1YVMA

E. coli methionine aminopeptidase in complex with thiabendazole
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal Ions as Cofactors for the Binding of Inhibitors to Methionine Aminopeptidase: A Critical View of the Relevance of In Vitro Metalloenzyme Assays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1yvmA00
2EVMA 2Q95A 4HXXA 4IDYA 4IPAA 4U71A 5CDLA 5JFRA 2B3HA 1WL6A 1KQ9A 4U69A 3BITA 2GU7A 4ZWOA 4RZZA 1A16A 2EVCA 1CHMA 4B28A 2GG7A 3IU9A 2V6CA 3L24A 5FCHA 2V3YA 3PKAA 1B59A 5CNXA 2GGCA 2Q92A 1XGSA 3FMQA 4RGZ1 4U1BA 4ZWPA 4U76A 3TAVA 1PV9A 5E5BA 2Q93A 2BWSA 3IU7A 4FLLA 1YW8A 4PV4A 3FMRA 1M35A 3L7GA 1R58A 1WN1A 2BHDA 2IW2A 4IKSA 1C21A 2Q94A 5CDVA 2BB7A 2V3ZA 4A6WA 4S01A 2GGBA 4KM3A 2DFIA 2BHBA 4ZWUA 2BWVA 2BWYA 4S2TP 3Q6DA 4IF7A 2MATA 3PKDA 4QR8A 2GG5A 1YJ3A 2BHAA 3MX6A 2HOWA 2EA2A 1C23A 2GA2A 2OKNA 1BN5A 1QZYA 1N51A 1WBQA 2OAZA 4FO8A 4OOKA 4R60A 4U6EA 4U6CA 1KQ0A 3CTZA 2Q8KA 4S2RP 2EVOA 4A6VA 1JAWA 3IG4A 2GU6A 4PNCA 2P99A 5CDEA 3D27A 2EA4A 3TB5A 3PKBA 5CLSA 4FO7A 4IU6A 3PKCA 3IU8A 1C27A 4U6JA 5CE6A 2GTXA 2Q96A 1Y1NA 4IKRA 3MATA 4ZNGA 1BOAA 2BWWA 3BIPA 1W2MA 2BWUA 1QXZA 4U73A 5CIKA 2V3XA 1XGOA 2B3KA 1WKMA 2ZSGA 5D6FA 2BWTA 4FKCA 2NQ6A 1MATA 4U70A 3PKEA 2BN7A 3FM3A 4U75A 1QXYA 1KP0A 1W7VA 1B6AA 3MR1A 1QXWA 1C24A 1C22A 2ADUA 2GG9A 4FLJA 4IKUA 3CB6A 5D6EA 2GG2A 2GU5A 4FLKA 4JUQA 1WL9A 1WLRA 3BIQA 4EGEA 2B3LA 4FUKA 4MATA 3S6BA 1XNZA 1O0XA 4RZYA 5JI6A 1YVMA 1WY2A 2G6PA 1R5GA 2NQ7A 4FLIA 2GU4A 5FCFA 4U6WA 3CB5A 2P98A 1XGNA 2BHCA 4U6ZA 2GG3A 3RVAA 2GZ5A 4Z7MA 1XGMA 4IKTA 4S00A 2P9AA 2BWXA 4IECA 1R5HA 1YW9A 5JHUA 3RORA 2BH3A 2GG0A 1YW7A 2GG8A
chains in the Genus database with same CATH superfamily
2EVMA 2Q95A 4HXXA 4IDYA 4IPAA 4U71A 5CDLA 5JFRA 2B3HA 1WL6A 1KQ9A 4U69A 3BITA 2GU7A 4ZWOA 4RZZA 1A16A 2EVCA 1CHMA 4B28A 2GG7A 3IU9A 2V6CA 3L24A 5FCHA 2V3YA 3PKAA 1B59A 5CNXA 2GGCA 2Q92A 1XGSA 3FMQA 4RGZ1 4U1BA 4ZWPA 4U76A 3TAVA 1PV9A 5E5BA 2Q93A 2BWSA 3IU7A 4FLLA 1YW8A 4PV4A 3FMRA 1M35A 3L7GA 1R58A 1WN1A 2BHDA 2IW2A 4IKSA 1C21A 2Q94A 5CDVA 2BB7A 2V3ZA 4A6WA 4S01A 