1YVMA

E. coli methionine aminopeptidase in complex with thiabendazole
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal Ions as Cofactors for the Binding of Inhibitors to Methionine Aminopeptidase: A Critical View of the Relevance of In Vitro Metalloenzyme Assays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1yvmA00
4U6JA 3L24A 3BITA 2Q92A 4PNCA 4QR8A 4RZYA 5D6FA 2V6CA 2BHDA 1R5GA 4IDYA 3IU7A 2G6PA 1C27A 4IPAA 4U6WA 1C22A 1Y1NA 2Q93A 3FMQA 1XNZA 2GGBA 4RGZ1 5CLSA 2GG8A 2OAZA 1KQ0A 1CHMA 2GU7A 1BOAA 1W7VA 2GG5A 2IW2A 4U70A 4MATA 1YW7A 3IU8A 2DFIA 4U6ZA 2EVCA 1YW8A 5D6EA 3Q6DA 2GG3A 4FKCA 4FLIA 1WBQA 2BHAA 4U76A 1B6AA 3BIQA 2P99A 3MX6A 2Q94A 3MR1A 1C21A 1C24A 2EA2A 2Q95A 4U69A 2NQ6A 4EGEA 1WY2A 3PKDA 3CTZA 2BWWA 2GTXA 2EA4A 4HXXA 1WKMA 3TB5A 4A6VA 1YVMA 3IG4A 3BIPA 1MATA 2GGCA 3MATA 1WL6A 4U1BA 4IKSA 2BN7A 2BWSA 4S00A 4FLKA 1B59A 4IKRA 5CNXA 2EVMA 3PKBA 4IECA 4R60A 4S2RP 2ADUA 5JHUA 3S6BA 1XGSA 5CE6A 5FCHA 1W2MA 1YW9A 3FMRA 4IKTA 1QZYA 1PV9A 2B3HA 1YJ3A 5FCFA 3IU9A 2GA2A 4ZWPA 3TAVA 2GU5A 4S01A 1N51A 2B3KA 2Q8KA 4IF7A 1M35A 5JFRA 1BN5A 3CB6A 5CDVA 5JI6A 4FO8A 1XGOA 3D27A 3FM3A 5CIKA 2BB7A 3RVAA 4U73A 2HOWA 4ZWUA 4ZWOA 1QXZA 4A6WA 1QXWA 2BWYA 2P98A 4RZZA 1WLRA 3PKEA 4JUQA 4KM3A 3CB5A 2BH3A 1R5HA 2GG0A 3PKAA 4FLJA 2BWVA 2V3YA 4U75A 2B3LA 4FLLA 4FO7A 2BWUA 1KP0A 2EVOA 1A16A 2GG2A 1C23A 4B28A 5E5BA 2V3ZA 2BWXA 5CDLA 2GU6A 4U6CA 2V3XA 2OKNA 3L7GA 1R58A 2BHCA 1XGMA 1JAWA 4IU6A 1WL9A 2BWTA 4IKUA 4Z7MA 4U71A 2P9AA 4PV4A 3RORA 2BHBA 4S2TP 4ZNGA 1WN1A 4OOKA 2Q96A 2ZSGA 1XGNA 1O0XA 5CDEA 2NQ7A 2GZ5A 1QXYA 2GU4A 4U6EA 2MATA 1KQ9A 2GG7A 2GG9A 3PKCA 4FUKA
chains in the Genus database with same CATH superfamily
4U6JA 3L24A 3BITA 2Q92A 4PNCA 4QR8A 4RZYA 5D6FA 2V6CA 2BHDA 1R5GA 4IDYA 3IU7A 2G6PA 1C27A 4IPAA 4U6WA 1C22A 1Y1NA 2Q93A 3FMQA 1XNZA 2GGBA 4RGZ1 5CLSA 2GG8A 2OAZA 1KQ0A 1CHMA 2GU7A 1BOAA 1W7VA 2GG5A 2IW2A 4U70A 4MATA 1YW7A 3IU8A 2DFIA 4U6ZA 2EVCA 1YW8A 5D6EA 3Q6DA 2GG3A 4FKCA 4FLIA 1WBQA 2BHAA 4U76A 1B6AA 3BIQA 2P99A 3MX6A 2Q94A 3MR1A 1C21A 1C24A 2EA2A 2Q95A 4U69A 