4PNCA

E. coli methionine aminopeptidase in complex with inhibitor 7-methoxy-2-methylen-3,4-dihydronaphthalen-1(2h)-one
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beta-aminoketones as prodrugs for selective irreversible inhibitors of type-1 methionine aminopeptidases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4pncA00
2GG5A 1CHMA 4QR8A 3Q6DA 4Z7MA 4U76A 2BHAA 2BN7A 4IKSA 4U6CA 1XGNA 3MX6A 5CLSA 1XGMA 4JUQA 3IG4A 3IU8A 2BH3A 3IU7A 4PV4A 1C23A 1KQ0A 1N51A 2P99A 1QXYA 1B6AA 1YW9A 3S6BA 4B28A 4S2RP 3FMQA 3TAVA 5CNXA 2BHCA 3L24A 1WY2A 2Q93A 1PV9A 2NQ7A 2NQ6A 4IDYA 2BWUA 3MR1A 1WBQA 2GG0A 3BIQA 1MATA 2BWWA 1W2MA 1WLRA 4IKTA 4IECA 5D6FA 4IU6A 4U6ZA 2GG8A 4U73A 4RGZ1 4R60A 3RORA 4S01A 1O0XA 1QXZA 4S00A 2G6PA 4S2TP 2P9AA 2B3LA 3RVAA 4FLKA 1M35A 2Q92A 3IU9A 4MATA 2Q95A 4IKRA 2EVMA 4ZWPA 5D6EA 4U6JA 2ADUA 4IKUA 1YW8A 4U6WA 3BIPA 1R5GA 2EVCA 2OKNA 3PKAA 5JHUA 1YW7A 3BITA 2GU4A 4IF7A 4ZNGA 1WN1A 4EGEA 2OAZA 5E5BA 2EA4A 2ZSGA 1BN5A 4OOKA 4HXXA 3FM3A 4U69A 2BWTA 2BWSA 4ZWUA 4FUKA 2GG7A 1YJ3A 3PKEA 2GU7A 1KP0A 1QXWA 3CB5A 4FLJA 2IW2A 2B3KA 5CIKA 2GG9A 2GA2A 4FO8A 4A6WA 4U6EA 3L7GA 3TB5A 5FCHA 1KQ9A 4KM3A 3PKBA 4FO7A 2V3XA 2V3YA 4FLLA 2V6CA 5CE6A 1QZYA 2DFIA 2EVOA 2GU6A 1XGOA 1JAWA 3CTZA 3PKDA 2EA2A 2GZ5A 2GG3A 4FLIA 3FMRA 1YVMA 2Q96A 5CDEA 5JI6A 1BOAA 4RZZA 2Q94A 1C21A 3PKCA 3MATA 4U70A 2BHBA 1WL6A 3D27A 1XGSA 1Y1NA 2Q8KA 4A6VA 5CDLA 2BWVA 4ZWOA 3CB6A 1B59A 4U75A 2P98A 1R58A 4RZYA 1WL9A 2GGBA 2V3ZA 2BB7A 2GGCA 2BWYA 1C27A 1W7VA 2GTXA 4PNCA 4U71A 2B3HA 2BHDA 1C24A 1R5HA 2MATA 4FKCA 2GG2A 1WKMA 1XNZA 4U1BA 5JFRA 1A16A 5FCFA 5CDVA 1C22A 4IPAA 2BWXA 2GU5A 2HOWA
chains in the Genus database with same CATH superfamily
2GG5A 1CHMA 4QR8A 3Q6DA 4Z7MA 4U76A 2BHAA 2BN7A 4IKSA 4U6CA 1XGNA 3MX6A 5CLSA 1XGMA 4JUQA 3IG4A 3IU8A 2BH3A 3IU7A 4PV4A 1C23A 1KQ0A 1N51A 2P99A 1QXYA 1B6AA 1YW9A 3S6BA 4B28A 4S2RP 3FMQA 3TAVA 5CNXA 2BHCA 3L24A 1WY2A 2Q93A 1PV9A 2NQ7A 2NQ6A 4IDYA 2BWUA 3MR1A 1WBQA 2GG0A 3BIQA 1MATA 2BWWA 1W2MA 1WLRA 4IKTA 4IECA 5D6FA 4IU6A 4U6ZA 2GG8A 4U73A 4RGZ1 4R60A 3RORA 