1YVMA

E. coli methionine aminopeptidase in complex with thiabendazole
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal Ions as Cofactors for the Binding of Inhibitors to Methionine Aminopeptidase: A Critical View of the Relevance of In Vitro Metalloenzyme Assays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1yvmA00
4U6WA 2BB7A 3PKDA 1WY2A 4HXXA 1YW9A 4ZWPA 2B3KA 2V3YA 2V3XA 1WN1A 5CE6A 3BIQA 3S6BA 4U6ZA 1N51A 4U71A 5FCFA 4ZWOA 5CDLA 1C21A 5D6EA 5JI6A 4RZZA 2BHDA 2BN7A 1KQ0A 5CIKA 2GG0A 4RZYA 2GU5A 1W7VA 2Q92A 4IKTA 1O0XA 2EVMA 1WL6A 3MR1A 2GU7A 3FMRA 2V6CA 4FO7A 4RGZ1 4U73A 4IKRA 2BHCA 4FLLA 4U6EA 1XNZA 1W2MA 1WBQA 4FLJA 3MX6A 4IU6A 4S2RP 2BH3A 1YVMA 4U75A 3MATA 5E5BA 2BHAA 4IKUA 2GGBA 1Y1NA 2BWYA 4IPAA 2B3HA 4A6WA 4IF7A 2EA2A 1YW8A 2BWUA 3PKEA 3CB6A 1XGMA 1WLRA 1C27A 2OAZA 1WL9A 4JUQA 2HOWA 1MATA 1XGSA 2GZ5A 5JFRA 3L7GA 4S2TP 4U76A 5JHUA 2GG9A 4PV4A 3PKCA 1WKMA 2B3LA 5CDVA 2GGCA 3IU9A 1BN5A 2BWSA 2GU4A 2P9AA 1C24A 2EVCA 3IG4A 1B59A 3Q6DA 1QXYA 4U6CA 1KQ9A 3TB5A 2GG2A 2OKNA 1C22A 1A16A 4S01A 5CNXA 4MATA 4U1BA 3FM3A 2P99A 4FUKA 2GTXA 3BITA 3RVAA 4IECA 2GG5A 1XGNA 3L24A 2EVOA 2NQ6A 1C23A 4FLKA 4IKSA 4R60A 3D27A 2NQ7A 2ZSGA 4U70A 2GA2A 5CLSA 1R5HA 4QR8A 4EGEA 2Q8KA 2GU6A 3TAVA 4Z7MA 2P98A 4U69A 2GG8A 3CTZA 3PKBA 3PKAA 2BWVA 1YJ3A 1QXWA 3BIPA 4FLIA 2MATA 1R5GA 2DFIA 4S00A 4KM3A 4U6JA 2BWWA 4ZWUA 2GG3A 2ADUA 2BWTA 2EA4A 3CB5A 2BWXA 2Q95A 1JAWA 2GG7A 4PNCA 2Q93A 4A6VA 2Q96A 4B28A 1M35A 1QZYA 2BHBA 2IW2A 2G6PA 4IDYA 1PV9A 2V3ZA 4OOKA 4FKCA 2Q94A 3IU8A 1QXZA 1B6AA 3FMQA 3IU7A 5CDEA 1XGOA 5D6FA 1R58A 1BOAA 4ZNGA 4FO8A 1KP0A 3RORA 1CHMA 5FCHA 1YW7A
chains in the Genus database with same CATH superfamily
4U6WA 2BB7A 3PKDA 1WY2A 4HXXA 1YW9A 4ZWPA 2B3KA 2V3YA 2V3XA 1WN1A 5CE6A 3BIQA 3S6BA 4U6ZA 1N51A 4U71A 5FCFA 4ZWOA 5CDLA 1C21A 5D6EA 5JI6A 4RZZA 2BHDA 2BN7A 1KQ0A 5CIKA 2GG0A 4RZYA 2GU5A 1W7VA 2Q92A 4IKTA 1O0XA 2EVMA 1WL6A 3MR1A 2GU7A 3FMRA 2V6CA 4FO7A 4RGZ1 4U73A 4IKRA 2BHCA 4FLLA 4U6EA 1XNZA 1W2MA 1WBQA 4FLJA 3MX6A 4IU6A 4S2RP 2BH3A 1YVMA 4U75A 3MATA 5E5BA 2BHAA 