1YVMA

E. coli methionine aminopeptidase in complex with thiabendazole
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Metal Ions as Cofactors for the Binding of Inhibitors to Methionine Aminopeptidase: A Critical View of the Relevance of In Vitro Metalloenzyme Assays.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1yvmA00
3MATA 2V6CA 3IG4A 5CDVA 4FLLA 2BHBA 4IKSA 1WLRA 4U69A 4U6ZA 2EA2A 4KM3A 5CE6A 1W2MA 2B3LA 1B59A 4PV4A 1R5GA 2P9AA 2B3KA 3PKDA 4U6EA 5CIKA 4Z7MA 2IW2A 1QZYA 4QR8A 4U73A 2B3HA 2BH3A 2GZ5A 4U6CA 3MR1A 1QXYA 4S01A 1XGOA 4FUKA 1PV9A 4OOKA 1C22A 1B6AA 4IPAA 2BHCA 1WBQA 4MATA 2Q92A 3PKBA 3L7GA 4FLKA 3FM3A 2HOWA 4S2TP 2GG0A 4FO8A 2GG5A 5D6EA 2BWWA 2ADUA 1YW7A 2EVCA 4ZNGA 2GTXA 5CLSA 1C23A 4IECA 1MATA 2NQ6A 5JI6A 2EVMA 2ZSGA 4PNCA 4FKCA 4U75A 2GG3A 1XGSA 1WL9A 4IF7A 4IU6A 1C27A 2G6PA 2Q96A 1N51A 2GU4A 1JAWA 3FMQA 4ZWUA 2BWXA 1C24A 4A6VA 3S6BA 4R60A 5JFRA 4U6WA 2MATA 1CHMA 4B28A 4FLIA 4IDYA 2BN7A 2BWYA 1YW8A 2BHDA 4U6JA 1W7VA 4ZWOA 3PKCA 3RVAA 2EA4A 1BN5A 2V3YA 2GGBA 2BWSA 2GG7A 2V3ZA 1XNZA 2GG9A 2OKNA 3FMRA 1YJ3A 4U1BA 1BOAA 2GU7A 5CNXA 1A16A 3TAVA 1O0XA 2Q8KA 4IKRA 4U70A 1KQ9A 1WY2A 2GG2A 3L24A 2NQ7A 2P98A 1WL6A 4IKUA 4S00A 2Q95A 1R58A 3MX6A 2P99A 1Y1NA 3IU9A 4FO7A 5CDEA 5FCFA 3BIPA 1WKMA 1WN1A 4JUQA 4IKTA 2BWTA 3D27A 5CDLA 4S2RP 3BITA 1XGNA 3TB5A 3PKAA 5E5BA 4ZWPA 1XGMA 2Q93A 1QXZA 1QXWA 5JHUA 4A6WA 1C21A 2Q94A 2EVOA 2BWUA 3IU8A 2GU5A 5FCHA 2GA2A 1YW9A 3BIQA 2OAZA 4HXXA 4EGEA 2GG8A 4RZZA 4U71A 3Q6DA 2GU6A 3CTZA 2V3XA 3CB6A 3IU7A 2DFIA 4U76A 1KP0A 2GGCA 4FLJA 2BB7A 3CB5A 4RGZ1 2BHAA 2BWVA 1KQ0A 3RORA 4RZYA 1R5HA 1M35A 5D6FA 3PKEA 1YVMA
chains in the Genus database with same CATH superfamily
3MATA 2V6CA 3IG4A 5CDVA 4FLLA 2BHBA 4IKSA 1WLRA 4U69A 4U6ZA 2EA2A 4KM3A 5CE6A 1W2MA 2B3LA 1B59A 4PV4A 1R5GA 2P9AA 2B3KA 3PKDA 4U6EA 5CIKA 4Z7MA 2IW2A 1QZYA 4QR8A 4U73A 2B3HA 2BH3A 2GZ5A 4U6CA 3MR1A 1QXYA 4S01A 1XGOA 4FUKA 1PV9A 4OOKA 1C22A 1B6AA 4IPAA 2BHCA 1WBQA 4MATA 2Q92A 3PKBA 3L7GA 4FLKA 3FM3A 2HOWA 4S2TP 2GG0A 4FO8A 2GG5A 5D6EA 2BWWA 2ADUA 1YW7A 2EVCA 4ZNGA 