2GGBA 4KM3A 2DFIA 2BHBA 4ZWUA 2BWVA 2BWYA 4S2TP 3Q6DA 4IF7A 2MATA 3PKDA 4QR8A 2GG5A 1YJ3A 2BHAA 3MX6A 2HOWA 2EA2A 1C23A 2GA2A 2OKNA 1BN5A 1QZYA 1N51A 1WBQA 2OAZA 4FO8A 4OOKA 4R60A 4U6EA 4U6CA 1KQ0A 3CTZA 2Q8KA 4S2RP 2EVOA 4A6VA 1JAWA 3IG4A 2GU6A 4PNCA 2P99A 5CDEA 3D27A 2EA4A 3TB5A 3PKBA 5CLSA 4FO7A 4IU6A 3PKCA 3IU8A 1C27A 4U6JA 5CE6A 2GTXA 2Q96A 1Y1NA 4IKRA 3MATA 4ZNGA 1BOAA 2BWWA 3BIPA 1W2MA 2BWUA 1QXZA 4U73A 5CIKA 2V3XA 1XGOA 2B3KA 1WKMA 2ZSGA 5D6FA 2BWTA 4FKCA 2NQ6A 1MATA 4U70A 3PKEA 2BN7A 3FM3A 4U75A 1QXYA 1KP0A 1W7VA 1B6AA 3MR1A 1QXWA 1C24A 1C22A 2ADUA 2GG9A 4FLJA 4IKUA 3CB6A 5D6EA 2GG2A 2GU5A 4FLKA 4JUQA 1WL9A 1WLRA 3BIQA 4EGEA 2B3LA 4FUKA 4MATA 3S6BA 1XNZA 1O0XA 4RZYA 5JI6A 1YVMA 1WY2A 2G6PA 1R5GA 2NQ7A 4FLIA 2GU4A 5FCFA 4U6WA 3CB5A 2P98A 1XGNA 2BHCA 4U6ZA 2GG3A 3RVAA 2GZ5A 4Z7MA 1XGMA 4IKTA 4S00A 2P9AA 2BWXA 4IECA 1R5HA 1YW9A 5JHUA 3RORA 2BH3A 2GG0A 1YW7A 2GG8A
chains in the Genus database with same CATH topology
2EVMA 2Q95A 4HXXA 4IDYA 4IPAA 4U71A 5CDLA 5JFRA 2B3HA 1WL6A 1KQ9A 4U69A 3BITA 2GU7A 4ZWOA 4RZZA 1A16A 2EVCA 1CHMA 4B28A 2GG7A 3IU9A 2V6CA 3L24A 5FCHA 2V3YA 3PKAA 1B59A 5CNXA 2GGCA 2Q92A 1XGSA 3FMQA 4RGZ1 4U1BA 4ZWPA 4U76A 3TAVA 1PV9A 5E5BA 2Q93A 2BWSA 3IU7A 4FLLA 1YW8A 4PV4A 3FMRA 1M35A 3L7GA 1R58A 1WN1A 2BHDA 2IW2A 4IKSA 1C21A 2Q94A 5CDVA 2BB7A 2V3ZA 4A6WA 4S01A 2GGBA 4KM3A 2DFIA 2BHBA 4ZWUA 2BWVA 2BWYA 4S2TP 3Q6DA 4IF7A 2MATA 3PKDA 4QR8A 2GG5A 1YJ3A 2BHAA 3MX6A 2HOWA 2EA2A 1C23A 2GA2A 2OKNA 1BN5A 1QZYA 1N51A 1WBQA 2OAZA 4FO8A 4OOKA 4R60A 4U6EA 4U6CA 1KQ0A 3CTZA 2Q8KA 4S2RP 2EVOA 4A6VA 1JAWA 3IG4A 2GU6A 4PNCA 2P99A 5CDEA 3D27A 2EA4A 3TB5A 3PKBA 5CLSA 4FO7A 4IU6A 3PKCA 3IU8A 1C27A 4U6JA 5CE6A 2GTXA 2Q96A 1Y1NA 4IKRA 3MATA 4ZNGA 1BOAA 2BWWA 3BIPA 1W2MA 2BWUA 1QXZA 4U73A 5CIKA 2V3XA 1XGOA 2B3KA 1WKMA 2ZSGA 5D6FA 2BWTA 4FKCA 2NQ6A 1MATA 4U70A 3PKEA 2BN7A 3FM3A 4U75A 1QXYA 1KP0A 1W7VA 1B6AA 3MR1A 1QXWA 1C24A 1C22A 2ADUA 2GG9A 4FLJA 4IKUA 3CB6A 5D6EA 2GG2A 2GU5A 4FLKA 4JUQA 1WL9A 1WLRA 3BIQA 4EGEA 2B3LA 4FUKA 4MATA 3S6BA 1XNZA 1O0XA 4RZYA 5JI6A 1YVMA 1WY2A 