2NQ6A 4EGEA 1WY2A 3PKDA 3CTZA 2BWWA 2GTXA 2EA4A 4HXXA 1WKMA 3TB5A 4A6VA 1YVMA 3IG4A 3BIPA 1MATA 2GGCA 3MATA 1WL6A 4U1BA 4IKSA 2BN7A 2BWSA 4S00A 4FLKA 1B59A 4IKRA 5CNXA 2EVMA 3PKBA 4IECA 4R60A 4S2RP 2ADUA 5JHUA 3S6BA 1XGSA 5CE6A 5FCHA 1W2MA 1YW9A 3FMRA 4IKTA 1QZYA 1PV9A 2B3HA 1YJ3A 5FCFA 3IU9A 2GA2A 4ZWPA 3TAVA 2GU5A 4S01A 1N51A 2B3KA 2Q8KA 4IF7A 1M35A 5JFRA 1BN5A 3CB6A 5CDVA 5JI6A 4FO8A 1XGOA 3D27A 3FM3A 5CIKA 2BB7A 3RVAA 4U73A 2HOWA 4ZWUA 4ZWOA 1QXZA 4A6WA 1QXWA 2BWYA 2P98A 4RZZA 1WLRA 3PKEA 4JUQA 4KM3A 3CB5A 2BH3A 1R5HA 2GG0A 3PKAA 4FLJA 2BWVA 2V3YA 4U75A 2B3LA 4FLLA 4FO7A 2BWUA 1KP0A 2EVOA 1A16A 2GG2A 1C23A 4B28A 5E5BA 2V3ZA 2BWXA 5CDLA 2GU6A 4U6CA 2V3XA 2OKNA 3L7GA 1R58A 2BHCA 1XGMA 1JAWA 4IU6A 1WL9A 2BWTA 4IKUA 4Z7MA 4U71A 2P9AA 4PV4A 3RORA 2BHBA 4S2TP 4ZNGA 1WN1A 4OOKA 2Q96A 2ZSGA 1XGNA 1O0XA 5CDEA 2NQ7A 2GZ5A 1QXYA 2GU4A 4U6EA 2MATA 1KQ9A 2GG7A 2GG9A 3PKCA 4FUKA
chains in the Genus database with same CATH topology
4U6JA 3L24A 3BITA 2Q92A 4PNCA 4QR8A 4RZYA 5D6FA 2V6CA 2BHDA 1R5GA 4IDYA 3IU7A 2G6PA 1C27A 4IPAA 4U6WA 1C22A 1Y1NA 2Q93A 3FMQA 1XNZA 2GGBA 4RGZ1 5CLSA 2GG8A 2OAZA 1KQ0A 1CHMA 2GU7A 1BOAA 1W7VA 2GG5A 2IW2A 4U70A 4MATA 1YW7A 3IU8A 2DFIA 4U6ZA 2EVCA 1YW8A 5D6EA 3Q6DA 2GG3A 4FKCA 4FLIA 1WBQA 2BHAA 4U76A 1B6AA 3BIQA 2P99A 3MX6A 2Q94A 3MR1A 1C21A 1C24A 2EA2A 2Q95A 4U69A 2NQ6A 4EGEA 1WY2A 3PKDA 3CTZA 2BWWA 2GTXA 2EA4A 4HXXA 1WKMA 3TB5A 4A6VA 1YVMA 3IG4A 3BIPA 1MATA 2GGCA 3MATA 1WL6A 4U1BA 4IKSA 2BN7A 2BWSA 4S00A 4FLKA 1B59A 4IKRA 5CNXA 2EVMA 3PKBA 4IECA 4R60A 4S2RP 2ADUA 5JHUA 3S6BA 1XGSA 5CE6A 5FCHA 1W2MA 1YW9A 3FMRA 4IKTA 1QZYA 1PV9A 2B3HA 1YJ3A 5FCFA 3IU9A 2GA2A 4ZWPA 3TAVA 2GU5A 4S01A 1N51A 2B3KA 2Q8KA 4IF7A 1M35A 5JFRA 1BN5A 3CB6A 5CDVA 5JI6A 4FO8A 1XGOA 3D27A 3FM3A 5CIKA 2BB7A 3RVAA 4U73A 2HOWA 4ZWUA 4ZWOA 1QXZA 4A6WA 1QXWA 2BWYA 2P98A 4RZZA 1WLRA 3PKEA 4JUQA 4KM3A 3CB5A 2BH3A 1R5HA 2GG0A 3PKAA 4FLJA 2BWVA 2V3YA 4U75A 2B3LA 4FLLA 4FO7A 2BWUA 1KP0A 2EVOA 1A16A 2GG2A 1C23A 4B28A 5E5BA 2V3ZA 2BWXA 5CDLA 2GU6A 4U6CA 2V3XA 2OKNA 3L7GA 1R58A 2BHCA 1XGMA 1JAWA 