2GTXA 5CLSA 1C23A 4IECA 1MATA 2NQ6A 5JI6A 2EVMA 2ZSGA 4PNCA 4FKCA 4U75A 2GG3A 1XGSA 1WL9A 4IF7A 4IU6A 1C27A 2G6PA 2Q96A 1N51A 2GU4A 1JAWA 3FMQA 4ZWUA 2BWXA 1C24A 4A6VA 3S6BA 4R60A 5JFRA 4U6WA 2MATA 1CHMA 4B28A 4FLIA 4IDYA 2BN7A 2BWYA 1YW8A 2BHDA 4U6JA 1W7VA 4ZWOA 3PKCA 3RVAA 2EA4A 1BN5A 2V3YA 2GGBA 2BWSA 2GG7A 2V3ZA 1XNZA 2GG9A 2OKNA 3FMRA 1YJ3A 4U1BA 1BOAA 2GU7A 5CNXA 1A16A 3TAVA 1O0XA 2Q8KA 4IKRA 4U70A 1KQ9A 1WY2A 2GG2A 3L24A 2NQ7A 2P98A 1WL6A 4IKUA 4S00A 2Q95A 1R58A 3MX6A 2P99A 1Y1NA 3IU9A 4FO7A 5CDEA 5FCFA 3BIPA 1WKMA 1WN1A 4JUQA 4IKTA 2BWTA 3D27A 5CDLA 4S2RP 3BITA 1XGNA 3TB5A 3PKAA 5E5BA 4ZWPA 1XGMA 2Q93A 1QXZA 1QXWA 5JHUA 4A6WA 1C21A 2Q94A 2EVOA 2BWUA 3IU8A 2GU5A 5FCHA 2GA2A 1YW9A 3BIQA 2OAZA 4HXXA 4EGEA 2GG8A 4RZZA 4U71A 3Q6DA 2GU6A 3CTZA 2V3XA 3CB6A 3IU7A 2DFIA 4U76A 1KP0A 2GGCA 4FLJA 2BB7A 3CB5A 4RGZ1 2BHAA 2BWVA 1KQ0A 3RORA 4RZYA 1R5HA 1M35A 5D6FA 3PKEA 1YVMA
chains in the Genus database with same CATH topology
3MATA 2V6CA 3IG4A 5CDVA 4FLLA 2BHBA 4IKSA 1WLRA 4U69A 4U6ZA 2EA2A 4KM3A 5CE6A 1W2MA 2B3LA 1B59A 4PV4A 1R5GA 2P9AA 2B3KA 3PKDA 4U6EA 5CIKA 4Z7MA 2IW2A 1QZYA 4QR8A 4U73A 2B3HA 2BH3A 2GZ5A 4U6CA 3MR1A 1QXYA 4S01A 1XGOA 4FUKA 1PV9A 4OOKA 1C22A 1B6AA 4IPAA 2BHCA 1WBQA 4MATA 2Q92A 3PKBA 3L7GA 4FLKA 3FM3A 2HOWA 4S2TP 2GG0A 4FO8A 2GG5A 5D6EA 2BWWA 2ADUA 1YW7A 2EVCA 4ZNGA 2GTXA 5CLSA 1C23A 4IECA 1MATA 2NQ6A 5JI6A 2EVMA 2ZSGA 4PNCA 4FKCA 4U75A 2GG3A 1XGSA 1WL9A 4IF7A 4IU6A 1C27A 2G6PA 2Q96A 1N51A 2GU4A 1JAWA 3FMQA 4ZWUA 2BWXA 1C24A 4A6VA 3S6BA 4R60A 5JFRA 4U6WA 2MATA 1CHMA 4B28A 4FLIA 4IDYA 2BN7A 2BWYA 1YW8A 2BHDA 4U6JA 1W7VA 4ZWOA 3PKCA 3RVAA 2EA4A 1BN5A 2V3YA 2GGBA 2BWSA 2GG7A 2V3ZA 1XNZA 2GG9A 2OKNA 3FMRA 1YJ3A 4U1BA 1BOAA 2GU7A 5CNXA 1A16A 3TAVA 1O0XA 2Q8KA 4IKRA 4U70A 1KQ9A 1WY2A 2GG2A 3L24A 2NQ7A 2P98A 1WL6A 4IKUA 4S00A 2Q95A 1R58A 3MX6A 2P99A 1Y1NA 3IU9A 4FO7A 5CDEA 5FCFA 3BIPA 1WKMA 1WN1A 4JUQA 4IKTA 2BWTA 3D27A 5CDLA 4S2RP 3BITA 1XGNA 3TB5A 3PKAA 5E5BA 4ZWPA 1XGMA 2Q93A 1QXZA 1QXWA 5JHUA 4A6WA 1C21A 2Q94A 2EVOA 2BWUA 3IU8A 2GU5A 5FCHA 2GA2A 1YW9A 