4PNCA

E. coli methionine aminopeptidase in complex with inhibitor 7-methoxy-2-methylen-3,4-dihydronaphthalen-1(2h)-one
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Beta-aminoketones as prodrugs for selective irreversible inhibitors of type-1 methionine aminopeptidases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4pncA00
1MATA 1QZYA 2GGCA 2HOWA 1XGSA 5E5BA 1PV9A 3IU8A 1W2MA 1XNZA 4U73A 2IW2A 2GU7A 5D6EA 1YVMA 2G6PA 1XGNA 3FMQA 4FO8A 4U6JA 2P9AA 2GTXA 1BN5A 4FUKA 4ZWOA 2BB7A 1KP0A 4Z7MA 1N51A 2EA2A 3RORA 1B6AA 3PKEA 2Q94A 4IU6A 2ZSGA 4U69A 4IPAA 5CDLA 5FCFA 3PKDA 5CDVA 1WBQA 2OAZA 2BWSA 4FLJA 4S2RP 3CB5A 4IKRA 5JFRA 3TAVA 2NQ6A 3MATA 1WKMA 2BWWA 4B28A 4IKSA 4U1BA 5JHUA 2EVOA 4EGEA 1WL9A 1BOAA 1YJ3A 2BWUA 2GG3A 5CLSA 4JUQA 1CHMA 4U70A 2Q96A 4FLLA 4PV4A 2BWTA 2BWYA 2Q95A 4U6WA 4FLIA 3CB6A 1C23A 3FM3A 2NQ7A 3MX6A 2Q8KA 2Q93A 2BHDA 1A16A 3D27A 4ZWPA 4IECA 1KQ0A 5D6FA 1W7VA 4OOKA 2GZ5A 5CIKA 2MATA 3IU7A 3Q6DA 2B3HA 4FO7A 3BITA 3BIPA 2GU6A 3FMRA 2V3YA 4IDYA 5FCHA 4QR8A 5CDEA 3PKAA 4IKUA 3TB5A 2GG7A 4ZNGA 1C27A 4MATA 1XGMA 2BH3A 1XGOA 3MR1A 2V3ZA 2GG8A 3L7GA 4U76A 1JAWA 1R5HA 1M35A 3PKBA 2BHBA 1C22A 2OKNA 3BIQA 4S00A 2EVCA 1WL6A 2BWVA 2GG0A 2GG9A 2GU5A 4RZZA 4RZYA 3IU9A 4HXXA 4U6ZA 1QXYA 3S6BA 2GGBA 2B3KA 4FKCA 4U6CA 2V6CA 1WY2A 3CTZA 5CNXA 5JI6A 2BHCA 3IG4A 3RVAA 1WN1A 3PKCA 1KQ9A 4IF7A 4U71A 4A6VA 2GG5A 5CE6A 4KM3A 2BN7A 2GU4A 3L24A 1R58A 4PNCA 1QXZA 1YW9A 1Y1NA 2ADUA 2B3LA 2GA2A 4FLKA 4IKTA 2EA4A 1R5GA 1O0XA 1C24A 2DFIA 4R60A 2BWXA 4ZWUA 2P99A 2P98A 4RGZ1 1YW7A 2GG2A 1WLRA 4U75A 1QXWA 1YW8A 4A6WA 1B59A 2EVMA 4S01A 2V3XA 2BHAA 4U6EA 2Q92A 4S2TP 1C21A
chains in the Genus database with same CATH superfamily
1MATA 1QZYA 2GGCA 2HOWA 1XGSA 5E5BA 1PV9A 3IU8A 1W2MA 1XNZA 4U73A 2IW2A 2GU7A 5D6EA 1YVMA 2G6PA 1XGNA 3FMQA 4FO8A 4U6JA 2P9AA 2GTXA 1BN5A 4FUKA 4ZWOA 2BB7A 1KP0A 4Z7MA 1N51A 2EA2A 3RORA 1B6AA 3PKEA 2Q94A 4IU6A 2ZSGA 4U69A 4IPAA 5CDLA 5FCFA 3PKDA 5CDVA 1WBQA 2OAZA 2BWSA 4FLJA 4S2RP 3CB5A 4IKRA 5JFRA 3TAVA 2NQ6A 3MATA 1WKMA 2BWWA 4B28A 4IKSA 4U1BA 5JHUA 2EVOA 