4S01A 1O0XA 1QXZA 4S00A 2G6PA 4S2TP 2P9AA 2B3LA 3RVAA 4FLKA 1M35A 2Q92A 3IU9A 4MATA 2Q95A 4IKRA 2EVMA 4ZWPA 5D6EA 4U6JA 2ADUA 4IKUA 1YW8A 4U6WA 3BIPA 1R5GA 2EVCA 2OKNA 3PKAA 5JHUA 1YW7A 3BITA 2GU4A 4IF7A 4ZNGA 1WN1A 4EGEA 2OAZA 5E5BA 2EA4A 2ZSGA 1BN5A 4OOKA 4HXXA 3FM3A 4U69A 2BWTA 2BWSA 4ZWUA 4FUKA 2GG7A 1YJ3A 3PKEA 2GU7A 1KP0A 1QXWA 3CB5A 4FLJA 2IW2A 2B3KA 5CIKA 2GG9A 2GA2A 4FO8A 4A6WA 4U6EA 3L7GA 3TB5A 5FCHA 1KQ9A 4KM3A 3PKBA 4FO7A 2V3XA 2V3YA 4FLLA 2V6CA 5CE6A 1QZYA 2DFIA 2EVOA 2GU6A 1XGOA 1JAWA 3CTZA 3PKDA 2EA2A 2GZ5A 2GG3A 4FLIA 3FMRA 1YVMA 2Q96A 5CDEA 5JI6A 1BOAA 4RZZA 2Q94A 1C21A 3PKCA 3MATA 4U70A 2BHBA 1WL6A 3D27A 1XGSA 1Y1NA 2Q8KA 4A6VA 5CDLA 2BWVA 4ZWOA 3CB6A 1B59A 4U75A 2P98A 1R58A 4RZYA 1WL9A 2GGBA 2V3ZA 2BB7A 2GGCA 2BWYA 1C27A 1W7VA 2GTXA 4PNCA 4U71A 2B3HA 2BHDA 1C24A 1R5HA 2MATA 4FKCA 2GG2A 1WKMA 1XNZA 4U1BA 5JFRA 1A16A 5FCFA 5CDVA 1C22A 4IPAA 2BWXA 2GU5A 2HOWA
chains in the Genus database with same CATH topology
2GG5A 1CHMA 4QR8A 3Q6DA 4Z7MA 4U76A 2BHAA 2BN7A 4IKSA 4U6CA 1XGNA 3MX6A 5CLSA 1XGMA 4JUQA 3IG4A 3IU8A 2BH3A 3IU7A 4PV4A 1C23A 1KQ0A 1N51A 2P99A 1QXYA 1B6AA 1YW9A 3S6BA 4B28A 4S2RP 3FMQA 3TAVA 5CNXA 2BHCA 3L24A 1WY2A 2Q93A 1PV9A 2NQ7A 2NQ6A 4IDYA 2BWUA 3MR1A 1WBQA 2GG0A 3BIQA 1MATA 2BWWA 1W2MA 1WLRA 4IKTA 4IECA 5D6FA 4IU6A 4U6ZA 2GG8A 4U73A 4RGZ1 4R60A 3RORA 4S01A 1O0XA 1QXZA 4S00A 2G6PA 4S2TP 2P9AA 2B3LA 3RVAA 4FLKA 1M35A 2Q92A 3IU9A 4MATA 2Q95A 4IKRA 2EVMA 4ZWPA 5D6EA 4U6JA 2ADUA 4IKUA 1YW8A 4U6WA 3BIPA 1R5GA 2EVCA 2OKNA 3PKAA 5JHUA 1YW7A 3BITA 2GU4A 4IF7A 4ZNGA 1WN1A 4EGEA 2OAZA 5E5BA 2EA4A 2ZSGA 1BN5A 4OOKA 4HXXA 3FM3A 4U69A 2BWTA 2BWSA 4ZWUA 4FUKA 2GG7A 1YJ3A 3PKEA 2GU7A 1KP0A 1QXWA 3CB5A 4FLJA 2IW2A 2B3KA 5CIKA 2GG9A 2GA2A 4FO8A 4A6WA 4U6EA 3L7GA 3TB5A 5FCHA 1KQ9A 4KM3A 3PKBA 4FO7A 2V3XA 2V3YA 4FLLA 2V6CA 5CE6A 1QZYA 2DFIA 2EVOA 2GU6A 1XGOA 1JAWA 3CTZA 3PKDA 2EA2A 2GZ5A 2GG3A 4FLIA 3FMRA 1YVMA 2Q96A 5CDEA 5JI6A 1BOAA 4RZZA 2Q94A 1C21A 3PKCA 3MATA 4U70A 2BHBA 1WL6A 3D27A 1XGSA 1Y1NA 2Q8KA 4A6VA 5CDLA 2BWVA 4ZWOA 3CB6A 1B59A 4U75A 2P98A 1R58A 