4PNCA

E. coli methionine aminopeptidase in complex with inhibitor 7-methoxy-2-methylen-3,4-dihydronaphthalen-1(2h)-one
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Beta-aminoketones as prodrugs for selective irreversible inhibitors of type-1 methionine aminopeptidases.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4pncA00
4U6JA 4RZYA 5D6EA 2P98A 1M35A 4U6WA 2BHCA 3MR1A 1XGMA 2GG2A 4A6VA 1C22A 2GG7A 4EGEA 1WN1A 4U69A 2EA4A 3PKCA 4FO7A 4R60A 2Q92A 4RGZ1 5CDLA 2EVCA 4JUQA 5CNXA 4ZWOA 2Q8KA 5JI6A 4ZWPA 1W2MA 1PV9A 1QZYA 4IKRA 5CE6A 4U6EA 4ZNGA 4MATA 4S01A 3L24A 2V6CA 1WL6A 2GU6A 4FLLA 1CHMA 3BITA 4FLKA 3IU7A 4KM3A 2P99A 2Q94A 2NQ6A 3RVAA 4B28A 2BWYA 1O0XA 4QR8A 4Z7MA 1R58A 3D27A 1A16A 5JHUA 3PKAA 3IU8A 2P9AA 2BB7A 2GG0A 5CDEA 2ADUA 2BWVA 3FM3A 3PKDA 3BIPA 1QXYA 3PKEA 4FUKA 1Y1NA 4IKUA 4IU6A 2B3LA 3MATA 4PNCA 3S6BA 2B3HA 1XNZA 4U73A 4A6WA 1YW7A 1KP0A 2GGCA 2GG9A 4IPAA 2V3ZA 2BWXA 5JFRA 2GGBA 4PV4A 2GU7A 2EA2A 2Q96A 2GU4A 4U71A 1N51A 4FKCA 5FCFA 1JAWA 2BWWA 1R5GA 1C23A 5D6FA 1WBQA 2Q95A 5CIKA 1B59A 2BWSA 1C24A 2NQ7A 2V3XA 1YVMA 1BOAA 1QXZA 2GG5A 3Q6DA 2BH3A 1C21A 2B3KA 1QXWA 1W7VA 3RORA 4IDYA 1XGOA 4U6CA 1YJ3A 2EVMA 1XGSA 2BHBA 3BIQA 1WY2A 2GG8A 4ZWUA 1WKMA 4OOKA 4S2RP 3CB6A 4IKSA 2V3YA 4FLJA 2BWUA 2GA2A 4U70A 4U1BA 2ZSGA 3FMQA 1B6AA 3MX6A 4S2TP 1WLRA 5FCHA 2BHDA 2GG3A 2GTXA 1MATA 2GU5A 4FLIA 1C27A 2G6PA 4IKTA 4U76A 2IW2A 2OKNA 2DFIA 1KQ9A 5CDVA 3PKBA 2OAZA 3CB5A 4FO8A 1WL9A 1KQ0A 1YW8A 2HOWA 3FMRA 2EVOA 4RZZA 3IG4A 1XGNA 4U75A 5E5BA 4S00A 3TAVA 5CLSA 4IECA 3L7GA 2MATA 2Q93A 3TB5A 4U6ZA 2BHAA 2BN7A 1YW9A 2GZ5A 4IF7A 3IU9A 1BN5A 4HXXA 1R5HA 2BWTA 3CTZA
chains in the Genus database with same CATH superfamily
4U6JA 4RZYA 5D6EA 2P98A 1M35A 4U6WA 2BHCA 3MR1A 1XGMA 2GG2A 4A6VA 1C22A 2GG7A 4EGEA 1WN1A 4U69A 2EA4A 3PKCA 4FO7A 4R60A 2Q92A 4RGZ1 5CDLA 2EVCA 4JUQA 5CNXA 4ZWOA 2Q8KA 5JI6A 4ZWPA 1W2MA 1PV9A 1QZYA 4IKRA 5CE6A 4U6EA 4ZNGA 4MATA 4S01A 3L24A 2V6CA 1WL6A 2GU6A 4FLLA 1CHMA 3BITA 4FLKA 3IU7A 4KM3A 2P99A 2Q94A 2NQ6A 3RVAA 4B28A 2BWYA 1O0XA 4QR8A 4Z7MA 1R58A 3D27A 