4IU6A 1WL9A 2BWTA 4IKUA 4Z7MA 4U71A 2P9AA 4PV4A 3RORA 2BHBA 4S2TP 4ZNGA 1WN1A 4OOKA 2Q96A 2ZSGA 1XGNA 1O0XA 5CDEA 2NQ7A 2GZ5A 1QXYA 2GU4A 4U6EA 2MATA 1KQ9A 2GG7A 2GG9A 3PKCA 4FUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6J A;  3L24 A;  3BIT A;  2Q92 A;  4PNC A;  4QR8 A;  4RZY A;  5D6F A;  2V6C A;  2BHD A;  1R5G A;  4IDY A;  3IU7 A;  2G6P A;  1C27 A;  4IPA A;  4U6W A;  1C22 A;  1Y1N A;  2Q93 A;  3FMQ A;  1XNZ A;  2GGB A;  4RGZ 1;  5CLS A;  2GG8 A;  2OAZ A;  1KQ0 A;  1CHM A;  2GU7 A;  1BOA A;  1W7V A;  2GG5 A;  2IW2 A;  4U70 A;  4MAT A;  1YW7 A;  3IU8 A;  2DFI A;  4U6Z A;  2EVC A;  1YW8 A;  5D6E A;  3Q6D A;  2GG3 A;  4FKC A;  4FLI A;  1WBQ A;  2BHA A;  4U76 A;  1B6A A;  3BIQ A;  2P99 A;  3MX6 A;  2Q94 A;  3MR1 A;  1C21 A;  1C24 A;  2EA2 A;  2Q95 A;  4U69 A;  2NQ6 A;  4EGE A;  1WY2 A;  3PKD A;  3CTZ A;  2BWW A;  2GTX A;  2EA4 A;  4HXX A;  1WKM A;  3TB5 A;  4A6V A;  1YVM A;  3IG4 A;  3BIP A;  1MAT A;  2GGC A;  3MAT A;  1WL6 A;  4U1B A;  4IKS A;  2BN7 A;  2BWS A;  4S00 A;  4FLK A;  1B59 A;  4IKR A;  5CNX A;  2EVM A;  3PKB A;  4IEC A;  4R60 A;  4S2R P;  2ADU A;  5JHU A;  3S6B A;  1XGS A;  5CE6 A;  5FCH A;  1W2M A;  1YW9 A;  3FMR A;  4IKT A;  1QZY A;  1PV9 A;  2B3H A;  1YJ3 A;  5FCF A;  3IU9 A;  2GA2 A;  4ZWP A;  3TAV A;  2GU5 A;  4S01 A;  1N51 A;  2B3K A;  2Q8K A;  4IF7 A;  1M35 A;  5JFR A;  1BN5 A;  3CB6 A;  5CDV A;  5JI6 A;  4FO8 A;  1XGO A;  3D27 A;  3FM3 A;  5CIK A;  2BB7 A;  3RVA A;  4U73 A;  2HOW A;  4ZWU A;  4ZWO A;  1QXZ A;  4A6W A;  1QXW A;  2BWY A;  2P98 A;  4RZZ A;  1WLR A;  3PKE A;  4JUQ A;  4KM3 A;  3CB5 A;  2BH3 A;  1R5H A;  2GG0 A;  3PKA A;  4FLJ A;  2BWV A;  2V3Y A;  4U75 A;  2B3L A;  4FLL A;  4FO7 A;  2BWU A;  1KP0 A;  2EVO A;  1A16 A;  2GG2 A;  1C23 A;  4B28 A;  5E5B A;  2V3Z A;  2BWX A;  5CDL A;  2GU6 A;  4U6C A;  2V3X A;  2OKN A;  3L7G A;  1R58 A;  2BHC A;  1XGM A;  1JAW A;  4IU6 A;  1WL9 A;  2BWT A;  4IKU A;  4Z7M A;  4U71 A;  2P9A A;  4PV4 A;  3ROR A;  2BHB A;  4S2T P;  4ZNG A;  1WN1 A;  4OOK A;  2Q96 A;  2ZSG A;  1XGN A;  1O0X A;  5CDE A;  2NQ7 A;  2GZ5 A;  1QXY A;  2GU4 A;  4U6E A;  2MAT A;  1KQ9 A;  2GG7 A;  2GG9 A;  3PKC A;  4FUK A; 