4EGEA 1WL9A 1BOAA 1YJ3A 2BWUA 2GG3A 5CLSA 4JUQA 1CHMA 4U70A 2Q96A 4FLLA 4PV4A 2BWTA 2BWYA 2Q95A 4U6WA 4FLIA 3CB6A 1C23A 3FM3A 2NQ7A 3MX6A 2Q8KA 2Q93A 2BHDA 1A16A 3D27A 4ZWPA 4IECA 1KQ0A 5D6FA 1W7VA 4OOKA 2GZ5A 5CIKA 2MATA 3IU7A 3Q6DA 2B3HA 4FO7A 3BITA 3BIPA 2GU6A 3FMRA 2V3YA 4IDYA 5FCHA 4QR8A 5CDEA 3PKAA 4IKUA 3TB5A 2GG7A 4ZNGA 1C27A 4MATA 1XGMA 2BH3A 1XGOA 3MR1A 2V3ZA 2GG8A 3L7GA 4U76A 1JAWA 1R5HA 1M35A 3PKBA 2BHBA 1C22A 2OKNA 3BIQA 4S00A 2EVCA 1WL6A 2BWVA 2GG0A 2GG9A 2GU5A 4RZZA 4RZYA 3IU9A 4HXXA 4U6ZA 1QXYA 3S6BA 2GGBA 2B3KA 4FKCA 4U6CA 2V6CA 1WY2A 3CTZA 5CNXA 5JI6A 2BHCA 3IG4A 3RVAA 1WN1A 3PKCA 1KQ9A 4IF7A 4U71A 4A6VA 2GG5A 5CE6A 4KM3A 2BN7A 2GU4A 3L24A 1R58A 4PNCA 1QXZA 1YW9A 1Y1NA 2ADUA 2B3LA 2GA2A 4FLKA 4IKTA 2EA4A 1R5GA 1O0XA 1C24A 2DFIA 4R60A 2BWXA 4ZWUA 2P99A 2P98A 4RGZ1 1YW7A 2GG2A 1WLRA 4U75A 1QXWA 1YW8A 4A6WA 1B59A 2EVMA 4S01A 2V3XA 2BHAA 4U6EA 2Q92A 4S2TP 1C21A
chains in the Genus database with same CATH topology
1MATA 1QZYA 2GGCA 2HOWA 1XGSA 5E5BA 1PV9A 3IU8A 1W2MA 1XNZA 4U73A 2IW2A 2GU7A 5D6EA 1YVMA 2G6PA 1XGNA 3FMQA 4FO8A 4U6JA 2P9AA 2GTXA 1BN5A 4FUKA 4ZWOA 2BB7A 1KP0A 4Z7MA 1N51A 2EA2A 3RORA 1B6AA 3PKEA 2Q94A 4IU6A 2ZSGA 4U69A 4IPAA 5CDLA 5FCFA 3PKDA 5CDVA 1WBQA 2OAZA 2BWSA 4FLJA 4S2RP 3CB5A 4IKRA 5JFRA 3TAVA 2NQ6A 3MATA 1WKMA 2BWWA 4B28A 4IKSA 4U1BA 5JHUA 2EVOA 4EGEA 1WL9A 1BOAA 1YJ3A 2BWUA 2GG3A 5CLSA 4JUQA 1CHMA 4U70A 2Q96A 4FLLA 4PV4A 2BWTA 2BWYA 2Q95A 4U6WA 4FLIA 3CB6A 1C23A 3FM3A 2NQ7A 3MX6A 2Q8KA 2Q93A 2BHDA 1A16A 3D27A 4ZWPA 4IECA 1KQ0A 5D6FA 1W7VA 4OOKA 2GZ5A 5CIKA 2MATA 3IU7A 3Q6DA 2B3HA 4FO7A 3BITA 3BIPA 2GU6A 3FMRA 2V3YA 4IDYA 5FCHA 4QR8A 5CDEA 3PKAA 4IKUA 3TB5A 2GG7A 4ZNGA 1C27A 4MATA 1XGMA 2BH3A 1XGOA 3MR1A 2V3ZA 2GG8A 3L7GA 4U76A 1JAWA 1R5HA 1M35A 3PKBA 2BHBA 1C22A 2OKNA 3BIQA 4S00A 2EVCA 1WL6A 2BWVA 2GG0A 2GG9A 2GU5A 4RZZA 4RZYA 3IU9A 4HXXA 4U6ZA 1QXYA 3S6BA 2GGBA 2B3KA 4FKCA 4U6CA 2V6CA 1WY2A 3CTZA 5CNXA 5JI6A 2BHCA 3IG4A 3RVAA 1WN1A 3PKCA 1KQ9A 4IF7A 4U71A 4A6VA 2GG5A 5CE6A 4KM3A 2BN7A 2GU4A 3L24A 1R58A 4PNCA 1QXZA 1YW9A 1Y1NA 2ADUA 