1A16A 5JHUA 3PKAA 3IU8A 2P9AA 2BB7A 2GG0A 5CDEA 2ADUA 2BWVA 3FM3A 3PKDA 3BIPA 1QXYA 3PKEA 4FUKA 1Y1NA 4IKUA 4IU6A 2B3LA 3MATA 4PNCA 3S6BA 2B3HA 1XNZA 4U73A 4A6WA 1YW7A 1KP0A 2GGCA 2GG9A 4IPAA 2V3ZA 2BWXA 5JFRA 2GGBA 4PV4A 2GU7A 2EA2A 2Q96A 2GU4A 4U71A 1N51A 4FKCA 5FCFA 1JAWA 2BWWA 1R5GA 1C23A 5D6FA 1WBQA 2Q95A 5CIKA 1B59A 2BWSA 1C24A 2NQ7A 2V3XA 1YVMA 1BOAA 1QXZA 2GG5A 3Q6DA 2BH3A 1C21A 2B3KA 1QXWA 1W7VA 3RORA 4IDYA 1XGOA 4U6CA 1YJ3A 2EVMA 1XGSA 2BHBA 3BIQA 1WY2A 2GG8A 4ZWUA 1WKMA 4OOKA 4S2RP 3CB6A 4IKSA 2V3YA 4FLJA 2BWUA 2GA2A 4U70A 4U1BA 2ZSGA 3FMQA 1B6AA 3MX6A 4S2TP 1WLRA 5FCHA 2BHDA 2GG3A 2GTXA 1MATA 2GU5A 4FLIA 1C27A 2G6PA 4IKTA 4U76A 2IW2A 2OKNA 2DFIA 1KQ9A 5CDVA 3PKBA 2OAZA 3CB5A 4FO8A 1WL9A 1KQ0A 1YW8A 2HOWA 3FMRA 2EVOA 4RZZA 3IG4A 1XGNA 4U75A 5E5BA 4S00A 3TAVA 5CLSA 4IECA 3L7GA 2MATA 2Q93A 3TB5A 4U6ZA 2BHAA 2BN7A 1YW9A 2GZ5A 4IF7A 3IU9A 1BN5A 4HXXA 1R5HA 2BWTA 3CTZA
chains in the Genus database with same CATH topology
4U6JA 4RZYA 5D6EA 2P98A 1M35A 4U6WA 2BHCA 3MR1A 1XGMA 2GG2A 4A6VA 1C22A 2GG7A 4EGEA 1WN1A 4U69A 2EA4A 3PKCA 4FO7A 4R60A 2Q92A 4RGZ1 5CDLA 2EVCA 4JUQA 5CNXA 4ZWOA 2Q8KA 5JI6A 4ZWPA 1W2MA 1PV9A 1QZYA 4IKRA 5CE6A 4U6EA 4ZNGA 4MATA 4S01A 3L24A 2V6CA 1WL6A 2GU6A 4FLLA 1CHMA 3BITA 4FLKA 3IU7A 4KM3A 2P99A 2Q94A 2NQ6A 3RVAA 4B28A 2BWYA 1O0XA 4QR8A 4Z7MA 1R58A 3D27A 1A16A 5JHUA 3PKAA 3IU8A 2P9AA 2BB7A 2GG0A 5CDEA 2ADUA 2BWVA 3FM3A 3PKDA 3BIPA 1QXYA 3PKEA 4FUKA 1Y1NA 4IKUA 4IU6A 2B3LA 3MATA 4PNCA 3S6BA 2B3HA 1XNZA 4U73A 4A6WA 1YW7A 1KP0A 2GGCA 2GG9A 4IPAA 2V3ZA 2BWXA 5JFRA 2GGBA 4PV4A 2GU7A 2EA2A 2Q96A 2GU4A 4U71A 1N51A 4FKCA 5FCFA 1JAWA 2BWWA 1R5GA 1C23A 5D6FA 1WBQA 2Q95A 5CIKA 1B59A 2BWSA 1C24A 2NQ7A 2V3XA 1YVMA 1BOAA 1QXZA 2GG5A 3Q6DA 2BH3A 1C21A 2B3KA 1QXWA 1W7VA 3RORA 4IDYA 1XGOA 4U6CA 1YJ3A 2EVMA 1XGSA 2BHBA 3BIQA 1WY2A 2GG8A 4ZWUA 1WKMA 4OOKA 4S2RP 3CB6A 4IKSA 2V3YA 4FLJA 2BWUA 2GA2A 4U70A 4U1BA 2ZSGA 3FMQA 1B6AA 3MX6A 4S2TP 1WLRA 5FCHA 2BHDA 2GG3A 2GTXA 1MATA 2GU5A 4FLIA 1C27A 2G6PA 4IKTA 4U76A 2IW2A 2OKNA 2DFIA 1KQ9A 5CDVA 3PKBA 2OAZA 3CB5A 4FO8A 