4IKUA 2GGBA 1Y1NA 2BWYA 4IPAA 2B3HA 4A6WA 4IF7A 2EA2A 1YW8A 2BWUA 3PKEA 3CB6A 1XGMA 1WLRA 1C27A 2OAZA 1WL9A 4JUQA 2HOWA 1MATA 1XGSA 2GZ5A 5JFRA 3L7GA 4S2TP 4U76A 5JHUA 2GG9A 4PV4A 3PKCA 1WKMA 2B3LA 5CDVA 2GGCA 3IU9A 1BN5A 2BWSA 2GU4A 2P9AA 1C24A 2EVCA 3IG4A 1B59A 3Q6DA 1QXYA 4U6CA 1KQ9A 3TB5A 2GG2A 2OKNA 1C22A 1A16A 4S01A 5CNXA 4MATA 4U1BA 3FM3A 2P99A 4FUKA 2GTXA 3BITA 3RVAA 4IECA 2GG5A 1XGNA 3L24A 2EVOA 2NQ6A 1C23A 4FLKA 4IKSA 4R60A 3D27A 2NQ7A 2ZSGA 4U70A 2GA2A 5CLSA 1R5HA 4QR8A 4EGEA 2Q8KA 2GU6A 3TAVA 4Z7MA 2P98A 4U69A 2GG8A 3CTZA 3PKBA 3PKAA 2BWVA 1YJ3A 1QXWA 3BIPA 4FLIA 2MATA 1R5GA 2DFIA 4S00A 4KM3A 4U6JA 2BWWA 4ZWUA 2GG3A 2ADUA 2BWTA 2EA4A 3CB5A 2BWXA 2Q95A 1JAWA 2GG7A 4PNCA 2Q93A 4A6VA 2Q96A 4B28A 1M35A 1QZYA 2BHBA 2IW2A 2G6PA 4IDYA 1PV9A 2V3ZA 4OOKA 4FKCA 2Q94A 3IU8A 1QXZA 1B6AA 3FMQA 3IU7A 5CDEA 1XGOA 5D6FA 1R58A 1BOAA 4ZNGA 4FO8A 1KP0A 3RORA 1CHMA 5FCHA 1YW7A
chains in the Genus database with same CATH topology
4U6WA 2BB7A 3PKDA 1WY2A 4HXXA 1YW9A 4ZWPA 2B3KA 2V3YA 2V3XA 1WN1A 5CE6A 3BIQA 3S6BA 4U6ZA 1N51A 4U71A 5FCFA 4ZWOA 5CDLA 1C21A 5D6EA 5JI6A 4RZZA 2BHDA 2BN7A 1KQ0A 5CIKA 2GG0A 4RZYA 2GU5A 1W7VA 2Q92A 4IKTA 1O0XA 2EVMA 1WL6A 3MR1A 2GU7A 3FMRA 2V6CA 4FO7A 4RGZ1 4U73A 4IKRA 2BHCA 4FLLA 4U6EA 1XNZA 1W2MA 1WBQA 4FLJA 3MX6A 4IU6A 4S2RP 2BH3A 1YVMA 4U75A 3MATA 5E5BA 2BHAA 4IKUA 2GGBA 1Y1NA 2BWYA 4IPAA 2B3HA 4A6WA 4IF7A 2EA2A 1YW8A 2BWUA 3PKEA 3CB6A 1XGMA 1WLRA 1C27A 2OAZA 1WL9A 4JUQA 2HOWA 1MATA 1XGSA 2GZ5A 5JFRA 3L7GA 4S2TP 4U76A 5JHUA 2GG9A 4PV4A 3PKCA 1WKMA 2B3LA 5CDVA 2GGCA 3IU9A 1BN5A 2BWSA 2GU4A 2P9AA 1C24A 2EVCA 3IG4A 1B59A 3Q6DA 1QXYA 4U6CA 1KQ9A 3TB5A 2GG2A 2OKNA 1C22A 1A16A 4S01A 5CNXA 4MATA 4U1BA 3FM3A 2P99A 4FUKA 2GTXA 3BITA 3RVAA 4IECA 2GG5A 1XGNA 3L24A 2EVOA 2NQ6A 1C23A 4FLKA 4IKSA 4R60A 3D27A 2NQ7A 2ZSGA 4U70A 2GA2A 5CLSA 1R5HA 4QR8A 4EGEA 2Q8KA 2GU6A 3TAVA 4Z7MA 2P98A 4U69A 2GG8A 3CTZA 3PKBA 3PKAA 2BWVA 1YJ3A 1QXWA 3BIPA 4FLIA 2MATA 1R5GA 2DFIA 4S00A 4KM3A 4U6JA 2BWWA 4ZWUA 2GG3A 2ADUA 2BWTA 2EA4A 3CB5A 2BWXA 2Q95A 1JAWA 2GG7A 4PNCA 2Q93A 4A6VA 