4RZYA 1WL9A 2GGBA 2V3ZA 2BB7A 2GGCA 2BWYA 1C27A 1W7VA 2GTXA 4PNCA 4U71A 2B3HA 2BHDA 1C24A 1R5HA 2MATA 4FKCA 2GG2A 1WKMA 1XNZA 4U1BA 5JFRA 1A16A 5FCFA 5CDVA 1C22A 4IPAA 2BWXA 2GU5A 2HOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG5 A;  1CHM A;  4QR8 A;  3Q6D A;  4Z7M A;  4U76 A;  2BHA A;  2BN7 A;  4IKS A;  4U6C A;  1XGN A;  3MX6 A;  5CLS A;  1XGM A;  4JUQ A;  3IG4 A;  3IU8 A;  2BH3 A;  3IU7 A;  4PV4 A;  1C23 A;  1KQ0 A;  1N51 A;  2P99 A;  1QXY A;  1B6A A;  1YW9 A;  3S6B A;  4B28 A;  4S2R P;  3FMQ A;  3TAV A;  5CNX A;  2BHC A;  3L24 A;  1WY2 A;  2Q93 A;  1PV9 A;  2NQ7 A;  2NQ6 A;  4IDY A;  2BWU A;  3MR1 A;  1WBQ A;  2GG0 A;  3BIQ A;  1MAT A;  2BWW A;  1W2M A;  1WLR A;  4IKT A;  4IEC A;  5D6F A;  4IU6 A;  4U6Z A;  2GG8 A;  4U73 A;  4RGZ 1;  4R60 A;  3ROR A;  4S01 A;  1O0X A;  1QXZ A;  4S00 A;  2G6P A;  4S2T P;  2P9A A;  2B3L A;  3RVA A;  4FLK A;  1M35 A;  2Q92 A;  3IU9 A;  4MAT A;  2Q95 A;  4IKR A;  2EVM A;  4ZWP A;  5D6E A;  4U6J A;  2ADU A;  4IKU A;  1YW8 A;  4U6W A;  3BIP A;  1R5G A;  2EVC A;  2OKN A;  3PKA A;  5JHU A;  1YW7 A;  3BIT A;  2GU4 A;  4IF7 A;  4ZNG A;  1WN1 A;  4EGE A;  2OAZ A;  5E5B A;  2EA4 A;  2ZSG A;  1BN5 A;  4OOK A;  4HXX A;  3FM3 A;  4U69 A;  2BWT A;  2BWS A;  4ZWU A;  4FUK A;  2GG7 A;  1YJ3 A;  3PKE A;  2GU7 A;  1KP0 A;  1QXW A;  3CB5 A;  4FLJ A;  2IW2 A;  2B3K A;  5CIK A;  2GG9 A;  2GA2 A;  4FO8 A;  4A6W A;  4U6E A;  3L7G A;  3TB5 A;  5FCH A;  1KQ9 A;  4KM3 A;  3PKB A;  4FO7 A;  2V3X A;  2V3Y A;  4FLL A;  2V6C A;  5CE6 A;  1QZY A;  2DFI A;  2EVO A;  2GU6 A;  1XGO A;  1JAW A;  3CTZ A;  3PKD A;  2EA2 A;  2GZ5 A;  2GG3 A;  4FLI A;  3FMR A;  1YVM A;  2Q96 A;  5CDE A;  5JI6 A;  1BOA A;  4RZZ A;  2Q94 A;  1C21 A;  3PKC A;  3MAT A;  4U70 A;  2BHB A;  1WL6 A;  3D27 A;  1XGS A;  1Y1N A;  2Q8K A;  4A6V A;  5CDL A;  2BWV A;  4ZWO A;  3CB6 A;  1B59 A;  4U75 A;  2P98 A;  1R58 A;  4RZY A;  1WL9 A;  2GGB A;  2V3Z A;  2BB7 A;  2GGC A;  2BWY A;  1C27 A;  1W7V A;  2GTX A;  4PNC A;  4U71 A;  2B3H A;  2BHD A;  1C24 A;  1R5H A;  2MAT A;  4FKC A;  2GG2 A;  1WKM A;  1XNZ A;  4U1B A;  5JFR A;  1A16 A;  5FCF A;  5CDV A;  1C22 A;  4IPA A;  2BWX A;  2GU5 A;  2HOW A; 