1WL9A 1KQ0A 1YW8A 2HOWA 3FMRA 2EVOA 4RZZA 3IG4A 1XGNA 4U75A 5E5BA 4S00A 3TAVA 5CLSA 4IECA 3L7GA 2MATA 2Q93A 3TB5A 4U6ZA 2BHAA 2BN7A 1YW9A 2GZ5A 4IF7A 3IU9A 1BN5A 4HXXA 1R5HA 2BWTA 3CTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6J A;  4RZY A;  5D6E A;  2P98 A;  1M35 A;  4U6W A;  2BHC A;  3MR1 A;  1XGM A;  2GG2 A;  4A6V A;  1C22 A;  2GG7 A;  4EGE A;  1WN1 A;  4U69 A;  2EA4 A;  3PKC A;  4FO7 A;  4R60 A;  2Q92 A;  4RGZ 1;  5CDL A;  2EVC A;  4JUQ A;  5CNX A;  4ZWO A;  2Q8K A;  5JI6 A;  4ZWP A;  1W2M A;  1PV9 A;  1QZY A;  4IKR A;  5CE6 A;  4U6E A;  4ZNG A;  4MAT A;  4S01 A;  3L24 A;  2V6C A;  1WL6 A;  2GU6 A;  4FLL A;  1CHM A;  3BIT A;  4FLK A;  3IU7 A;  4KM3 A;  2P99 A;  2Q94 A;  2NQ6 A;  3RVA A;  4B28 A;  2BWY A;  1O0X A;  4QR8 A;  4Z7M A;  1R58 A;  3D27 A;  1A16 A;  5JHU A;  3PKA A;  3IU8 A;  2P9A A;  2BB7 A;  2GG0 A;  5CDE A;  2ADU A;  2BWV A;  3FM3 A;  3PKD A;  3BIP A;  1QXY A;  3PKE A;  4FUK A;  1Y1N A;  4IKU A;  4IU6 A;  2B3L A;  3MAT A;  4PNC A;  3S6B A;  2B3H A;  1XNZ A;  4U73 A;  4A6W A;  1YW7 A;  1KP0 A;  2GGC A;  2GG9 A;  4IPA A;  2V3Z A;  2BWX A;  5JFR A;  2GGB A;  4PV4 A;  2GU7 A;  2EA2 A;  2Q96 A;  2GU4 A;  4U71 A;  1N51 A;  4FKC A;  5FCF A;  1JAW A;  2BWW A;  1R5G A;  1C23 A;  5D6F A;  1WBQ A;  2Q95 A;  5CIK A;  1B59 A;  2BWS A;  1C24 A;  2NQ7 A;  2V3X A;  1YVM A;  1BOA A;  1QXZ A;  2GG5 A;  3Q6D A;  2BH3 A;  1C21 A;  2B3K A;  1QXW A;  1W7V A;  3ROR A;  4IDY A;  1XGO A;  4U6C A;  1YJ3 A;  2EVM A;  1XGS A;  2BHB A;  3BIQ A;  1WY2 A;  2GG8 A;  4ZWU A;  1WKM A;  4OOK A;  4S2R P;  3CB6 A;  4IKS A;  2V3Y A;  4FLJ A;  2BWU A;  2GA2 A;  4U70 A;  4U1B A;  2ZSG A;  3FMQ A;  1B6A A;  3MX6 A;  4S2T P;  1WLR A;  5FCH A;  2BHD A;  2GG3 A;  2GTX A;  1MAT A;  2GU5 A;  4FLI A;  1C27 A;  2G6P A;  4IKT A;  4U76 A;  2IW2 A;  2OKN A;  2DFI A;  1KQ9 A;  5CDV A;  3PKB A;  2OAZ A;  3CB5 A;  4FO8 A;  1WL9 A;  1KQ0 A;  1YW8 A;  2HOW A;  3FMR A;  2EVO A;  4RZZ A;  3IG4 A;  1XGN A;  4U75 A;  5E5B A;  4S00 A;  3TAV A;  5CLS A;  4IEC A;  3L7G A;  2MAT A;  2Q93 A;  3TB5 A;  4U6Z A;  2BHA A;  2BN7 A;  1YW9 A;  2GZ5 A;  4IF7 A;  3IU9 A;  1BN5 A;  4HXX A;  1R5H A;  2BWT A;  3CTZ A; 