2B3LA 2GA2A 4FLKA 4IKTA 2EA4A 1R5GA 1O0XA 1C24A 2DFIA 4R60A 2BWXA 4ZWUA 2P99A 2P98A 4RGZ1 1YW7A 2GG2A 1WLRA 4U75A 1QXWA 1YW8A 4A6WA 1B59A 2EVMA 4S01A 2V3XA 2BHAA 4U6EA 2Q92A 4S2TP 1C21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAT A;  1QZY A;  2GGC A;  2HOW A;  1XGS A;  5E5B A;  1PV9 A;  3IU8 A;  1W2M A;  1XNZ A;  4U73 A;  2IW2 A;  2GU7 A;  5D6E A;  1YVM A;  2G6P A;  1XGN A;  3FMQ A;  4FO8 A;  4U6J A;  2P9A A;  2GTX A;  1BN5 A;  4FUK A;  4ZWO A;  2BB7 A;  1KP0 A;  4Z7M A;  1N51 A;  2EA2 A;  3ROR A;  1B6A A;  3PKE A;  2Q94 A;  4IU6 A;  2ZSG A;  4U69 A;  4IPA A;  5CDL A;  5FCF A;  3PKD A;  5CDV A;  1WBQ A;  2OAZ A;  2BWS A;  4FLJ A;  4S2R P;  3CB5 A;  4IKR A;  5JFR A;  3TAV A;  2NQ6 A;  3MAT A;  1WKM A;  2BWW A;  4B28 A;  4IKS A;  4U1B A;  5JHU A;  2EVO A;  4EGE A;  1WL9 A;  1BOA A;  1YJ3 A;  2BWU A;  2GG3 A;  5CLS A;  4JUQ A;  1CHM A;  4U70 A;  2Q96 A;  4FLL A;  4PV4 A;  2BWT A;  2BWY A;  2Q95 A;  4U6W A;  4FLI A;  3CB6 A;  1C23 A;  3FM3 A;  2NQ7 A;  3MX6 A;  2Q8K A;  2Q93 A;  2BHD A;  1A16 A;  3D27 A;  4ZWP A;  4IEC A;  1KQ0 A;  5D6F A;  1W7V A;  4OOK A;  2GZ5 A;  5CIK A;  2MAT A;  3IU7 A;  3Q6D A;  2B3H A;  4FO7 A;  3BIT A;  3BIP A;  2GU6 A;  3FMR A;  2V3Y A;  4IDY A;  5FCH A;  4QR8 A;  5CDE A;  3PKA A;  4IKU A;  3TB5 A;  2GG7 A;  4ZNG A;  1C27 A;  4MAT A;  1XGM A;  2BH3 A;  1XGO A;  3MR1 A;  2V3Z A;  2GG8 A;  3L7G A;  4U76 A;  1JAW A;  1R5H A;  1M35 A;  3PKB A;  2BHB A;  1C22 A;  2OKN A;  3BIQ A;  4S00 A;  2EVC A;  1WL6 A;  2BWV A;  2GG0 A;  2GG9 A;  2GU5 A;  4RZZ A;  4RZY A;  3IU9 A;  4HXX A;  4U6Z A;  1QXY A;  3S6B A;  2GGB A;  2B3K A;  4FKC A;  4U6C A;  2V6C A;  1WY2 A;  3CTZ A;  5CNX A;  5JI6 A;  2BHC A;  3IG4 A;  3RVA A;  1WN1 A;  3PKC A;  1KQ9 A;  4IF7 A;  4U71 A;  4A6V A;  2GG5 A;  5CE6 A;  4KM3 A;  2BN7 A;  2GU4 A;  3L24 A;  1R58 A;  4PNC A;  1QXZ A;  1YW9 A;  1Y1N A;  2ADU A;  2B3L A;  2GA2 A;  4FLK A;  4IKT A;  2EA4 A;  1R5G A;  1O0X A;  1C24 A;  2DFI A;  4R60 A;  2BWX A;  4ZWU A;  2P99 A;  2P98 A;  4RGZ 1;  1YW7 A;  2GG2 A;  1WLR A;  4U75 A;  1QXW A;  1YW8 A;  4A6W A;  1B59 A;  2EVM A;  4S01 A;  2V3X A;  2BHA A;  4U6E A;  2Q92 A;  4S2T P;  1C21 A; 