#chains in the Genus database with same CATH topology
 4U6J A;  3L24 A;  3BIT A;  2Q92 A;  4PNC A;  4QR8 A;  4RZY A;  5D6F A;  2V6C A;  2BHD A;  1R5G A;  4IDY A;  3IU7 A;  2G6P A;  1C27 A;  4IPA A;  4U6W A;  1C22 A;  1Y1N A;  2Q93 A;  3FMQ A;  1XNZ A;  2GGB A;  4RGZ 1;  5CLS A;  2GG8 A;  2OAZ A;  1KQ0 A;  1CHM A;  2GU7 A;  1BOA A;  1W7V A;  2GG5 A;  2IW2 A;  4U70 A;  4MAT A;  1YW7 A;  3IU8 A;  2DFI A;  4U6Z A;  2EVC A;  1YW8 A;  5D6E A;  3Q6D A;  2GG3 A;  4FKC A;  4FLI A;  1WBQ A;  2BHA A;  4U76 A;  1B6A A;  3BIQ A;  2P99 A;  3MX6 A;  2Q94 A;  3MR1 A;  1C21 A;  1C24 A;  2EA2 A;  2Q95 A;  4U69 A;  2NQ6 A;  4EGE A;  1WY2 A;  3PKD A;  3CTZ A;  2BWW A;  2GTX A;  2EA4 A;  4HXX A;  1WKM A;  3TB5 A;  4A6V A;  1YVM A;  3IG4 A;  3BIP A;  1MAT A;  2GGC A;  3MAT A;  1WL6 A;  4U1B A;  4IKS A;  2BN7 A;  2BWS A;  4S00 A;  4FLK A;  1B59 A;  4IKR A;  5CNX A;  2EVM A;  3PKB A;  4IEC A;  4R60 A;  4S2R P;  2ADU A;  5JHU A;  3S6B A;  1XGS A;  5CE6 A;  5FCH A;  1W2M A;  1YW9 A;  3FMR A;  4IKT A;  1QZY A;  1PV9 A;  2B3H A;  1YJ3 A;  5FCF A;  3IU9 A;  2GA2 A;  4ZWP A;  3TAV A;  2GU5 A;  4S01 A;  1N51 A;  2B3K A;  2Q8K A;  4IF7 A;  1M35 A;  5JFR A;  1BN5 A;  3CB6 A;  5CDV A;  5JI6 A;  4FO8 A;  1XGO A;  3D27 A;  3FM3 A;  5CIK A;  2BB7 A;  3RVA A;  4U73 A;  2HOW A;  4ZWU A;  4ZWO A;  1QXZ A;  4A6W A;  1QXW A;  2BWY A;  2P98 A;  4RZZ A;  1WLR A;  3PKE A;  4JUQ A;  4KM3 A;  3CB5 A;  2BH3 A;  1R5H A;  2GG0 A;  3PKA A;  4FLJ A;  2BWV A;  2V3Y A;  4U75 A;  2B3L A;  4FLL A;  4FO7 A;  2BWU A;  1KP0 A;  2EVO A;  1A16 A;  2GG2 A;  1C23 A;  4B28 A;  5E5B A;  2V3Z A;  2BWX A;  5CDL A;  2GU6 A;  4U6C A;  2V3X A;  2OKN A;  3L7G A;  1R58 A;  2BHC A;  1XGM A;  1JAW A;  4IU6 A;  1WL9 A;  2BWT A;  4IKU A;  4Z7M A;  4U71 A;  2P9A A;  4PV4 A;  3ROR A;  2BHB A;  4S2T P;  4ZNG A;  1WN1 A;  4OOK A;  2Q96 A;  2ZSG A;  1XGN A;  1O0X A;  5CDE A;  2NQ7 A;  2GZ5 A;  1QXY A;  2GU4 A;  4U6E A;  2MAT A;  1KQ9 A;  2GG7 A;  2GG9 A;  3PKC A;  4FUK A; 