#chains in the Genus database with same CATH topology
 4U6J A;  4RZY A;  5D6E A;  2P98 A;  1M35 A;  4U6W A;  2BHC A;  3MR1 A;  1XGM A;  2GG2 A;  4A6V A;  1C22 A;  2GG7 A;  4EGE A;  1WN1 A;  4U69 A;  2EA4 A;  3PKC A;  4FO7 A;  4R60 A;  2Q92 A;  4RGZ 1;  5CDL A;  2EVC A;  4JUQ A;  5CNX A;  4ZWO A;  2Q8K A;  5JI6 A;  4ZWP A;  1W2M A;  1PV9 A;  1QZY A;  4IKR A;  5CE6 A;  4U6E A;  4ZNG A;  4MAT A;  4S01 A;  3L24 A;  2V6C A;  1WL6 A;  2GU6 A;  4FLL A;  1CHM A;  3BIT A;  4FLK A;  3IU7 A;  4KM3 A;  2P99 A;  2Q94 A;  2NQ6 A;  3RVA A;  4B28 A;  2BWY A;  1O0X A;  4QR8 A;  4Z7M A;  1R58 A;  3D27 A;  1A16 A;  5JHU A;  3PKA A;  3IU8 A;  2P9A A;  2BB7 A;  2GG0 A;  5CDE A;  2ADU A;  2BWV A;  3FM3 A;  3PKD A;  3BIP A;  1QXY A;  3PKE A;  4FUK A;  1Y1N A;  4IKU A;  4IU6 A;  2B3L A;  3MAT A;  4PNC A;  3S6B A;  2B3H A;  1XNZ A;  4U73 A;  4A6W A;  1YW7 A;  1KP0 A;  2GGC A;  2GG9 A;  4IPA A;  2V3Z A;  2BWX A;  5JFR A;  2GGB A;  4PV4 A;  2GU7 A;  2EA2 A;  2Q96 A;  2GU4 A;  4U71 A;  1N51 A;  4FKC A;  5FCF A;  1JAW A;  2BWW A;  1R5G A;  1C23 A;  5D6F A;  1WBQ A;  2Q95 A;  5CIK A;  1B59 A;  2BWS A;  1C24 A;  2NQ7 A;  2V3X A;  1YVM A;  1BOA A;  1QXZ A;  2GG5 A;  3Q6D A;  2BH3 A;  1C21 A;  2B3K A;  1QXW A;  1W7V A;  3ROR A;  4IDY A;  1XGO A;  4U6C A;  1YJ3 A;  2EVM A;  1XGS A;  2BHB A;  3BIQ A;  1WY2 A;  2GG8 A;  4ZWU A;  1WKM A;  4OOK A;  4S2R P;  3CB6 A;  4IKS A;  2V3Y A;  4FLJ A;  2BWU A;  2GA2 A;  4U70 A;  4U1B A;  2ZSG A;  3FMQ A;  1B6A A;  3MX6 A;  4S2T P;  1WLR A;  5FCH A;  2BHD A;  2GG3 A;  2GTX A;  1MAT A;  2GU5 A;  4FLI A;  1C27 A;  2G6P A;  4IKT A;  4U76 A;  2IW2 A;  2OKN A;  2DFI A;  1KQ9 A;  5CDV A;  3PKB A;  2OAZ A;  3CB5 A;  4FO8 A;  1WL9 A;  1KQ0 A;  1YW8 A;  2HOW A;  3FMR A;  2EVO A;  4RZZ A;  3IG4 A;  1XGN A;  4U75 A;  5E5B A;  4S00 A;  3TAV A;  5CLS A;  4IEC A;  3L7G A;  2MAT A;  2Q93 A;  3TB5 A;  4U6Z A;  2BHA A;  2BN7 A;  1YW9 A;  2GZ5 A;  4IF7 A;  3IU9 A;  1BN5 A;  4HXX A;  1R5H A;  2BWT A;  3CTZ A; 