#chains in the Genus database with same CATH topology
 2GG5 A;  1CHM A;  4QR8 A;  3Q6D A;  4Z7M A;  4U76 A;  2BHA A;  2BN7 A;  4IKS A;  4U6C A;  1XGN A;  3MX6 A;  5CLS A;  1XGM A;  4JUQ A;  3IG4 A;  3IU8 A;  2BH3 A;  3IU7 A;  4PV4 A;  1C23 A;  1KQ0 A;  1N51 A;  2P99 A;  1QXY A;  1B6A A;  1YW9 A;  3S6B A;  4B28 A;  4S2R P;  3FMQ A;  3TAV A;  5CNX A;  2BHC A;  3L24 A;  1WY2 A;  2Q93 A;  1PV9 A;  2NQ7 A;  2NQ6 A;  4IDY A;  2BWU A;  3MR1 A;  1WBQ A;  2GG0 A;  3BIQ A;  1MAT A;  2BWW A;  1W2M A;  1WLR A;  4IKT A;  4IEC A;  5D6F A;  4IU6 A;  4U6Z A;  2GG8 A;  4U73 A;  4RGZ 1;  4R60 A;  3ROR A;  4S01 A;  1O0X A;  1QXZ A;  4S00 A;  2G6P A;  4S2T P;  2P9A A;  2B3L A;  3RVA A;  4FLK A;  1M35 A;  2Q92 A;  3IU9 A;  4MAT A;  2Q95 A;  4IKR A;  2EVM A;  4ZWP A;  5D6E A;  4U6J A;  2ADU A;  4IKU A;  1YW8 A;  4U6W A;  3BIP A;  1R5G A;  2EVC A;  2OKN A;  3PKA A;  5JHU A;  1YW7 A;  3BIT A;  2GU4 A;  4IF7 A;  4ZNG A;  1WN1 A;  4EGE A;  2OAZ A;  5E5B A;  2EA4 A;  2ZSG A;  1BN5 A;  4OOK A;  4HXX A;  3FM3 A;  4U69 A;  2BWT A;  2BWS A;  4ZWU A;  4FUK A;  2GG7 A;  1YJ3 A;  3PKE A;  2GU7 A;  1KP0 A;  1QXW A;  3CB5 A;  4FLJ A;  2IW2 A;  2B3K A;  5CIK A;  2GG9 A;  2GA2 A;  4FO8 A;  4A6W A;  4U6E A;  3L7G A;  3TB5 A;  5FCH A;  1KQ9 A;  4KM3 A;  3PKB A;  4FO7 A;  2V3X A;  2V3Y A;  4FLL A;  2V6C A;  5CE6 A;  1QZY A;  2DFI A;  2EVO A;  2GU6 A;  1XGO A;  1JAW A;  3CTZ A;  3PKD A;  2EA2 A;  2GZ5 A;  2GG3 A;  4FLI A;  3FMR A;  1YVM A;  2Q96 A;  5CDE A;  5JI6 A;  1BOA A;  4RZZ A;  2Q94 A;  1C21 A;  3PKC A;  3MAT A;  4U70 A;  2BHB A;  1WL6 A;  3D27 A;  1XGS A;  1Y1N A;  2Q8K A;  4A6V A;  5CDL A;  2BWV A;  4ZWO A;  3CB6 A;  1B59 A;  4U75 A;  2P98 A;  1R58 A;  4RZY A;  1WL9 A;  2GGB A;  2V3Z A;  2BB7 A;  2GGC A;  2BWY A;  1C27 A;  1W7V A;  2GTX A;  4PNC A;  4U71 A;  2B3H A;  2BHD A;  1C24 A;  1R5H A;  2MAT A;  4FKC A;  2GG2 A;  1WKM A;  1XNZ A;  4U1B A;  5JFR A;  1A16 A;  5FCF A;  5CDV A;  1C22 A;  4IPA A;  2BWX A;  2GU5 A;  2HOW A; 