3BIQA 2OAZA 4HXXA 4EGEA 2GG8A 4RZZA 4U71A 3Q6DA 2GU6A 3CTZA 2V3XA 3CB6A 3IU7A 2DFIA 4U76A 1KP0A 2GGCA 4FLJA 2BB7A 3CB5A 4RGZ1 2BHAA 2BWVA 1KQ0A 3RORA 4RZYA 1R5HA 1M35A 5D6FA 3PKEA 1YVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAT A;  2V6C A;  3IG4 A;  5CDV A;  4FLL A;  2BHB A;  4IKS A;  1WLR A;  4U69 A;  4U6Z A;  2EA2 A;  4KM3 A;  5CE6 A;  1W2M A;  2B3L A;  1B59 A;  4PV4 A;  1R5G A;  2P9A A;  2B3K A;  3PKD A;  4U6E A;  5CIK A;  4Z7M A;  2IW2 A;  1QZY A;  4QR8 A;  4U73 A;  2B3H A;  2BH3 A;  2GZ5 A;  4U6C A;  3MR1 A;  1QXY A;  4S01 A;  1XGO A;  4FUK A;  1PV9 A;  4OOK A;  1C22 A;  1B6A A;  4IPA A;  2BHC A;  1WBQ A;  4MAT A;  2Q92 A;  3PKB A;  3L7G A;  4FLK A;  3FM3 A;  2HOW A;  4S2T P;  2GG0 A;  4FO8 A;  2GG5 A;  5D6E A;  2BWW A;  2ADU A;  1YW7 A;  2EVC A;  4ZNG A;  2GTX A;  5CLS A;  1C23 A;  4IEC A;  1MAT A;  2NQ6 A;  5JI6 A;  2EVM A;  2ZSG A;  4PNC A;  4FKC A;  4U75 A;  2GG3 A;  1XGS A;  1WL9 A;  4IF7 A;  4IU6 A;  1C27 A;  2G6P A;  2Q96 A;  1N51 A;  2GU4 A;  1JAW A;  3FMQ A;  4ZWU A;  2BWX A;  1C24 A;  4A6V A;  3S6B A;  4R60 A;  5JFR A;  4U6W A;  2MAT A;  1CHM A;  4B28 A;  4FLI A;  4IDY A;  2BN7 A;  2BWY A;  1YW8 A;  2BHD A;  4U6J A;  1W7V A;  4ZWO A;  3PKC A;  3RVA A;  2EA4 A;  1BN5 A;  2V3Y A;  2GGB A;  2BWS A;  2GG7 A;  2V3Z A;  1XNZ A;  2GG9 A;  2OKN A;  3FMR A;  1YJ3 A;  4U1B A;  1BOA A;  2GU7 A;  5CNX A;  1A16 A;  3TAV A;  1O0X A;  2Q8K A;  4IKR A;  4U70 A;  1KQ9 A;  1WY2 A;  2GG2 A;  3L24 A;  2NQ7 A;  2P98 A;  1WL6 A;  4IKU A;  4S00 A;  2Q95 A;  1R58 A;  3MX6 A;  2P99 A;  1Y1N A;  3IU9 A;  4FO7 A;  5CDE A;  5FCF A;  3BIP A;  1WKM A;  1WN1 A;  4JUQ A;  4IKT A;  2BWT A;  3D27 A;  5CDL A;  4S2R P;  3BIT A;  1XGN A;  3TB5 A;  3PKA A;  5E5B A;  4ZWP A;  1XGM A;  2Q93 A;  1QXZ A;  1QXW A;  5JHU A;  4A6W A;  1C21 A;  2Q94 A;  2EVO A;  2BWU A;  3IU8 A;  2GU5 A;  5FCH A;  2GA2 A;  1YW9 A;  3BIQ A;  2OAZ A;  4HXX A;  4EGE A;  2GG8 A;  4RZZ A;  4U71 A;  3Q6D A;  2GU6 A;  3CTZ A;  2V3X A;  3CB6 A;  3IU7 A;  2DFI A;  4U76 A;  1KP0 A;  2GGC A;  4FLJ A;  2BB7 A;  3CB5 A;  4RGZ 1;  2BHA A;  2BWV A;  1KQ0 A;  3ROR A;  4RZY A;  1R5H A;  1M35 A;  5D6F A;  3PKE A;  1YVM A; 