#chains in the Genus database with same CATH homology
 4U6J A;  4RZY A;  5D6E A;  2P98 A;  1M35 A;  4U6W A;  2BHC A;  3MR1 A;  1XGM A;  2GG2 A;  4A6V A;  1C22 A;  2GG7 A;  4EGE A;  1WN1 A;  4U69 A;  2EA4 A;  3PKC A;  4FO7 A;  4R60 A;  2Q92 A;  4RGZ 1;  5CDL A;  2EVC A;  4JUQ A;  5CNX A;  4ZWO A;  2Q8K A;  5JI6 A;  4ZWP A;  1W2M A;  1PV9 A;  1QZY A;  4IKR A;  5CE6 A;  4U6E A;  4ZNG A;  4MAT A;  4S01 A;  3L24 A;  2V6C A;  1WL6 A;  2GU6 A;  4FLL A;  1CHM A;  3BIT A;  4FLK A;  3IU7 A;  4KM3 A;  2P99 A;  2Q94 A;  2NQ6 A;  3RVA A;  4B28 A;  2BWY A;  1O0X A;  4QR8 A;  4Z7M A;  1R58 A;  3D27 A;  1A16 A;  5JHU A;  3PKA A;  3IU8 A;  2P9A A;  2BB7 A;  2GG0 A;  5CDE A;  2ADU A;  2BWV A;  3FM3 A;  3PKD A;  3BIP A;  1QXY A;  3PKE A;  4FUK A;  1Y1N A;  4IKU A;  4IU6 A;  2B3L A;  3MAT A;  4PNC A;  3S6B A;  2B3H A;  1XNZ A;  4U73 A;  4A6W A;  1YW7 A;  1KP0 A;  2GGC A;  2GG9 A;  4IPA A;  2V3Z A;  2BWX A;  5JFR A;  2GGB A;  4PV4 A;  2GU7 A;  2EA2 A;  2Q96 A;  2GU4 A;  4U71 A;  1N51 A;  4FKC A;  5FCF A;  1JAW A;  2BWW A;  1R5G A;  1C23 A;  5D6F A;  1WBQ A;  2Q95 A;  5CIK A;  1B59 A;  2BWS A;  1C24 A;  2NQ7 A;  2V3X A;  1YVM A;  1BOA A;  1QXZ A;  2GG5 A;  3Q6D A;  2BH3 A;  1C21 A;  2B3K A;  1QXW A;  1W7V A;  3ROR A;  4IDY A;  1XGO A;  4U6C A;  1YJ3 A;  2EVM A;  1XGS A;  2BHB A;  3BIQ A;  1WY2 A;  2GG8 A;  4ZWU A;  1WKM A;  4OOK A;  4S2R P;  3CB6 A;  4IKS A;  2V3Y A;  4FLJ A;  2BWU A;  2GA2 A;  4U70 A;  4U1B A;  2ZSG A;  3FMQ A;  1B6A A;  3MX6 A;  4S2T P;  1WLR A;  5FCH A;  2BHD A;  2GG3 A;  2GTX A;  1MAT A;  2GU5 A;  4FLI A;  1C27 A;  2G6P A;  4IKT A;  4U76 A;  2IW2 A;  2OKN A;  2DFI A;  1KQ9 A;  5CDV A;  3PKB A;  2OAZ A;  3CB5 A;  4FO8 A;  1WL9 A;  1KQ0 A;  1YW8 A;  2HOW A;  3FMR A;  2EVO A;  4RZZ A;  3IG4 A;  1XGN A;  4U75 A;  5E5B A;  4S00 A;  3TAV A;  5CLS A;  4IEC A;  3L7G A;  2MAT A;  2Q93 A;  3TB5 A;  4U6Z A;  2BHA A;  2BN7 A;  1YW9 A;  2GZ5 A;  4IF7 A;  3IU9 A;  1BN5 A;  4HXX A;  1R5H A;  2BWT A;  3CTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...