2Q96A 4B28A 1M35A 1QZYA 2BHBA 2IW2A 2G6PA 4IDYA 1PV9A 2V3ZA 4OOKA 4FKCA 2Q94A 3IU8A 1QXZA 1B6AA 3FMQA 3IU7A 5CDEA 1XGOA 5D6FA 1R58A 1BOAA 4ZNGA 4FO8A 1KP0A 3RORA 1CHMA 5FCHA 1YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6W A;  2BB7 A;  3PKD A;  1WY2 A;  4HXX A;  1YW9 A;  4ZWP A;  2B3K A;  2V3Y A;  2V3X A;  1WN1 A;  5CE6 A;  3BIQ A;  3S6B A;  4U6Z A;  1N51 A;  4U71 A;  5FCF A;  4ZWO A;  5CDL A;  1C21 A;  5D6E A;  5JI6 A;  4RZZ A;  2BHD A;  2BN7 A;  1KQ0 A;  5CIK A;  2GG0 A;  4RZY A;  2GU5 A;  1W7V A;  2Q92 A;  4IKT A;  1O0X A;  2EVM A;  1WL6 A;  3MR1 A;  2GU7 A;  3FMR A;  2V6C A;  4FO7 A;  4RGZ 1;  4U73 A;  4IKR A;  2BHC A;  4FLL A;  4U6E A;  1XNZ A;  1W2M A;  1WBQ A;  4FLJ A;  3MX6 A;  4IU6 A;  4S2R P;  2BH3 A;  1YVM A;  4U75 A;  3MAT A;  5E5B A;  2BHA A;  4IKU A;  2GGB A;  1Y1N A;  2BWY A;  4IPA A;  2B3H A;  4A6W A;  4IF7 A;  2EA2 A;  1YW8 A;  2BWU A;  3PKE A;  3CB6 A;  1XGM A;  1WLR A;  1C27 A;  2OAZ A;  1WL9 A;  4JUQ A;  2HOW A;  1MAT A;  1XGS A;  2GZ5 A;  5JFR A;  3L7G A;  4S2T P;  4U76 A;  5JHU A;  2GG9 A;  4PV4 A;  3PKC A;  1WKM A;  2B3L A;  5CDV A;  2GGC A;  3IU9 A;  1BN5 A;  2BWS A;  2GU4 A;  2P9A A;  1C24 A;  2EVC A;  3IG4 A;  1B59 A;  3Q6D A;  1QXY A;  4U6C A;  1KQ9 A;  3TB5 A;  2GG2 A;  2OKN A;  1C22 A;  1A16 A;  4S01 A;  5CNX A;  4MAT A;  4U1B A;  3FM3 A;  2P99 A;  4FUK A;  2GTX A;  3BIT A;  3RVA A;  4IEC A;  2GG5 A;  1XGN A;  3L24 A;  2EVO A;  2NQ6 A;  1C23 A;  4FLK A;  4IKS A;  4R60 A;  3D27 A;  2NQ7 A;  2ZSG A;  4U70 A;  2GA2 A;  5CLS A;  1R5H A;  4QR8 A;  4EGE A;  2Q8K A;  2GU6 A;  3TAV A;  4Z7M A;  2P98 A;  4U69 A;  2GG8 A;  3CTZ A;  3PKB A;  3PKA A;  2BWV A;  1YJ3 A;  1QXW A;  3BIP A;  4FLI A;  2MAT A;  1R5G A;  2DFI A;  4S00 A;  4KM3 A;  4U6J A;  2BWW A;  4ZWU A;  2GG3 A;  2ADU A;  2BWT A;  2EA4 A;  3CB5 A;  2BWX A;  2Q95 A;  1JAW A;  2GG7 A;  4PNC A;  2Q93 A;  4A6V A;  2Q96 A;  4B28 A;  1M35 A;  1QZY A;  2BHB A;  2IW2 A;  2G6P A;  4IDY A;  1PV9 A;  2V3Z A;  4OOK A;  4FKC A;  2Q94 A;  3IU8 A;  1QXZ A;  1B6A A;  3FMQ A;  3IU7 A;  5CDE A;  1XGO A;  5D6F A;  1R58 A;  1BOA A;  4ZNG A;  4FO8 A;  1KP0 A;  3ROR A;  1CHM A;  5FCH A;  1YW7 A; 