#chains in the Genus database with same CATH topology
 3MAT A;  2V6C A;  3IG4 A;  5CDV A;  4FLL A;  2BHB A;  4IKS A;  1WLR A;  4U69 A;  4U6Z A;  2EA2 A;  4KM3 A;  5CE6 A;  1W2M A;  2B3L A;  1B59 A;  4PV4 A;  1R5G A;  2P9A A;  2B3K A;  3PKD A;  4U6E A;  5CIK A;  4Z7M A;  2IW2 A;  1QZY A;  4QR8 A;  4U73 A;  2B3H A;  2BH3 A;  2GZ5 A;  4U6C A;  3MR1 A;  1QXY A;  4S01 A;  1XGO A;  4FUK A;  1PV9 A;  4OOK A;  1C22 A;  1B6A A;  4IPA A;  2BHC A;  1WBQ A;  4MAT A;  2Q92 A;  3PKB A;  3L7G A;  4FLK A;  3FM3 A;  2HOW A;  4S2T P;  2GG0 A;  4FO8 A;  2GG5 A;  5D6E A;  2BWW A;  2ADU A;  1YW7 A;  2EVC A;  4ZNG A;  2GTX A;  5CLS A;  1C23 A;  4IEC A;  1MAT A;  2NQ6 A;  5JI6 A;  2EVM A;  2ZSG A;  4PNC A;  4FKC A;  4U75 A;  2GG3 A;  1XGS A;  1WL9 A;  4IF7 A;  4IU6 A;  1C27 A;  2G6P A;  2Q96 A;  1N51 A;  2GU4 A;  1JAW A;  3FMQ A;  4ZWU A;  2BWX A;  1C24 A;  4A6V A;  3S6B A;  4R60 A;  5JFR A;  4U6W A;  2MAT A;  1CHM A;  4B28 A;  4FLI A;  4IDY A;  2BN7 A;  2BWY A;  1YW8 A;  2BHD A;  4U6J A;  1W7V A;  4ZWO A;  3PKC A;  3RVA A;  2EA4 A;  1BN5 A;  2V3Y A;  2GGB A;  2BWS A;  2GG7 A;  2V3Z A;  1XNZ A;  2GG9 A;  2OKN A;  3FMR A;  1YJ3 A;  4U1B A;  1BOA A;  2GU7 A;  5CNX A;  1A16 A;  3TAV A;  1O0X A;  2Q8K A;  4IKR A;  4U70 A;  1KQ9 A;  1WY2 A;  2GG2 A;  3L24 A;  2NQ7 A;  2P98 A;  1WL6 A;  4IKU A;  4S00 A;  2Q95 A;  1R58 A;  3MX6 A;  2P99 A;  1Y1N A;  3IU9 A;  4FO7 A;  5CDE A;  5FCF A;  3BIP A;  1WKM A;  1WN1 A;  4JUQ A;  4IKT A;  2BWT A;  3D27 A;  5CDL A;  4S2R P;  3BIT A;  1XGN A;  3TB5 A;  3PKA A;  5E5B A;  4ZWP A;  1XGM A;  2Q93 A;  1QXZ A;  1QXW A;  5JHU A;  4A6W A;  1C21 A;  2Q94 A;  2EVO A;  2BWU A;  3IU8 A;  2GU5 A;  5FCH A;  2GA2 A;  1YW9 A;  3BIQ A;  2OAZ A;  4HXX A;  4EGE A;  2GG8 A;  4RZZ A;  4U71 A;  3Q6D A;  2GU6 A;  3CTZ A;  2V3X A;  3CB6 A;  3IU7 A;  2DFI A;  4U76 A;  1KP0 A;  2GGC A;  4FLJ A;  2BB7 A;  3CB5 A;  4RGZ 1;  2BHA A;  2BWV A;  1KQ0 A;  3ROR A;  4RZY A;  1R5H A;  1M35 A;  5D6F A;  3PKE A;  1YVM A; 
