1YVMA

E. coli methionine aminopeptidase in complex with thiabendazole
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metal Ions as Cofactors for the Binding of Inhibitors to Methionine Aminopeptidase: A Critical View of the Relevance of In Vitro Metalloenzyme Assays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1yvmA00
2GA2A 4RGZ1 3IU7A 1WKMA 2BWVA 1BOAA 1QXYA 3PKDA 4U69A 4U75A 2BB7A 1MATA 1XNZA 5FCHA 3IU8A 1M35A 1QZYA 4FO7A 1R58A 2GG3A 2NQ6A 2ZSGA 4FLJA 2BWYA 1N51A 1YW8A 4IU6A 4KM3A 2MATA 3MR1A 2Q93A 4S2TP 4U6ZA 2GG8A 4A6WA 4U6JA 1Y1NA 1CHMA 2GU6A 4MATA 2ADUA 2G6PA 2Q94A 2BWSA 5CLSA 4IDYA 5CDVA 3FMRA 2BWXA 1QXWA 1XGOA 5D6FA 1WL6A 2BH3A 2V3XA 2GU7A 4ZWUA 1W2MA 4IF7A 2P99A 5JI6A 4A6VA 1KP0A 3CB5A 5E5BA 1R5GA 4ZWOA 2GG7A 1WBQA 2GG0A 1JAWA 2DFIA 2B3HA 5FCFA 1WY2A 3L24A 4IPAA 2EA2A 1WLRA 1YJ3A 2GU4A 3BITA 4FO8A 2IW2A 5D6EA 3S6BA 5JFRA 1B59A 4U71A 1WL9A 4ZNGA 1C21A 5CE6A 2GGBA 1R5HA 5CDLA 2EA4A 2EVMA 1PV9A 1YW9A 2GG2A 2BHCA 1C23A 3MATA 1KQ0A 2BWTA 2GTXA 4FLIA 1C22A 3RORA 2GZ5A 4U73A 1BN5A 4S01A 1B6AA 2B3KA 2V6CA 2GGCA 2V3ZA 2BWWA 3TAVA 3PKBA 4FKCA 2BHBA 2Q92A 2OKNA 3FM3A 4IKSA 2P98A 1XGNA 2V3YA 4PNCA 5JHUA 3PKAA 2Q8KA 2HOWA 4FUKA 3L7GA 3RVAA 4U6EA 4RZZA 1KQ9A 3CTZA 1XGMA 3IG4A 2EVOA 5CDEA 1C27A 2OAZA 3TB5A 4IKRA 3PKEA 4U1BA 2GG5A 3CB6A 2GU5A 4Z7MA 5CIKA 1YVMA 4IECA 1WN1A 1YW7A 2BWUA 3Q6DA 4S00A 1A16A 1C24A 3PKCA 4FLLA 2Q96A 1XGSA 4PV4A 4U6CA 2GG9A 4EGEA 4R60A 4U70A 4U6WA 2B3LA 3BIPA 4IKUA 3FMQA 1O0XA 4IKTA 1QXZA 2NQ7A 2Q95A 2P9AA 3IU9A 5CNXA 3BIQA 4HXXA 2EVCA 4OOKA 4RZYA 2BHDA 2BHAA 3MX6A 4ZWPA 4QR8A 4U76A 2BN7A 4FLKA 4B28A 4S2RP 1W7VA 4JUQA 3D27A
chains in the Genus database with same CATH superfamily
2GA2A 4RGZ1 3IU7A 1WKMA 2BWVA 1BOAA 1QXYA 3PKDA 4U69A 4U75A 2BB7A 1MATA 1XNZA 5FCHA 3IU8A 1M35A 1QZYA 4FO7A 1R58A 2GG3A 2NQ6A 2ZSGA 4FLJA 2BWYA 1N51A 1YW8A 4IU6A 4KM3A 2MATA 3MR1A 2Q93A 4S2TP 4U6ZA 2GG8A 4A6WA 4U6JA 1Y1NA 1CHMA 2GU6A 4MATA 2ADUA 2G6PA 2Q94A 2BWSA 5CLSA 4IDYA 5CDVA 3FMRA 2BWXA 1QXWA 1XGOA 5D6FA 1WL6A 2BH3A 2V3XA 2GU7A 4ZWUA 1W2MA 4IF7A 2P99A 5JI6A 