2G6PA 1R5GA 2NQ7A 4FLIA 2GU4A 5FCFA 4U6WA 3CB5A 2P98A 1XGNA 2BHCA 4U6ZA 2GG3A 3RVAA 2GZ5A 4Z7MA 1XGMA 4IKTA 4S00A 2P9AA 2BWXA 4IECA 1R5HA 1YW9A 5JHUA 3RORA 2BH3A 2GG0A 1YW7A 2GG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVM A;  2Q95 A;  4HXX A;  4IDY A;  4IPA A;  4U71 A;  5CDL A;  5JFR A;  2B3H A;  1WL6 A;  1KQ9 A;  4U69 A;  3BIT A;  2GU7 A;  4ZWO A;  4RZZ A;  1A16 A;  2EVC A;  1CHM A;  4B28 A;  2GG7 A;  3IU9 A;  2V6C A;  3L24 A;  5FCH A;  2V3Y A;  3PKA A;  1B59 A;  5CNX A;  2GGC A;  2Q92 A;  1XGS A;  3FMQ A;  4RGZ 1;  4U1B A;  4ZWP A;  4U76 A;  3TAV A;  1PV9 A;  5E5B A;  2Q93 A;  2BWS A;  3IU7 A;  4FLL A;  1YW8 A;  4PV4 A;  3FMR A;  1M35 A;  3L7G A;  1R58 A;  1WN1 A;  2BHD A;  2IW2 A;  4IKS A;  1C21 A;  2Q94 A;  5CDV A;  2BB7 A;  2V3Z A;  4A6W A;  4S01 A;  2GGB A;  4KM3 A;  2DFI A;  2BHB A;  4ZWU A;  2BWV A;  2BWY A;  4S2T P;  3Q6D A;  4IF7 A;  2MAT A;  3PKD A;  4QR8 A;  2GG5 A;  1YJ3 A;  2BHA A;  3MX6 A;  2HOW A;  2EA2 A;  1C23 A;  2GA2 A;  2OKN A;  1BN5 A;  1QZY A;  1N51 A;  1WBQ A;  2OAZ A;  4FO8 A;  4OOK A;  4R60 A;  4U6E A;  4U6C A;  1KQ0 A;  3CTZ A;  2Q8K A;  4S2R P;  2EVO A;  4A6V A;  1JAW A;  3IG4 A;  2GU6 A;  4PNC A;  2P99 A;  5CDE A;  3D27 A;  2EA4 A;  3TB5 A;  3PKB A;  5CLS A;  4FO7 A;  4IU6 A;  3PKC A;  3IU8 A;  1C27 A;  4U6J A;  5CE6 A;  2GTX A;  2Q96 A;  1Y1N A;  4IKR A;  3MAT A;  4ZNG A;  1BOA A;  2BWW A;  3BIP A;  1W2M A;  2BWU A;  1QXZ A;  4U73 A;  5CIK A;  2V3X A;  1XGO A;  2B3K A;  1WKM A;  2ZSG A;  5D6F A;  2BWT A;  4FKC A;  2NQ6 A;  1MAT A;  4U70 A;  3PKE A;  2BN7 A;  3FM3 A;  4U75 A;  1QXY A;  1KP0 A;  1W7V A;  1B6A A;  3MR1 A;  1QXW A;  1C24 A;  1C22 A;  2ADU A;  2GG9 A;  4FLJ A;  4IKU A;  3CB6 A;  5D6E A;  2GG2 A;  2GU5 A;  4FLK A;  4JUQ A;  1WL9 A;  1WLR A;  3BIQ A;  4EGE A;  2B3L A;  4FUK A;  4MAT A;  3S6B A;  1XNZ A;  1O0X A;  4RZY A;  5JI6 A;  1YVM A;  1WY2 A;  2G6P A;  1R5G A;  2NQ7 A;  4FLI A;  2GU4 A;  5FCF A;  4U6W A;  3CB5 A;  2P98 A;  1XGN A;  2BHC A;  4U6Z A;  2GG3 A;  3RVA A;  2GZ5 A;  4Z7M A;  1XGM A;  4IKT A;  4S00 A;  2P9A A;  2BWX A;  4IEC A;  1R5H A;  1YW9 A;  5JHU A;  3ROR A;  2BH3 A;  2GG0 A;  1YW7 A;  2GG8 A; 