#chains in the Genus database with same CATH homology
 3MAT A;  2V6C A;  3IG4 A;  5CDV A;  4FLL A;  2BHB A;  4IKS A;  1WLR A;  4U69 A;  4U6Z A;  2EA2 A;  4KM3 A;  5CE6 A;  1W2M A;  2B3L A;  1B59 A;  4PV4 A;  1R5G A;  2P9A A;  2B3K A;  3PKD A;  4U6E A;  5CIK A;  4Z7M A;  2IW2 A;  1QZY A;  4QR8 A;  4U73 A;  2B3H A;  2BH3 A;  2GZ5 A;  4U6C A;  3MR1 A;  1QXY A;  4S01 A;  1XGO A;  4FUK A;  1PV9 A;  4OOK A;  1C22 A;  1B6A A;  4IPA A;  2BHC A;  1WBQ A;  4MAT A;  2Q92 A;  3PKB A;  3L7G A;  4FLK A;  3FM3 A;  2HOW A;  4S2T P;  2GG0 A;  4FO8 A;  2GG5 A;  5D6E A;  2BWW A;  2ADU A;  1YW7 A;  2EVC A;  4ZNG A;  2GTX A;  5CLS A;  1C23 A;  4IEC A;  1MAT A;  2NQ6 A;  5JI6 A;  2EVM A;  2ZSG A;  4PNC A;  4FKC A;  4U75 A;  2GG3 A;  1XGS A;  1WL9 A;  4IF7 A;  4IU6 A;  1C27 A;  2G6P A;  2Q96 A;  1N51 A;  2GU4 A;  1JAW A;  3FMQ A;  4ZWU A;  2BWX A;  1C24 A;  4A6V A;  3S6B A;  4R60 A;  5JFR A;  4U6W A;  2MAT A;  1CHM A;  4B28 A;  4FLI A;  4IDY A;  2BN7 A;  2BWY A;  1YW8 A;  2BHD A;  4U6J A;  1W7V A;  4ZWO A;  3PKC A;  3RVA A;  2EA4 A;  1BN5 A;  2V3Y A;  2GGB A;  2BWS A;  2GG7 A;  2V3Z A;  1XNZ A;  2GG9 A;  2OKN A;  3FMR A;  1YJ3 A;  4U1B A;  1BOA A;  2GU7 A;  5CNX A;  1A16 A;  3TAV A;  1O0X A;  2Q8K A;  4IKR A;  4U70 A;  1KQ9 A;  1WY2 A;  2GG2 A;  3L24 A;  2NQ7 A;  2P98 A;  1WL6 A;  4IKU A;  4S00 A;  2Q95 A;  1R58 A;  3MX6 A;  2P99 A;  1Y1N A;  3IU9 A;  4FO7 A;  5CDE A;  5FCF A;  3BIP A;  1WKM A;  1WN1 A;  4JUQ A;  4IKT A;  2BWT A;  3D27 A;  5CDL A;  4S2R P;  3BIT A;  1XGN A;  3TB5 A;  3PKA A;  5E5B A;  4ZWP A;  1XGM A;  2Q93 A;  1QXZ A;  1QXW A;  5JHU A;  4A6W A;  1C21 A;  2Q94 A;  2EVO A;  2BWU A;  3IU8 A;  2GU5 A;  5FCH A;  2GA2 A;  1YW9 A;  3BIQ A;  2OAZ A;  4HXX A;  4EGE A;  2GG8 A;  4RZZ A;  4U71 A;  3Q6D A;  2GU6 A;  3CTZ A;  2V3X A;  3CB6 A;  3IU7 A;  2DFI A;  4U76 A;  1KP0 A;  2GGC A;  4FLJ A;  2BB7 A;  3CB5 A;  4RGZ 1;  2BHA A;  2BWV A;  1KQ0 A;  3ROR A;  4RZY A;  1R5H A;  1M35 A;  5D6F A;  3PKE A;  1YVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...