4A6VA 1KP0A 3CB5A 5E5BA 1R5GA 4ZWOA 2GG7A 1WBQA 2GG0A 1JAWA 2DFIA 2B3HA 5FCFA 1WY2A 3L24A 4IPAA 2EA2A 1WLRA 1YJ3A 2GU4A 3BITA 4FO8A 2IW2A 5D6EA 3S6BA 5JFRA 1B59A 4U71A 1WL9A 4ZNGA 1C21A 5CE6A 2GGBA 1R5HA 5CDLA 2EA4A 2EVMA 1PV9A 1YW9A 2GG2A 2BHCA 1C23A 3MATA 1KQ0A 2BWTA 2GTXA 4FLIA 1C22A 3RORA 2GZ5A 4U73A 1BN5A 4S01A 1B6AA 2B3KA 2V6CA 2GGCA 2V3ZA 2BWWA 3TAVA 3PKBA 4FKCA 2BHBA 2Q92A 2OKNA 3FM3A 4IKSA 2P98A 1XGNA 2V3YA 4PNCA 5JHUA 3PKAA 2Q8KA 2HOWA 4FUKA 3L7GA 3RVAA 4U6EA 4RZZA 1KQ9A 3CTZA 1XGMA 3IG4A 2EVOA 5CDEA 1C27A 2OAZA 3TB5A 4IKRA 3PKEA 4U1BA 2GG5A 3CB6A 2GU5A 4Z7MA 5CIKA 1YVMA 4IECA 1WN1A 1YW7A 2BWUA 3Q6DA 4S00A 1A16A 1C24A 3PKCA 4FLLA 2Q96A 1XGSA 4PV4A 4U6CA 2GG9A 4EGEA 4R60A 4U70A 4U6WA 2B3LA 3BIPA 4IKUA 3FMQA 1O0XA 4IKTA 1QXZA 2NQ7A 2Q95A 2P9AA 3IU9A 5CNXA 3BIQA 4HXXA 2EVCA 4OOKA 4RZYA 2BHDA 2BHAA 3MX6A 4ZWPA 4QR8A 4U76A 2BN7A 4FLKA 4B28A 4S2RP 1W7VA 4JUQA 3D27A
chains in the Genus database with same CATH topology
2GA2A 4RGZ1 3IU7A 1WKMA 2BWVA 1BOAA 1QXYA 3PKDA 4U69A 4U75A 2BB7A 1MATA 1XNZA 5FCHA 3IU8A 1M35A 1QZYA 4FO7A 1R58A 2GG3A 2NQ6A 2ZSGA 4FLJA 2BWYA 1N51A 1YW8A 4IU6A 4KM3A 2MATA 3MR1A 2Q93A 4S2TP 4U6ZA 2GG8A 4A6WA 4U6JA 1Y1NA 1CHMA 2GU6A 4MATA 2ADUA 2G6PA 2Q94A 2BWSA 5CLSA 4IDYA 5CDVA 3FMRA 2BWXA 1QXWA 1XGOA 5D6FA 1WL6A 2BH3A 2V3XA 2GU7A 4ZWUA 1W2MA 4IF7A 2P99A 5JI6A 4A6VA 1KP0A 3CB5A 5E5BA 1R5GA 4ZWOA 2GG7A 1WBQA 2GG0A 1JAWA 2DFIA 2B3HA 5FCFA 1WY2A 3L24A 4IPAA 2EA2A 1WLRA 1YJ3A 2GU4A 3BITA 4FO8A 2IW2A 5D6EA 3S6BA 5JFRA 1B59A 4U71A 1WL9A 4ZNGA 1C21A 5CE6A 2GGBA 1R5HA 5CDLA 2EA4A 2EVMA 1PV9A 1YW9A 2GG2A 2BHCA 1C23A 3MATA 1KQ0A 2BWTA 2GTXA 4FLIA 1C22A 3RORA 2GZ5A 4U73A 1BN5A 4S01A 1B6AA 2B3KA 2V6CA 2GGCA 2V3ZA 2BWWA 3TAVA 3PKBA 4FKCA 2BHBA 2Q92A 2OKNA 3FM3A 4IKSA 2P98A 1XGNA 2V3YA 4PNCA 5JHUA 3PKAA 2Q8KA 2HOWA 4FUKA 3L7GA 3RVAA 4U6EA 4RZZA 1KQ9A 3CTZA 1XGMA 3IG4A 2EVOA 5CDEA 1C27A 2OAZA 3TB5A 4IKRA 3PKEA 4U1BA 2GG5A 3CB6A 2GU5A 4Z7MA 5CIKA 1YVMA 4IECA 1WN1A 1YW7A 2BWUA 3Q6DA 4S00A 1A16A 1C24A 3PKCA 4FLLA 2Q96A 1XGSA 4PV4A 4U6CA 2GG9A 4EGEA 4R60A 4U70A 4U6WA 