#chains in the Genus database with same CATH topology
 2EVM A;  2Q95 A;  4HXX A;  4IDY A;  4IPA A;  4U71 A;  5CDL A;  5JFR A;  2B3H A;  1WL6 A;  1KQ9 A;  4U69 A;  3BIT A;  2GU7 A;  4ZWO A;  4RZZ A;  1A16 A;  2EVC A;  1CHM A;  4B28 A;  2GG7 A;  3IU9 A;  2V6C A;  3L24 A;  5FCH A;  2V3Y A;  3PKA A;  1B59 A;  5CNX A;  2GGC A;  2Q92 A;  1XGS A;  3FMQ A;  4RGZ 1;  4U1B A;  4ZWP A;  4U76 A;  3TAV A;  1PV9 A;  5E5B A;  2Q93 A;  2BWS A;  3IU7 A;  4FLL A;  1YW8 A;  4PV4 A;  3FMR A;  1M35 A;  3L7G A;  1R58 A;  1WN1 A;  2BHD A;  2IW2 A;  4IKS A;  1C21 A;  2Q94 A;  5CDV A;  2BB7 A;  2V3Z A;  4A6W A;  4S01 A;  2GGB A;  4KM3 A;  2DFI A;  2BHB A;  4ZWU A;  2BWV A;  2BWY A;  4S2T P;  3Q6D A;  4IF7 A;  2MAT A;  3PKD A;  4QR8 A;  2GG5 A;  1YJ3 A;  2BHA A;  3MX6 A;  2HOW A;  2EA2 A;  1C23 A;  2GA2 A;  2OKN A;  1BN5 A;  1QZY A;  1N51 A;  1WBQ A;  2OAZ A;  4FO8 A;  4OOK A;  4R60 A;  4U6E A;  4U6C A;  1KQ0 A;  3CTZ A;  2Q8K A;  4S2R P;  2EVO A;  4A6V A;  1JAW A;  3IG4 A;  2GU6 A;  4PNC A;  2P99 A;  5CDE A;  3D27 A;  2EA4 A;  3TB5 A;  3PKB A;  5CLS A;  4FO7 A;  4IU6 A;  3PKC A;  3IU8 A;  1C27 A;  4U6J A;  5CE6 A;  2GTX A;  2Q96 A;  1Y1N A;  4IKR A;  3MAT A;  4ZNG A;  1BOA A;  2BWW A;  3BIP A;  1W2M A;  2BWU A;  1QXZ A;  4U73 A;  5CIK A;  2V3X A;  1XGO A;  2B3K A;  1WKM A;  2ZSG A;  5D6F A;  2BWT A;  4FKC A;  2NQ6 A;  1MAT A;  4U70 A;  3PKE A;  2BN7 A;  3FM3 A;  4U75 A;  1QXY A;  1KP0 A;  1W7V A;  1B6A A;  3MR1 A;  1QXW A;  1C24 A;  1C22 A;  2ADU A;  2GG9 A;  4FLJ A;  4IKU A;  3CB6 A;  5D6E A;  2GG2 A;  2GU5 A;  4FLK A;  4JUQ A;  1WL9 A;  1WLR A;  3BIQ A;  4EGE A;  2B3L A;  4FUK A;  4MAT A;  3S6B A;  1XNZ A;  1O0X A;  4RZY A;  5JI6 A;  1YVM A;  1WY2 A;  2G6P A;  1R5G A;  2NQ7 A;  4FLI A;  2GU4 A;  5FCF A;  4U6W A;  3CB5 A;  2P98 A;  1XGN A;  2BHC A;  4U6Z A;  2GG3 A;  3RVA A;  2GZ5 A;  4Z7M A;  1XGM A;  4IKT A;  4S00 A;  2P9A A;  2BWX A;  4IEC A;  1R5H A;  1YW9 A;  5JHU A;  3ROR A;  2BH3 A;  2GG0 A;  1YW7 A;  2GG8 A; 