#chains in the Genus database with same CATH topology
 1MAT A;  1QZY A;  2GGC A;  2HOW A;  1XGS A;  5E5B A;  1PV9 A;  3IU8 A;  1W2M A;  1XNZ A;  4U73 A;  2IW2 A;  2GU7 A;  5D6E A;  1YVM A;  2G6P A;  1XGN A;  3FMQ A;  4FO8 A;  4U6J A;  2P9A A;  2GTX A;  1BN5 A;  4FUK A;  4ZWO A;  2BB7 A;  1KP0 A;  4Z7M A;  1N51 A;  2EA2 A;  3ROR A;  1B6A A;  3PKE A;  2Q94 A;  4IU6 A;  2ZSG A;  4U69 A;  4IPA A;  5CDL A;  5FCF A;  3PKD A;  5CDV A;  1WBQ A;  2OAZ A;  2BWS A;  4FLJ A;  4S2R P;  3CB5 A;  4IKR A;  5JFR A;  3TAV A;  2NQ6 A;  3MAT A;  1WKM A;  2BWW A;  4B28 A;  4IKS A;  4U1B A;  5JHU A;  2EVO A;  4EGE A;  1WL9 A;  1BOA A;  1YJ3 A;  2BWU A;  2GG3 A;  5CLS A;  4JUQ A;  1CHM A;  4U70 A;  2Q96 A;  4FLL A;  4PV4 A;  2BWT A;  2BWY A;  2Q95 A;  4U6W A;  4FLI A;  3CB6 A;  1C23 A;  3FM3 A;  2NQ7 A;  3MX6 A;  2Q8K A;  2Q93 A;  2BHD A;  1A16 A;  3D27 A;  4ZWP A;  4IEC A;  1KQ0 A;  5D6F A;  1W7V A;  4OOK A;  2GZ5 A;  5CIK A;  2MAT A;  3IU7 A;  3Q6D A;  2B3H A;  4FO7 A;  3BIT A;  3BIP A;  2GU6 A;  3FMR A;  2V3Y A;  4IDY A;  5FCH A;  4QR8 A;  5CDE A;  3PKA A;  4IKU A;  3TB5 A;  2GG7 A;  4ZNG A;  1C27 A;  4MAT A;  1XGM A;  2BH3 A;  1XGO A;  3MR1 A;  2V3Z A;  2GG8 A;  3L7G A;  4U76 A;  1JAW A;  1R5H A;  1M35 A;  3PKB A;  2BHB A;  1C22 A;  2OKN A;  3BIQ A;  4S00 A;  2EVC A;  1WL6 A;  2BWV A;  2GG0 A;  2GG9 A;  2GU5 A;  4RZZ A;  4RZY A;  3IU9 A;  4HXX A;  4U6Z A;  1QXY A;  3S6B A;  2GGB A;  2B3K A;  4FKC A;  4U6C A;  2V6C A;  1WY2 A;  3CTZ A;  5CNX A;  5JI6 A;  2BHC A;  3IG4 A;  3RVA A;  1WN1 A;  3PKC A;  1KQ9 A;  4IF7 A;  4U71 A;  4A6V A;  2GG5 A;  5CE6 A;  4KM3 A;  2BN7 A;  2GU4 A;  3L24 A;  1R58 A;  4PNC A;  1QXZ A;  1YW9 A;  1Y1N A;  2ADU A;  2B3L A;  2GA2 A;  4FLK A;  4IKT A;  2EA4 A;  1R5G A;  1O0X A;  1C24 A;  2DFI A;  4R60 A;  2BWX A;  4ZWU A;  2P99 A;  2P98 A;  4RGZ 1;  1YW7 A;  2GG2 A;  1WLR A;  4U75 A;  1QXW A;  1YW8 A;  4A6W A;  1B59 A;  2EVM A;  4S01 A;  2V3X A;  2BHA A;  4U6E A;  2Q92 A;  4S2T P;  1C21 A; 
