1YVMA

E. coli methionine aminopeptidase in complex with thiabendazole
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metal Ions as Cofactors for the Binding of Inhibitors to Methionine Aminopeptidase: A Critical View of the Relevance of In Vitro Metalloenzyme Assays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1yvmA00
2BB7A 2GA2A 2B3KA 4A6WA 4U70A 3RORA 1YJ3A 4RZZA 4U6EA 2GG8A 5CLSA 4RGZ1 1WLRA 2BWTA 2MATA 3L24A 1WL6A 2GG2A 1XGOA 1R5HA 1QXZA 1QXWA 5JHUA 1M35A 2EVOA 4HXXA 1XNZA 4U1BA 4IF7A 3IG4A 1C21A 3RVAA 2B3LA 2OKNA 5CDLA 2V3XA 3PKDA 4U6ZA 2V3ZA 1PV9A 4FLJA 3L7GA 3PKCA 2GGCA 2Q92A 4IKTA 2BWYA 1YW9A 4ZWUA 2GU5A 3MATA 4Z7MA 3TB5A 5CE6A 3FMQA 2BH3A 1YVMA 1YW7A 4U6WA 1KQ9A 2GG9A 3BITA 1BN5A 2V3YA 1C22A 1WBQA 4FO8A 4PNCA 4U73A 2IW2A 1JAWA 4A6VA 1QXYA 2BWWA 2GG7A 4S00A 4RZYA 1BOAA 1R5GA 2GU7A 2BHBA 2BWXA 1C23A 5CDEA 2GZ5A 1C24A 4S01A 5E5BA 3TAVA 3MX6A 3CTZA 2GTXA 4QR8A 2B3HA 5CDVA 1O0XA 4FLLA 3CB5A 3IU8A 2DFIA 4IKUA 3IU9A 2GG0A 2Q94A 3FMRA 3PKBA 4U6CA 2OAZA 2GGBA 2Q8KA 4S2RP 1QZYA 4JUQA 1Y1NA 2BN7A 4U76A 4IDYA 2P98A 2BHDA 1N51A 1MATA 1W7VA 3IU7A 2GG3A 3PKAA 4ZWPA 2NQ6A 1B6AA 4B28A 1KQ0A 2Q93A 1C27A 5CNXA 1R58A 3BIQA 1WY2A 3PKEA 4U6JA 1W2MA 4KM3A 4MATA 2ADUA 2EA2A 4U69A 2ZSGA 1B59A 1XGMA 2NQ7A 5CIKA 2EVMA 2BWUA 5D6EA 4IECA 4FUKA 3MR1A 4U75A 5FCFA 1XGNA 5JFRA 5JI6A 4IKSA 4ZWOA 1XGSA 2GU6A 5D6FA 2G6PA 2BHCA 3FM3A 1KP0A 3D27A 4S2TP 1WL9A 2Q96A 2EVCA 4FKCA 5FCHA 3S6BA 3CB6A 4IKRA 3BIPA 4FLKA 1CHMA 4FLIA 1WKMA 4IU6A 4ZNGA 2Q95A 3Q6DA 2GG5A 2P99A 2V6CA 1WN1A 1YW8A 4EGEA 4U71A 4PV4A 2P9AA 4FO7A 4IPAA 2BWSA 4R60A 2BHAA 1A16A 2HOWA 2GU4A 4OOKA 2BWVA 2EA4A
chains in the Genus database with same CATH superfamily
2BB7A 2GA2A 2B3KA 4A6WA 4U70A 3RORA 1YJ3A 4RZZA 4U6EA 2GG8A 5CLSA 4RGZ1 1WLRA 2BWTA 2MATA 3L24A 1WL6A 2GG2A 1XGOA 1R5HA 1QXZA 1QXWA 5JHUA 1M35A 2EVOA 4HXXA 1XNZA 4U1BA 4IF7A 3IG4A 1C21A 3RVAA 2B3LA 2OKNA 5CDLA 2V3XA 3PKDA 4U6ZA 2V3ZA 1PV9A 4FLJA 3L7GA 3PKCA 2GGCA 2Q92A 4IKTA 2BWYA 1YW9A 4ZWUA 2GU5A 3MATA 4Z7MA 3TB5A 5CE6A 3FMQA 2BH3A 1YVMA 1YW7A 4U6WA 1KQ9A 2GG9A 