#chains in the Genus database with same CATH topology
 4U6W A;  2BB7 A;  3PKD A;  1WY2 A;  4HXX A;  1YW9 A;  4ZWP A;  2B3K A;  2V3Y A;  2V3X A;  1WN1 A;  5CE6 A;  3BIQ A;  3S6B A;  4U6Z A;  1N51 A;  4U71 A;  5FCF A;  4ZWO A;  5CDL A;  1C21 A;  5D6E A;  5JI6 A;  4RZZ A;  2BHD A;  2BN7 A;  1KQ0 A;  5CIK A;  2GG0 A;  4RZY A;  2GU5 A;  1W7V A;  2Q92 A;  4IKT A;  1O0X A;  2EVM A;  1WL6 A;  3MR1 A;  2GU7 A;  3FMR A;  2V6C A;  4FO7 A;  4RGZ 1;  4U73 A;  4IKR A;  2BHC A;  4FLL A;  4U6E A;  1XNZ A;  1W2M A;  1WBQ A;  4FLJ A;  3MX6 A;  4IU6 A;  4S2R P;  2BH3 A;  1YVM A;  4U75 A;  3MAT A;  5E5B A;  2BHA A;  4IKU A;  2GGB A;  1Y1N A;  2BWY A;  4IPA A;  2B3H A;  4A6W A;  4IF7 A;  2EA2 A;  1YW8 A;  2BWU A;  3PKE A;  3CB6 A;  1XGM A;  1WLR A;  1C27 A;  2OAZ A;  1WL9 A;  4JUQ A;  2HOW A;  1MAT A;  1XGS A;  2GZ5 A;  5JFR A;  3L7G A;  4S2T P;  4U76 A;  5JHU A;  2GG9 A;  4PV4 A;  3PKC A;  1WKM A;  2B3L A;  5CDV A;  2GGC A;  3IU9 A;  1BN5 A;  2BWS A;  2GU4 A;  2P9A A;  1C24 A;  2EVC A;  3IG4 A;  1B59 A;  3Q6D A;  1QXY A;  4U6C A;  1KQ9 A;  3TB5 A;  2GG2 A;  2OKN A;  1C22 A;  1A16 A;  4S01 A;  5CNX A;  4MAT A;  4U1B A;  3FM3 A;  2P99 A;  4FUK A;  2GTX A;  3BIT A;  3RVA A;  4IEC A;  2GG5 A;  1XGN A;  3L24 A;  2EVO A;  2NQ6 A;  1C23 A;  4FLK A;  4IKS A;  4R60 A;  3D27 A;  2NQ7 A;  2ZSG A;  4U70 A;  2GA2 A;  5CLS A;  1R5H A;  4QR8 A;  4EGE A;  2Q8K A;  2GU6 A;  3TAV A;  4Z7M A;  2P98 A;  4U69 A;  2GG8 A;  3CTZ A;  3PKB A;  3PKA A;  2BWV A;  1YJ3 A;  1QXW A;  3BIP A;  4FLI A;  2MAT A;  1R5G A;  2DFI A;  4S00 A;  4KM3 A;  4U6J A;  2BWW A;  4ZWU A;  2GG3 A;  2ADU A;  2BWT A;  2EA4 A;  3CB5 A;  2BWX A;  2Q95 A;  1JAW A;  2GG7 A;  4PNC A;  2Q93 A;  4A6V A;  2Q96 A;  4B28 A;  1M35 A;  1QZY A;  2BHB A;  2IW2 A;  2G6P A;  4IDY A;  1PV9 A;  2V3Z A;  4OOK A;  4FKC A;  2Q94 A;  3IU8 A;  1QXZ A;  1B6A A;  3FMQ A;  3IU7 A;  5CDE A;  1XGO A;  5D6F A;  1R58 A;  1BOA A;  4ZNG A;  4FO8 A;  1KP0 A;  3ROR A;  1CHM A;  5FCH A;  1YW7 A; 