2B3LA 3BIPA 4IKUA 3FMQA 1O0XA 4IKTA 1QXZA 2NQ7A 2Q95A 2P9AA 3IU9A 5CNXA 3BIQA 4HXXA 2EVCA 4OOKA 4RZYA 2BHDA 2BHAA 3MX6A 4ZWPA 4QR8A 4U76A 2BN7A 4FLKA 4B28A 4S2RP 1W7VA 4JUQA 3D27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA2 A;  4RGZ 1;  3IU7 A;  1WKM A;  2BWV A;  1BOA A;  1QXY A;  3PKD A;  4U69 A;  4U75 A;  2BB7 A;  1MAT A;  1XNZ A;  5FCH A;  3IU8 A;  1M35 A;  1QZY A;  4FO7 A;  1R58 A;  2GG3 A;  2NQ6 A;  2ZSG A;  4FLJ A;  2BWY A;  1N51 A;  1YW8 A;  4IU6 A;  4KM3 A;  2MAT A;  3MR1 A;  2Q93 A;  4S2T P;  4U6Z A;  2GG8 A;  4A6W A;  4U6J A;  1Y1N A;  1CHM A;  2GU6 A;  4MAT A;  2ADU A;  2G6P A;  2Q94 A;  2BWS A;  5CLS A;  4IDY A;  5CDV A;  3FMR A;  2BWX A;  1QXW A;  1XGO A;  5D6F A;  1WL6 A;  2BH3 A;  2V3X A;  2GU7 A;  4ZWU A;  1W2M A;  4IF7 A;  2P99 A;  5JI6 A;  4A6V A;  1KP0 A;  3CB5 A;  5E5B A;  1R5G A;  4ZWO A;  2GG7 A;  1WBQ A;  2GG0 A;  1JAW A;  2DFI A;  2B3H A;  5FCF A;  1WY2 A;  3L24 A;  4IPA A;  2EA2 A;  1WLR A;  1YJ3 A;  2GU4 A;  3BIT A;  4FO8 A;  2IW2 A;  5D6E A;  3S6B A;  5JFR A;  1B59 A;  4U71 A;  1WL9 A;  4ZNG A;  1C21 A;  5CE6 A;  2GGB A;  1R5H A;  5CDL A;  2EA4 A;  2EVM A;  1PV9 A;  1YW9 A;  2GG2 A;  2BHC A;  1C23 A;  3MAT A;  1KQ0 A;  2BWT A;  2GTX A;  4FLI A;  1C22 A;  3ROR A;  2GZ5 A;  4U73 A;  1BN5 A;  4S01 A;  1B6A A;  2B3K A;  2V6C A;  2GGC A;  2V3Z A;  2BWW A;  3TAV A;  3PKB A;  4FKC A;  2BHB A;  2Q92 A;  2OKN A;  3FM3 A;  4IKS A;  2P98 A;  1XGN A;  2V3Y A;  4PNC A;  5JHU A;  3PKA A;  2Q8K A;  2HOW A;  4FUK A;  3L7G A;  3RVA A;  4U6E A;  4RZZ A;  1KQ9 A;  3CTZ A;  1XGM A;  3IG4 A;  2EVO A;  5CDE A;  1C27 A;  2OAZ A;  3TB5 A;  4IKR A;  3PKE A;  4U1B A;  2GG5 A;  3CB6 A;  2GU5 A;  4Z7M A;  5CIK A;  1YVM A;  4IEC A;  1WN1 A;  1YW7 A;  2BWU A;  3Q6D A;  4S00 A;  1A16 A;  1C24 A;  3PKC A;  4FLL A;  2Q96 A;  1XGS A;  4PV4 A;  4U6C A;  2GG9 A;  4EGE A;  4R60 A;  4U70 A;  4U6W A;  2B3L A;  3BIP A;  4IKU A;  3FMQ A;  1O0X A;  4IKT A;  1QXZ A;  2NQ7 A;  2Q95 A;  2P9A A;  3IU9 A;  5CNX A;  3BIQ A;  4HXX A;  2EVC A;  4OOK A;  4RZY A;  2BHD A;  2BHA A;  3MX6 A;  4ZWP A;  4QR8 A;  4U76 A;  2BN7 A;  4FLK A;  4B28 A;  4S2R P;  1W7V A;  4JUQ A;  3D27 A; 