#chains in the Genus database with same CATH homology
 1MAT A;  1QZY A;  2GGC A;  2HOW A;  1XGS A;  5E5B A;  1PV9 A;  3IU8 A;  1W2M A;  1XNZ A;  4U73 A;  2IW2 A;  2GU7 A;  5D6E A;  1YVM A;  2G6P A;  1XGN A;  3FMQ A;  4FO8 A;  4U6J A;  2P9A A;  2GTX A;  1BN5 A;  4FUK A;  4ZWO A;  2BB7 A;  1KP0 A;  4Z7M A;  1N51 A;  2EA2 A;  3ROR A;  1B6A A;  3PKE A;  2Q94 A;  4IU6 A;  2ZSG A;  4U69 A;  4IPA A;  5CDL A;  5FCF A;  3PKD A;  5CDV A;  1WBQ A;  2OAZ A;  2BWS A;  4FLJ A;  4S2R P;  3CB5 A;  4IKR A;  5JFR A;  3TAV A;  2NQ6 A;  3MAT A;  1WKM A;  2BWW A;  4B28 A;  4IKS A;  4U1B A;  5JHU A;  2EVO A;  4EGE A;  1WL9 A;  1BOA A;  1YJ3 A;  2BWU A;  2GG3 A;  5CLS A;  4JUQ A;  1CHM A;  4U70 A;  2Q96 A;  4FLL A;  4PV4 A;  2BWT A;  2BWY A;  2Q95 A;  4U6W A;  4FLI A;  3CB6 A;  1C23 A;  3FM3 A;  2NQ7 A;  3MX6 A;  2Q8K A;  2Q93 A;  2BHD A;  1A16 A;  3D27 A;  4ZWP A;  4IEC A;  1KQ0 A;  5D6F A;  1W7V A;  4OOK A;  2GZ5 A;  5CIK A;  2MAT A;  3IU7 A;  3Q6D A;  2B3H A;  4FO7 A;  3BIT A;  3BIP A;  2GU6 A;  3FMR A;  2V3Y A;  4IDY A;  5FCH A;  4QR8 A;  5CDE A;  3PKA A;  4IKU A;  3TB5 A;  2GG7 A;  4ZNG A;  1C27 A;  4MAT A;  1XGM A;  2BH3 A;  1XGO A;  3MR1 A;  2V3Z A;  2GG8 A;  3L7G A;  4U76 A;  1JAW A;  1R5H A;  1M35 A;  3PKB A;  2BHB A;  1C22 A;  2OKN A;  3BIQ A;  4S00 A;  2EVC A;  1WL6 A;  2BWV A;  2GG0 A;  2GG9 A;  2GU5 A;  4RZZ A;  4RZY A;  3IU9 A;  4HXX A;  4U6Z A;  1QXY A;  3S6B A;  2GGB A;  2B3K A;  4FKC A;  4U6C A;  2V6C A;  1WY2 A;  3CTZ A;  5CNX A;  5JI6 A;  2BHC A;  3IG4 A;  3RVA A;  1WN1 A;  3PKC A;  1KQ9 A;  4IF7 A;  4U71 A;  4A6V A;  2GG5 A;  5CE6 A;  4KM3 A;  2BN7 A;  2GU4 A;  3L24 A;  1R58 A;  4PNC A;  1QXZ A;  1YW9 A;  1Y1N A;  2ADU A;  2B3L A;  2GA2 A;  4FLK A;  4IKT A;  2EA4 A;  1R5G A;  1O0X A;  1C24 A;  2DFI A;  4R60 A;  2BWX A;  4ZWU A;  2P99 A;  2P98 A;  4RGZ 1;  1YW7 A;  2GG2 A;  1WLR A;  4U75 A;  1QXW A;  1YW8 A;  4A6W A;  1B59 A;  2EVM A;  4S01 A;  2V3X A;  2BHA A;  4U6E A;  2Q92 A;  4S2T P;  1C21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...