#chains in the Genus database with same CATH homology
 4U6W A;  2BB7 A;  3PKD A;  1WY2 A;  4HXX A;  1YW9 A;  4ZWP A;  2B3K A;  2V3Y A;  2V3X A;  1WN1 A;  5CE6 A;  3BIQ A;  3S6B A;  4U6Z A;  1N51 A;  4U71 A;  5FCF A;  4ZWO A;  5CDL A;  1C21 A;  5D6E A;  5JI6 A;  4RZZ A;  2BHD A;  2BN7 A;  1KQ0 A;  5CIK A;  2GG0 A;  4RZY A;  2GU5 A;  1W7V A;  2Q92 A;  4IKT A;  1O0X A;  2EVM A;  1WL6 A;  3MR1 A;  2GU7 A;  3FMR A;  2V6C A;  4FO7 A;  4RGZ 1;  4U73 A;  4IKR A;  2BHC A;  4FLL A;  4U6E A;  1XNZ A;  1W2M A;  1WBQ A;  4FLJ A;  3MX6 A;  4IU6 A;  4S2R P;  2BH3 A;  1YVM A;  4U75 A;  3MAT A;  5E5B A;  2BHA A;  4IKU A;  2GGB A;  1Y1N A;  2BWY A;  4IPA A;  2B3H A;  4A6W A;  4IF7 A;  2EA2 A;  1YW8 A;  2BWU A;  3PKE A;  3CB6 A;  1XGM A;  1WLR A;  1C27 A;  2OAZ A;  1WL9 A;  4JUQ A;  2HOW A;  1MAT A;  1XGS A;  2GZ5 A;  5JFR A;  3L7G A;  4S2T P;  4U76 A;  5JHU A;  2GG9 A;  4PV4 A;  3PKC A;  1WKM A;  2B3L A;  5CDV A;  2GGC A;  3IU9 A;  1BN5 A;  2BWS A;  2GU4 A;  2P9A A;  1C24 A;  2EVC A;  3IG4 A;  1B59 A;  3Q6D A;  1QXY A;  4U6C A;  1KQ9 A;  3TB5 A;  2GG2 A;  2OKN A;  1C22 A;  1A16 A;  4S01 A;  5CNX A;  4MAT A;  4U1B A;  3FM3 A;  2P99 A;  4FUK A;  2GTX A;  3BIT A;  3RVA A;  4IEC A;  2GG5 A;  1XGN A;  3L24 A;  2EVO A;  2NQ6 A;  1C23 A;  4FLK A;  4IKS A;  4R60 A;  3D27 A;  2NQ7 A;  2ZSG A;  4U70 A;  2GA2 A;  5CLS A;  1R5H A;  4QR8 A;  4EGE A;  2Q8K A;  2GU6 A;  3TAV A;  4Z7M A;  2P98 A;  4U69 A;  2GG8 A;  3CTZ A;  3PKB A;  3PKA A;  2BWV A;  1YJ3 A;  1QXW A;  3BIP A;  4FLI A;  2MAT A;  1R5G A;  2DFI A;  4S00 A;  4KM3 A;  4U6J A;  2BWW A;  4ZWU A;  2GG3 A;  2ADU A;  2BWT A;  2EA4 A;  3CB5 A;  2BWX A;  2Q95 A;  1JAW A;  2GG7 A;  4PNC A;  2Q93 A;  4A6V A;  2Q96 A;  4B28 A;  1M35 A;  1QZY A;  2BHB A;  2IW2 A;  2G6P A;  4IDY A;  1PV9 A;  2V3Z A;  4OOK A;  4FKC A;  2Q94 A;  3IU8 A;  1QXZ A;  1B6A A;  3FMQ A;  3IU7 A;  5CDE A;  1XGO A;  5D6F A;  1R58 A;  1BOA A;  4ZNG A;  4FO8 A;  1KP0 A;  3ROR A;  1CHM A;  5FCH A;  1YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...