#chains in the Genus database with same CATH homology
 4U6J A;  3L24 A;  3BIT A;  2Q92 A;  4PNC A;  4QR8 A;  4RZY A;  5D6F A;  2V6C A;  2BHD A;  1R5G A;  4IDY A;  3IU7 A;  2G6P A;  1C27 A;  4IPA A;  4U6W A;  1C22 A;  1Y1N A;  2Q93 A;  3FMQ A;  1XNZ A;  2GGB A;  4RGZ 1;  5CLS A;  2GG8 A;  2OAZ A;  1KQ0 A;  1CHM A;  2GU7 A;  1BOA A;  1W7V A;  2GG5 A;  2IW2 A;  4U70 A;  4MAT A;  1YW7 A;  3IU8 A;  2DFI A;  4U6Z A;  2EVC A;  1YW8 A;  5D6E A;  3Q6D A;  2GG3 A;  4FKC A;  4FLI A;  1WBQ A;  2BHA A;  4U76 A;  1B6A A;  3BIQ A;  2P99 A;  3MX6 A;  2Q94 A;  3MR1 A;  1C21 A;  1C24 A;  2EA2 A;  2Q95 A;  4U69 A;  2NQ6 A;  4EGE A;  1WY2 A;  3PKD A;  3CTZ A;  2BWW A;  2GTX A;  2EA4 A;  4HXX A;  1WKM A;  3TB5 A;  4A6V A;  1YVM A;  3IG4 A;  3BIP A;  1MAT A;  2GGC A;  3MAT A;  1WL6 A;  4U1B A;  4IKS A;  2BN7 A;  2BWS A;  4S00 A;  4FLK A;  1B59 A;  4IKR A;  5CNX A;  2EVM A;  3PKB A;  4IEC A;  4R60 A;  4S2R P;  2ADU A;  5JHU A;  3S6B A;  1XGS A;  5CE6 A;  5FCH A;  1W2M A;  1YW9 A;  3FMR A;  4IKT A;  1QZY A;  1PV9 A;  2B3H A;  1YJ3 A;  5FCF A;  3IU9 A;  2GA2 A;  4ZWP A;  3TAV A;  2GU5 A;  4S01 A;  1N51 A;  2B3K A;  2Q8K A;  4IF7 A;  1M35 A;  5JFR A;  1BN5 A;  3CB6 A;  5CDV A;  5JI6 A;  4FO8 A;  1XGO A;  3D27 A;  3FM3 A;  5CIK A;  2BB7 A;  3RVA A;  4U73 A;  2HOW A;  4ZWU A;  4ZWO A;  1QXZ A;  4A6W A;  1QXW A;  2BWY A;  2P98 A;  4RZZ A;  1WLR A;  3PKE A;  4JUQ A;  4KM3 A;  3CB5 A;  2BH3 A;  1R5H A;  2GG0 A;  3PKA A;  4FLJ A;  2BWV A;  2V3Y A;  4U75 A;  2B3L A;  4FLL A;  4FO7 A;  2BWU A;  1KP0 A;  2EVO A;  1A16 A;  2GG2 A;  1C23 A;  4B28 A;  5E5B A;  2V3Z A;  2BWX A;  5CDL A;  2GU6 A;  4U6C A;  2V3X A;  2OKN A;  3L7G A;  1R58 A;  2BHC A;  1XGM A;  1JAW A;  4IU6 A;  1WL9 A;  2BWT A;  4IKU A;  4Z7M A;  4U71 A;  2P9A A;  4PV4 A;  3ROR A;  2BHB A;  4S2T P;  4ZNG A;  1WN1 A;  4OOK A;  2Q96 A;  2ZSG A;  1XGN A;  1O0X A;  5CDE A;  2NQ7 A;  2GZ5 A;  1QXY A;  2GU4 A;  4U6E A;  2MAT A;  1KQ9 A;  2GG7 A;  2GG9 A;  3PKC A;  4FUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...