3BITA 1BN5A 2V3YA 1C22A 1WBQA 4FO8A 4PNCA 4U73A 2IW2A 1JAWA 4A6VA 1QXYA 2BWWA 2GG7A 4S00A 4RZYA 1BOAA 1R5GA 2GU7A 2BHBA 2BWXA 1C23A 5CDEA 2GZ5A 1C24A 4S01A 5E5BA 3TAVA 3MX6A 3CTZA 2GTXA 4QR8A 2B3HA 5CDVA 1O0XA 4FLLA 3CB5A 3IU8A 2DFIA 4IKUA 3IU9A 2GG0A 2Q94A 3FMRA 3PKBA 4U6CA 2OAZA 2GGBA 2Q8KA 4S2RP 1QZYA 4JUQA 1Y1NA 2BN7A 4U76A 4IDYA 2P98A 2BHDA 1N51A 1MATA 1W7VA 3IU7A 2GG3A 3PKAA 4ZWPA 2NQ6A 1B6AA 4B28A 1KQ0A 2Q93A 1C27A 5CNXA 1R58A 3BIQA 1WY2A 3PKEA 4U6JA 1W2MA 4KM3A 4MATA 2ADUA 2EA2A 4U69A 2ZSGA 1B59A 1XGMA 2NQ7A 5CIKA 2EVMA 2BWUA 5D6EA 4IECA 4FUKA 3MR1A 4U75A 5FCFA 1XGNA 5JFRA 5JI6A 4IKSA 4ZWOA 1XGSA 2GU6A 5D6FA 2G6PA 2BHCA 3FM3A 1KP0A 3D27A 4S2TP 1WL9A 2Q96A 2EVCA 4FKCA 5FCHA 3S6BA 3CB6A 4IKRA 3BIPA 4FLKA 1CHMA 4FLIA 1WKMA 4IU6A 4ZNGA 2Q95A 3Q6DA 2GG5A 2P99A 2V6CA 1WN1A 1YW8A 4EGEA 4U71A 4PV4A 2P9AA 4FO7A 4IPAA 2BWSA 4R60A 2BHAA 1A16A 2HOWA 2GU4A 4OOKA 2BWVA 2EA4A
chains in the Genus database with same CATH topology
2BB7A 2GA2A 2B3KA 4A6WA 4U70A 3RORA 1YJ3A 4RZZA 4U6EA 2GG8A 5CLSA 4RGZ1 1WLRA 2BWTA 2MATA 3L24A 1WL6A 2GG2A 1XGOA 1R5HA 1QXZA 1QXWA 5JHUA 1M35A 2EVOA 4HXXA 1XNZA 4U1BA 4IF7A 3IG4A 1C21A 3RVAA 2B3LA 2OKNA 5CDLA 2V3XA 3PKDA 4U6ZA 2V3ZA 1PV9A 4FLJA 3L7GA 3PKCA 2GGCA 2Q92A 4IKTA 2BWYA 1YW9A 4ZWUA 2GU5A 3MATA 4Z7MA 3TB5A 5CE6A 3FMQA 2BH3A 1YVMA 1YW7A 4U6WA 1KQ9A 2GG9A 3BITA 1BN5A 2V3YA 1C22A 1WBQA 4FO8A 4PNCA 4U73A 2IW2A 1JAWA 4A6VA 1QXYA 2BWWA 2GG7A 4S00A 4RZYA 1BOAA 1R5GA 2GU7A 2BHBA 2BWXA 1C23A 5CDEA 2GZ5A 1C24A 4S01A 5E5BA 3TAVA 3MX6A 3CTZA 2GTXA 4QR8A 2B3HA 5CDVA 1O0XA 4FLLA 3CB5A 3IU8A 2DFIA 4IKUA 3IU9A 2GG0A 2Q94A 3FMRA 3PKBA 4U6CA 2OAZA 2GGBA 2Q8KA 4S2RP 1QZYA 4JUQA 1Y1NA 2BN7A 4U76A 4IDYA 2P98A 2BHDA 1N51A 1MATA 1W7VA 3IU7A 2GG3A 3PKAA 4ZWPA 2NQ6A 1B6AA 4B28A 1KQ0A 2Q93A 1C27A 5CNXA 1R58A 3BIQA 1WY2A 3PKEA 4U6JA 1W2MA 4KM3A 4MATA 2ADUA 2EA2A 4U69A 2ZSGA 1B59A 1XGMA 2NQ7A 5CIKA 2EVMA 2BWUA 5D6EA 4IECA 4FUKA 3MR1A 4U75A 5FCFA 1XGNA 5JFRA 5JI6A 4IKSA 4ZWOA 1XGSA 2GU6A 5D6FA 2G6PA 2BHCA 3FM3A 1KP0A 3D27A 4S2TP 1WL9A 2Q96A 2EVCA 4FKCA 5FCHA 3S6BA 