#chains in the Genus database with same CATH homology
 2EVM A;  2Q95 A;  4HXX A;  4IDY A;  4IPA A;  4U71 A;  5CDL A;  5JFR A;  2B3H A;  1WL6 A;  1KQ9 A;  4U69 A;  3BIT A;  2GU7 A;  4ZWO A;  4RZZ A;  1A16 A;  2EVC A;  1CHM A;  4B28 A;  2GG7 A;  3IU9 A;  2V6C A;  3L24 A;  5FCH A;  2V3Y A;  3PKA A;  1B59 A;  5CNX A;  2GGC A;  2Q92 A;  1XGS A;  3FMQ A;  4RGZ 1;  4U1B A;  4ZWP A;  4U76 A;  3TAV A;  1PV9 A;  5E5B A;  2Q93 A;  2BWS A;  3IU7 A;  4FLL A;  1YW8 A;  4PV4 A;  3FMR A;  1M35 A;  3L7G A;  1R58 A;  1WN1 A;  2BHD A;  2IW2 A;  4IKS A;  1C21 A;  2Q94 A;  5CDV A;  2BB7 A;  2V3Z A;  4A6W A;  4S01 A;  2GGB A;  4KM3 A;  2DFI A;  2BHB A;  4ZWU A;  2BWV A;  2BWY A;  4S2T P;  3Q6D A;  4IF7 A;  2MAT A;  3PKD A;  4QR8 A;  2GG5 A;  1YJ3 A;  2BHA A;  3MX6 A;  2HOW A;  2EA2 A;  1C23 A;  2GA2 A;  2OKN A;  1BN5 A;  1QZY A;  1N51 A;  1WBQ A;  2OAZ A;  4FO8 A;  4OOK A;  4R60 A;  4U6E A;  4U6C A;  1KQ0 A;  3CTZ A;  2Q8K A;  4S2R P;  2EVO A;  4A6V A;  1JAW A;  3IG4 A;  2GU6 A;  4PNC A;  2P99 A;  5CDE A;  3D27 A;  2EA4 A;  3TB5 A;  3PKB A;  5CLS A;  4FO7 A;  4IU6 A;  3PKC A;  3IU8 A;  1C27 A;  4U6J A;  5CE6 A;  2GTX A;  2Q96 A;  1Y1N A;  4IKR A;  3MAT A;  4ZNG A;  1BOA A;  2BWW A;  3BIP A;  1W2M A;  2BWU A;  1QXZ A;  4U73 A;  5CIK A;  2V3X A;  1XGO A;  2B3K A;  1WKM A;  2ZSG A;  5D6F A;  2BWT A;  4FKC A;  2NQ6 A;  1MAT A;  4U70 A;  3PKE A;  2BN7 A;  3FM3 A;  4U75 A;  1QXY A;  1KP0 A;  1W7V A;  1B6A A;  3MR1 A;  1QXW A;  1C24 A;  1C22 A;  2ADU A;  2GG9 A;  4FLJ A;  4IKU A;  3CB6 A;  5D6E A;  2GG2 A;  2GU5 A;  4FLK A;  4JUQ A;  1WL9 A;  1WLR A;  3BIQ A;  4EGE A;  2B3L A;  4FUK A;  4MAT A;  3S6B A;  1XNZ A;  1O0X A;  4RZY A;  5JI6 A;  1YVM A;  1WY2 A;  2G6P A;  1R5G A;  2NQ7 A;  4FLI A;  2GU4 A;  5FCF A;  4U6W A;  3CB5 A;  2P98 A;  1XGN A;  2BHC A;  4U6Z A;  2GG3 A;  3RVA A;  2GZ5 A;  4Z7M A;  1XGM A;  4IKT A;  4S00 A;  2P9A A;  2BWX A;  4IEC A;  1R5H A;  1YW9 A;  5JHU A;  3ROR A;  2BH3 A;  2GG0 A;  1YW7 A;  2GG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...