4PNCA

E. coli methionine aminopeptidase in complex with inhibitor 7-methoxy-2-methylen-3,4-dihydronaphthalen-1(2h)-one
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Beta-aminoketones as prodrugs for selective irreversible inhibitors of type-1 methionine aminopeptidases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4pncA00
4U1BA 1C24A 4S2RP 2Q92A 4IECA 3IU8A 4HXXA 2HOWA 4IKUA 4IU6A 5CDEA 4FLKA 3RORA 4FLLA 2GU6A 2BWSA 2P98A 2IW2A 1WY2A 5CDLA 1CHMA 1QXZA 3FMQA 1XGOA 3S6BA 3PKCA 4FLIA 4U6EA 3IU7A 3IG4A 4QR8A 2GU4A 1KQ9A 1R5HA 1W2MA 2GG3A 2EVCA 3PKEA 2Q95A 1N51A 2BWYA 2V6CA 1R58A 5JI6A 1YW7A 4U71A 2BHCA 2GG2A 1O0XA 3PKDA 1WL6A 5FCHA 4IKRA 2B3KA 3D27A 2BWUA 4U76A 5D6FA 1B59A 4PNCA 1A16A 2ZSGA 4S01A 5JHUA 1M35A 1C23A 2GG8A 2BHBA 4U6ZA 4IKTA 2BWXA 2NQ6A 1W7VA 4PV4A 2GGCA 5FCFA 1B6AA 2P9AA 4U6WA 4A6WA 1XNZA 2EA4A 5D6EA 5CIKA 1YVMA 2BHAA 3MR1A 3TB5A 2GU5A 2BB7A 4FUKA 2BWTA 2V3XA 4FLJA 4MATA 4RZZA 4U69A 4RZYA 2BWWA 2EVOA 1QZYA 2MATA 5CNXA 2OKNA 4S2TP 1BOAA 2BWVA 4IPAA 1WLRA 1XGMA 3PKBA 2NQ7A 2GA2A 2P99A 3BIPA 4R60A 2EVMA 2Q93A 1BN5A 1C22A 3FMRA 1WN1A 2V3YA 3L7GA 4RGZ1 1WL9A 4U73A 4U70A 2DFIA 1YJ3A 2BH3A 2GG7A 2BN7A 1QXWA 2GG9A 2GZ5A 4IKSA 1XGSA 4S00A 4FKCA 1YW8A 3BITA 1Y1NA 3TAVA 2GU7A 5CE6A 4IDYA 4U6CA 2Q94A 3IU9A 3MX6A 2GG0A 1WKMA 3CB5A 3L24A 1YW9A 2B3HA 1KQ0A 3CB6A 3PKAA 1QXYA 5CLSA 2BHDA 5JFRA 1KP0A 4U75A 3FM3A 3RVAA 4FO8A 1C27A 2EA2A 3MATA 2G6PA 4FO7A 4EGEA 4KM3A 5E5BA 4ZWUA 2GG5A 4B28A 2V3ZA 2OAZA 4ZWOA 4JUQA 1WBQA 2GGBA 5CDVA 2GTXA 1MATA 1PV9A 2Q96A 4A6VA 1C21A 2Q8KA 1R5GA 4ZWPA 4OOKA 3BIQA 1XGNA 2ADUA 3Q6DA 4U6JA 4Z7MA 2B3LA 1JAWA 3CTZA 4ZNGA 4IF7A
chains in the Genus database with same CATH superfamily