#chains in the Genus database with same CATH homology
 2GG5 A;  1CHM A;  4QR8 A;  3Q6D A;  4Z7M A;  4U76 A;  2BHA A;  2BN7 A;  4IKS A;  4U6C A;  1XGN A;  3MX6 A;  5CLS A;  1XGM A;  4JUQ A;  3IG4 A;  3IU8 A;  2BH3 A;  3IU7 A;  4PV4 A;  1C23 A;  1KQ0 A;  1N51 A;  2P99 A;  1QXY A;  1B6A A;  1YW9 A;  3S6B A;  4B28 A;  4S2R P;  3FMQ A;  3TAV A;  5CNX A;  2BHC A;  3L24 A;  1WY2 A;  2Q93 A;  1PV9 A;  2NQ7 A;  2NQ6 A;  4IDY A;  2BWU A;  3MR1 A;  1WBQ A;  2GG0 A;  3BIQ A;  1MAT A;  2BWW A;  1W2M A;  1WLR A;  4IKT A;  4IEC A;  5D6F A;  4IU6 A;  4U6Z A;  2GG8 A;  4U73 A;  4RGZ 1;  4R60 A;  3ROR A;  4S01 A;  1O0X A;  1QXZ A;  4S00 A;  2G6P A;  4S2T P;  2P9A A;  2B3L A;  3RVA A;  4FLK A;  1M35 A;  2Q92 A;  3IU9 A;  4MAT A;  2Q95 A;  4IKR A;  2EVM A;  4ZWP A;  5D6E A;  4U6J A;  2ADU A;  4IKU A;  1YW8 A;  4U6W A;  3BIP A;  1R5G A;  2EVC A;  2OKN A;  3PKA A;  5JHU A;  1YW7 A;  3BIT A;  2GU4 A;  4IF7 A;  4ZNG A;  1WN1 A;  4EGE A;  2OAZ A;  5E5B A;  2EA4 A;  2ZSG A;  1BN5 A;  4OOK A;  4HXX A;  3FM3 A;  4U69 A;  2BWT A;  2BWS A;  4ZWU A;  4FUK A;  2GG7 A;  1YJ3 A;  3PKE A;  2GU7 A;  1KP0 A;  1QXW A;  3CB5 A;  4FLJ A;  2IW2 A;  2B3K A;  5CIK A;  2GG9 A;  2GA2 A;  4FO8 A;  4A6W A;  4U6E A;  3L7G A;  3TB5 A;  5FCH A;  1KQ9 A;  4KM3 A;  3PKB A;  4FO7 A;  2V3X A;  2V3Y A;  4FLL A;  2V6C A;  5CE6 A;  1QZY A;  2DFI A;  2EVO A;  2GU6 A;  1XGO A;  1JAW A;  3CTZ A;  3PKD A;  2EA2 A;  2GZ5 A;  2GG3 A;  4FLI A;  3FMR A;  1YVM A;  2Q96 A;  5CDE A;  5JI6 A;  1BOA A;  4RZZ A;  2Q94 A;  1C21 A;  3PKC A;  3MAT A;  4U70 A;  2BHB A;  1WL6 A;  3D27 A;  1XGS A;  1Y1N A;  2Q8K A;  4A6V A;  5CDL A;  2BWV A;  4ZWO A;  3CB6 A;  1B59 A;  4U75 A;  2P98 A;  1R58 A;  4RZY A;  1WL9 A;  2GGB A;  2V3Z A;  2BB7 A;  2GGC A;  2BWY A;  1C27 A;  1W7V A;  2GTX A;  4PNC A;  4U71 A;  2B3H A;  2BHD A;  1C24 A;  1R5H A;  2MAT A;  4FKC A;  2GG2 A;  1WKM A;  1XNZ A;  4U1B A;  5JFR A;  1A16 A;  5FCF A;  5CDV A;  1C22 A;  4IPA A;  2BWX A;  2GU5 A;  2HOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...