M A;  5JHU A;  2GG0 A;  1YJ3 A;  2BHB A;  1PV9 A;  3PKE A;  3FM3 A;  2V6C A;  2GU4 A;  2GGB A;  4FO7 A;  4PNC A;  1C27 A;  3L24 A;  3FMQ A;  2OKN A;  4S00 A;  1WL6 A;  1WBQ A;  2HOW A;  1C24 A;  1QXY A;  1R58 A;  2GTX A;  2EA2 A;  3PKB A;  2Q92 A;  2B3H A;  1KQ9 A;  3BIQ A;  4S2T P;  1Y1N A;  4U6J A;  1BOA A;  4S01 A;  1YW7 A;  1QXZ A;  3PKA A;  4U69 A;  5FCH A;  2ZSG A;  3MR1 A;  2Q95 A;  1XGS A;  3ROR A;  1C23 A;  5JFR A;  4IDY A;  4IKT A;  1WY2 A;  4FLK A;  3BIT A;  4FO8 A;  2BHD A;  4ZWP A;  2BWU A;  2GU7 A;  2GGC A;  4FLL A;  4EGE A;  3CB5 A;  1XNZ A;  3TAV A;  3S6B A;  4QR8 A;  3RVA A;  1W7V A;  2BWX A;  3IU7 A;  1XGO A;  1C21 A;  4RZZ A;  1WLR A;  2GA2 A;  2GU6 A;  1R5H A;  2BB7 A;  4RZY A;  4ZNG A;  4U76 A;  5E5B A;  1WN1 A;  4U6C A;  5CNX A;  2BHC A;  2BHA A;  1MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...