3CB6A 4IKRA 3BIPA 4FLKA 1CHMA 4FLIA 1WKMA 4IU6A 4ZNGA 2Q95A 3Q6DA 2GG5A 2P99A 2V6CA 1WN1A 1YW8A 4EGEA 4U71A 4PV4A 2P9AA 4FO7A 4IPAA 2BWSA 4R60A 2BHAA 1A16A 2HOWA 2GU4A 4OOKA 2BWVA 2EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BB7 A;  2GA2 A;  2B3K A;  4A6W A;  4U70 A;  3ROR A;  1YJ3 A;  4RZZ A;  4U6E A;  2GG8 A;  5CLS A;  4RGZ 1;  1WLR A;  2BWT A;  2MAT A;  3L24 A;  1WL6 A;  2GG2 A;  1XGO A;  1R5H A;  1QXZ A;  1QXW A;  5JHU A;  1M35 A;  2EVO A;  4HXX A;  1XNZ A;  4U1B A;  4IF7 A;  3IG4 A;  1C21 A;  3RVA A;  2B3L A;  2OKN A;  5CDL A;  2V3X A;  3PKD A;  4U6Z A;  2V3Z A;  1PV9 A;  4FLJ A;  3L7G A;  3PKC A;  2GGC A;  2Q92 A;  4IKT A;  2BWY A;  1YW9 A;  4ZWU A;  2GU5 A;  3MAT A;  4Z7M A;  3TB5 A;  5CE6 A;  3FMQ A;  2BH3 A;  1YVM A;  1YW7 A;  4U6W A;  1KQ9 A;  2GG9 A;  3BIT A;  1BN5 A;  2V3Y A;  1C22 A;  1WBQ A;  4FO8 A;  4PNC A;  4U73 A;  2IW2 A;  1JAW A;  4A6V A;  1QXY A;  2BWW A;  2GG7 A;  4S00 A;  4RZY A;  1BOA A;  1R5G A;  2GU7 A;  2BHB A;  2BWX A;  1C23 A;  5CDE A;  2GZ5 A;  1C24 A;  4S01 A;  5E5B A;  3TAV A;  3MX6 A;  3CTZ A;  2GTX A;  4QR8 A;  2B3H A;  5CDV A;  1O0X A;  4FLL A;  3CB5 A;  3IU8 A;  2DFI A;  4IKU A;  3IU9 A;  2GG0 A;  2Q94 A;  3FMR A;  3PKB A;  4U6C A;  2OAZ A;  2GGB A;  2Q8K A;  4S2R P;  1QZY A;  4JUQ A;  1Y1N A;  2BN7 A;  4U76 A;  4IDY A;  2P98 A;  2BHD A;  1N51 A;  1MAT A;  1W7V A;  3IU7 A;  2GG3 A;  3PKA A;  4ZWP A;  2NQ6 A;  1B6A A;  4B28 A;  1KQ0 A;  2Q93 A;  1C27 A;  5CNX A;  1R58 A;  3BIQ A;  1WY2 A;  3PKE A;  4U6J A;  1W2M A;  4KM3 A;  4MAT A;  2ADU A;  2EA2 A;  4U69 A;  2ZSG A;  1B59 A;  1XGM A;  2NQ7 A;  5CIK A;  2EVM A;  2BWU A;  5D6E A;  4IEC A;  4FUK A;  3MR1 A;  4U75 A;  5FCF A;  1XGN A;  5JFR A;  5JI6 A;  4IKS A;  4ZWO A;  1XGS A;  2GU6 A;  5D6F A;  2G6P A;  2BHC A;  3FM3 A;  1KP0 A;  3D27 A;  4S2T P;  1WL9 A;  2Q96 A;  2EVC A;  4FKC A;  5FCH A;  3S6B A;  3CB6 A;  4IKR A;  3BIP A;  4FLK A;  1CHM A;  4FLI A;  1WKM A;  4IU6 A;  4ZNG A;  2Q95 A;  3Q6D A;  2GG5 A;  2P99 A;  2V6C A;  1WN1 A;  1YW8 A;  4EGE A;  4U71 A;  4PV4 A;  2P9A A;  4FO7 A;  4IPA A;  2BWS A;  4R60 A;  2BHA A;  1A16 A;  2HOW A;  2GU4 A;  4OOK A;  2BWV A;  2EA4 A; 