#chains in the Genus database with same CATH topology
 2GA2 A;  4RGZ 1;  3IU7 A;  1WKM A;  2BWV A;  1BOA A;  1QXY A;  3PKD A;  4U69 A;  4U75 A;  2BB7 A;  1MAT A;  1XNZ A;  5FCH A;  3IU8 A;  1M35 A;  1QZY A;  4FO7 A;  1R58 A;  2GG3 A;  2NQ6 A;  2ZSG A;  4FLJ A;  2BWY A;  1N51 A;  1YW8 A;  4IU6 A;  4KM3 A;  2MAT A;  3MR1 A;  2Q93 A;  4S2T P;  4U6Z A;  2GG8 A;  4A6W A;  4U6J A;  1Y1N A;  1CHM A;  2GU6 A;  4MAT A;  2ADU A;  2G6P A;  2Q94 A;  2BWS A;  5CLS A;  4IDY A;  5CDV A;  3FMR A;  2BWX A;  1QXW A;  1XGO A;  5D6F A;  1WL6 A;  2BH3 A;  2V3X A;  2GU7 A;  4ZWU A;  1W2M A;  4IF7 A;  2P99 A;  5JI6 A;  4A6V A;  1KP0 A;  3CB5 A;  5E5B A;  1R5G A;  4ZWO A;  2GG7 A;  1WBQ A;  2GG0 A;  1JAW A;  2DFI A;  2B3H A;  5FCF A;  1WY2 A;  3L24 A;  4IPA A;  2EA2 A;  1WLR A;  1YJ3 A;  2GU4 A;  3BIT A;  4FO8 A;  2IW2 A;  5D6E A;  3S6B A;  5JFR A;  1B59 A;  4U71 A;  1WL9 A;  4ZNG A;  1C21 A;  5CE6 A;  2GGB A;  1R5H A;  5CDL A;  2EA4 A;  2EVM A;  1PV9 A;  1YW9 A;  2GG2 A;  2BHC A;  1C23 A;  3MAT A;  1KQ0 A;  2BWT A;  2GTX A;  4FLI A;  1C22 A;  3ROR A;  2GZ5 A;  4U73 A;  1BN5 A;  4S01 A;  1B6A A;  2B3K A;  2V6C A;  2GGC A;  2V3Z A;  2BWW A;  3TAV A;  3PKB A;  4FKC A;  2BHB A;  2Q92 A;  2OKN A;  3FM3 A;  4IKS A;  2P98 A;  1XGN A;  2V3Y A;  4PNC A;  5JHU A;  3PKA A;  2Q8K A;  2HOW A;  4FUK A;  3L7G A;  3RVA A;  4U6E A;  4RZZ A;  1KQ9 A;  3CTZ A;  1XGM A;  3IG4 A;  2EVO A;  5CDE A;  1C27 A;  2OAZ A;  3TB5 A;  4IKR A;  3PKE A;  4U1B A;  2GG5 A;  3CB6 A;  2GU5 A;  4Z7M A;  5CIK A;  1YVM A;  4IEC A;  1WN1 A;  1YW7 A;  2BWU A;  3Q6D A;  4S00 A;  1A16 A;  1C24 A;  3PKC A;  4FLL A;  2Q96 A;  1XGS A;  4PV4 A;  4U6C A;  2GG9 A;  4EGE A;  4R60 A;  4U70 A;  4U6W A;  2B3L A;  3BIP A;  4IKU A;  3FMQ A;  1O0X A;  4IKT A;  1QXZ A;  2NQ7 A;  2Q95 A;  2P9A A;  3IU9 A;  5CNX A;  3BIQ A;  4HXX A;  2EVC A;  4OOK A;  4RZY A;  2BHD A;  2BHA A;  3MX6 A;  4ZWP A;  4QR8 A;  4U76 A;  2BN7 A;  4FLK A;  4B28 A;  4S2R P;  1W7V A;  4JUQ A;  3D27 A; 
#chains in the Genus database with same CATH homology
 2GA2 A;  4RGZ 1;  3IU7 A;  1WKM A;  2BWV A;  1BOA A;  1QXY A;  3PKD A;  4U69 A;  4U75 A;  2BB7 A;  1MAT A;  1XNZ A;  5FCH A;  3IU8 A;  1M35 A;  1QZY A;  4FO7 A;  1R58 A;  2GG3 A;  2NQ6 A;  2ZSG A;  4FLJ A;  2BWY A;  1N51 A;  1YW8 A;  4IU6 A;  4KM3 A;  2MAT A;  3MR1 A;  2Q93 A;  4S2T P;  4U6Z A;  2GG8 A;  4A6W A;  4U6J A;  1Y1N A;  1CHM A;  2GU6 A;  4MAT A;  2ADU A;  2G6P A;  2Q94 A;  2BWS A;  5CLS A;  4IDY A;  5CDV A;  3FMR A;  2BWX A;  1QXW A;  1XGO A;  5D6F A;  1WL6 A;  2BH3 A;  2V3X A;  2GU7 A;  4ZWU A;  1W2M A;  4IF7 A;  2P99 A;  5JI6 A;  4A6V A;  1KP0 A;  3CB5 A;  5E5B A;  1R5G A;  4ZWO A;  2GG7 A;  1WBQ A;  2GG0 A;  1JAW A;  2DFI A;  2B3H A;  5FCF A;  1WY2 A;  3L24 A;  4IPA A;  2EA2 A;  1WLR A;  1YJ3 A;  2GU4 A;  3BIT A;  4FO8 A;  2IW2 A;  5D6E A;  3S6B A;  5JFR A;  1B59 A;  4U71 A;  1WL9 A;  4ZNG A;  1C21 A;  5CE6 A;  2GGB A;  1R5H A;  5CDL A;  2EA4 A;  2EVM A;  1PV9 A;  1YW9 A;  2GG2 A;  2BHC A;  1C23 A;  3MAT A;  1KQ0 A;  2BWT A;  2GTX A;  4FLI A;  1C22 A;  3ROR A;  2GZ5 A;  4U73 A;  1BN5 A;  4S01 A;  1B6A A;  2B3K A;  2V6C A;  2GGC A;  2V3Z A;  2BWW A;  3TAV A;  3PKB A;  4FKC A;  2BHB A;  2Q92 A;  2OKN A;  3FM3 A;  4IKS A;  2P98 A;  1XGN A;  2V3Y A;  4PNC A;  5JHU A;  3PKA A;  2Q8K A;  2HOW A;  4FUK A;  3L7G A;  3RVA A;  4U6E A;  4RZZ A;  1KQ9 A;  3CTZ A;  1XGM A;  3IG4 A;  2EVO A;  5CDE A;  1C27 A;  2OAZ A;  3TB5 A;  4IKR A;  3PKE A;  4U1B A;  2GG5 A;  3CB6 A;  2GU5 A;  4Z7M A;  5CIK A;  1YVM A;  4IEC A;  1WN1 A;  1YW7 A;  2BWU A;  3Q6D A;  4S00 A;  1A16 A;  1C24 A;  3PKC A;  4FLL A;  2Q96 A;  1XGS A;  4PV4 A;  4U6C A;  2GG9 A;  4EGE A;  4R60 A;  4U70 A;  4U6W A;  2B3L A;  3BIP A;  4IKU A;  3FMQ A;  1O0X A;  4IKT A;  1QXZ A;  2NQ7 A;  2Q95 A;  2P9A A;  3IU9 A;  5CNX A;  3BIQ A;  4HXX A;  2EVC A;  4OOK A;  4RZY A;  2BHD A;  2BHA A;  3MX6 A;  4ZWP A;  4QR8 A;  4U76 A;  2BN7 A;  4FLK A;  4B28 A;  4S2R P;  1W7V A;  4JUQ A;  3D27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...