#chains in the Genus database with same CATH topology
 2BB7 A;  2GA2 A;  2B3K A;  4A6W A;  4U70 A;  3ROR A;  1YJ3 A;  4RZZ A;  4U6E A;  2GG8 A;  5CLS A;  4RGZ 1;  1WLR A;  2BWT A;  2MAT A;  3L24 A;  1WL6 A;  2GG2 A;  1XGO A;  1R5H A;  1QXZ A;  1QXW A;  5JHU A;  1M35 A;  2EVO A;  4HXX A;  1XNZ A;  4U1B A;  4IF7 A;  3IG4 A;  1C21 A;  3RVA A;  2B3L A;  2OKN A;  5CDL A;  2V3X A;  3PKD A;  4U6Z A;  2V3Z A;  1PV9 A;  4FLJ A;  3L7G A;  3PKC A;  2GGC A;  2Q92 A;  4IKT A;  2BWY A;  1YW9 A;  4ZWU A;  2GU5 A;  3MAT A;  4Z7M A;  3TB5 A;  5CE6 A;  3FMQ A;  2BH3 A;  1YVM A;  1YW7 A;  4U6W A;  1KQ9 A;  2GG9 A;  3BIT A;  1BN5 A;  2V3Y A;  1C22 A;  1WBQ A;  4FO8 A;  4PNC A;  4U73 A;  2IW2 A;  1JAW A;  4A6V A;  1QXY A;  2BWW A;  2GG7 A;  4S00 A;  4RZY A;  1BOA A;  1R5G A;  2GU7 A;  2BHB A;  2BWX A;  1C23 A;  5CDE A;  2GZ5 A;  1C24 A;  4S01 A;  5E5B A;  3TAV A;  3MX6 A;  3CTZ A;  2GTX A;  4QR8 A;  2B3H A;  5CDV A;  1O0X A;  4FLL A;  3CB5 A;  3IU8 A;  2DFI A;  4IKU A;  3IU9 A;  2GG0 A;  2Q94 A;  3FMR A;  3PKB A;  4U6C A;  2OAZ A;  2GGB A;  2Q8K A;  4S2R P;  1QZY A;  4JUQ A;  1Y1N A;  2BN7 A;  4U76 A;  4IDY A;  2P98 A;  2BHD A;  1N51 A;  1MAT A;  1W7V A;  3IU7 A;  2GG3 A;  3PKA A;  4ZWP A;  2NQ6 A;  1B6A A;  4B28 A;  1KQ0 A;  2Q93 A;  1C27 A;  5CNX A;  1R58 A;  3BIQ A;  1WY2 A;  3PKE A;  4U6J A;  1W2M A;  4KM3 A;  4MAT A;  2ADU A;  2EA2 A;  4U69 A;  2ZSG A;  1B59 A;  1XGM A;  2NQ7 A;  5CIK A;  2EVM A;  2BWU A;  5D6E A;  4IEC A;  4FUK A;  3MR1 A;  4U75 A;  5FCF A;  1XGN A;  5JFR A;  5JI6 A;  4IKS A;  4ZWO A;  1XGS A;  2GU6 A;  5D6F A;  2G6P A;  2BHC A;  3FM3 A;  1KP0 A;  3D27 A;  4S2T P;  1WL9 A;  2Q96 A;  2EVC A;  4FKC A;  5FCH A;  3S6B A;  3CB6 A;  4IKR A;  3BIP A;  4FLK A;  1CHM A;  4FLI A;  1WKM A;  4IU6 A;  4ZNG A;  2Q95 A;  3Q6D A;  2GG5 A;  2P99 A;  2V6C A;  1WN1 A;  1YW8 A;  4EGE A;  4U71 A;  4PV4 A;  2P9A A;  4FO7 A;  4IPA A;  2BWS A;  4R60 A;  2BHA A;  1A16 A;  2HOW A;  2GU4 A;  4OOK A;  2BWV A;  2EA4 A; 
#chains in the Genus database with same CATH homology
 2BB7 A;  2GA2 A;  2B3K A;  4A6W A;  4U70 A;  3ROR A;  1YJ3 A;  4RZZ A;  4U6E A;  2GG8 A;  5CLS A;  4RGZ 1;  1WLR A;  2BWT A;  2MAT A;  3L24 A;  1WL6 A;  2GG2 A;  1XGO A;  1R5H A;  1QXZ A;  1QXW A;  5JHU A;  1M35 A;  2EVO A;  4HXX A;  1XNZ A;  4U1B A;  4IF7 A;  3IG4 A;  1C21 A;  3RVA A;  2B3L A;  2OKN A;  5CDL A;  2V3X A;  3PKD A;  4U6Z A;  2V3Z A;  1PV9 A;  4FLJ A;  3L7G A;  3PKC A;  2GGC A;  2Q92 A;  4IKT A;  2BWY A;  1YW9 A;  4ZWU A;  2GU5 A;  3MAT A;  4Z7M A;  3TB5 A;  5CE6 A;  3FMQ A;  2BH3 A;  1YVM A;  1YW7 A;  4U6W A;  1KQ9 A;  2GG9 A;  3BIT A;  1BN5 A;  2V3Y A;  1C22 A;  1WBQ A;  4FO8 A;  4PNC A;  4U73 A;  2IW2 A;  1JAW A;  4A6V A;  1QXY A;  2BWW A;  2GG7 A;  4S00 A;  4RZY A;  1BOA A;  1R5G A;  2GU7 A;  2BHB A;  2BWX A;  1C23 A;  5CDE A;  2GZ5 A;  1C24 A;  4S01 A;  5E5B A;  3TAV A;  3MX6 A;  3CTZ A;  2GTX A;  4QR8 A;  2B3H A;  5CDV A;  1O0X A;  4FLL A;  3CB5 A;  3IU8 A;  2DFI A;  4IKU A;  3IU9 A;  2GG0 A;  2Q94 A;  3FMR A;  3PKB A;  4U6C A;  2OAZ A;  2GGB A;  2Q8K A;  4S2R P;  1QZY A;  4JUQ A;  1Y1N A;  2BN7 A;  4U76 A;  4IDY A;  2P98 A;  2BHD A;  1N51 A;  1MAT A;  1W7V A;  3IU7 A;  2GG3 A;  3PKA A;  4ZWP A;  2NQ6 A;  1B6A A;  4B28 A;  1KQ0 A;  2Q93 A;  1C27 A;  5CNX A;  1R58 A;  3BIQ A;  1WY2 A;  3PKE A;  4U6J A;  1W2M A;  4KM3 A;  4MAT A;  2ADU A;  2EA2 A;  4U69 A;  2ZSG A;  1B59 A;  1XGM A;  2NQ7 A;  5CIK A;  2EVM A;  2BWU A;  5D6E A;  4IEC A;  4FUK A;  3MR1 A;  4U75 A;  5FCF A;  1XGN A;  5JFR A;  5JI6 A;  4IKS A;  4ZWO A;  1XGS A;  2GU6 A;  5D6F A;  2G6P A;  2BHC A;  3FM3 A;  1KP0 A;  3D27 A;  4S2T P;  1WL9 A;  2Q96 A;  2EVC A;  4FKC A;  5FCH A;  3S6B A;  3CB6 A;  4IKR A;  3BIP A;  4FLK A;  1CHM A;  4FLI A;  1WKM A;  4IU6 A;  4ZNG A;  2Q95 A;  3Q6D A;  2GG5 A;  2P99 A;  2V6C A;  1WN1 A;  1YW8 A;  4EGE A;  4U71 A;  4PV4 A;  2P9A A;  4FO7 A;  4IPA A;  2BWS A;  4R60 A;  2BHA A;  1A16 A;  2HOW A;  2GU4 A;  4OOK A;  2BWV A;  2EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...