4U1BA 1C24A 4S2RP 2Q92A 4IECA 3IU8A 4HXXA 2HOWA 4IKUA 4IU6A 5CDEA 4FLKA 3RORA 4FLLA 2GU6A 2BWSA 2P98A 2IW2A 1WY2A 5CDLA 1CHMA 1QXZA 3FMQA 1XGOA 3S6BA 3PKCA 4FLIA 4U6EA 3IU7A 3IG4A 4QR8A 2GU4A 1KQ9A 1R5HA 1W2MA 2GG3A 2EVCA 3PKEA 2Q95A 1N51A 2BWYA 2V6CA 1R58A 5JI6A 1YW7A 4U71A 2BHCA 2GG2A 1O0XA 3PKDA 1WL6A 5FCHA 4IKRA 2B3KA 3D27A 2BWUA 4U76A 5D6FA 1B59A 4PNCA 1A16A 2ZSGA 4S01A 5JHUA 1M35A 1C23A 2GG8A 2BHBA 4U6ZA 4IKTA 2BWXA 2NQ6A 1W7VA 4PV4A 2GGCA 5FCFA 1B6AA 2P9AA 4U6WA 4A6WA 1XNZA 2EA4A 5D6EA 5CIKA 1YVMA 2BHAA 3MR1A 3TB5A 2GU5A 2BB7A 4FUKA 2BWTA 2V3XA 4FLJA 4MATA 4RZZA 4U69A 4RZYA 2BWWA 2EVOA 1QZYA 2MATA 5CNXA 2OKNA 4S2TP 1BOAA 2BWVA 4IPAA 1WLRA 1XGMA 3PKBA 2NQ7A 2GA2A 2P99A 3BIPA 4R60A 2EVMA 2Q93A 1BN5A 1C22A 3FMRA 1WN1A 2V3YA 3L7GA 4RGZ1 1WL9A 4U73A 4U70A 2DFIA 1YJ3A 2BH3A 2GG7A 2BN7A 1QXWA 2GG9A 2GZ5A 4IKSA 1XGSA 4S00A 4FKCA 1YW8A 3BITA 1Y1NA 3TAVA 2GU7A 5CE6A 4IDYA 4U6CA 2Q94A 3IU9A 3MX6A 2GG0A 1WKMA 3CB5A 3L24A 1YW9A 2B3HA 1KQ0A 3CB6A 3PKAA 1QXYA 5CLSA 2BHDA 5JFRA 1KP0A 4U75A 3FM3A 3RVAA 4FO8A 1C27A 2EA2A 3MATA 2G6PA 4FO7A 4EGEA 4KM3A 5E5BA 4ZWUA 2GG5A 4B28A 2V3ZA 2OAZA 4ZWOA 4JUQA 1WBQA 2GGBA 5CDVA 2GTXA 1MATA 1PV9A 2Q96A 4A6VA 1C21A 2Q8KA 1R5GA 4ZWPA 4OOKA 3BIQA 1XGNA 2ADUA 3Q6DA 4U6JA 4Z7MA 2B3LA 1JAWA 3CTZA 4ZNGA 4IF7A
chains in the Genus database with same CATH topology
4U1BA 1C24A 4S2RP 2Q92A 4IECA 3IU8A 4HXXA 2HOWA 4IKUA 4IU6A 5CDEA 4FLKA 3RORA 4FLLA 2GU6A 2BWSA 2P98A 2IW2A 1WY2A 5CDLA 1CHMA 1QXZA 3FMQA 1XGOA 3S6BA 3PKCA 4FLIA 4U6EA 3IU7A 3IG4A 4QR8A 2GU4A 1KQ9A 1R5HA 1W2MA 2GG3A 2EVCA 3PKEA 2Q95A 1N51A 2BWYA 2V6CA 1R58A 5JI6A 1YW7A 4U71A 2BHCA 2GG2A 1O0XA 3PKDA 1WL6A 5FCHA 4IKRA 2B3KA 3D27A 2BWUA 4U76A 5D6FA 1B59A 4PNCA 1A16A 2ZSGA 4S01A 5JHUA 1M35A 1C23A 2GG8A 2BHBA 4U6ZA 4IKTA 2BWXA 2NQ6A 1W7VA 4PV4A 2GGCA 5FCFA 1B6AA 2P9AA 4U6WA 4A6WA 1XNZA 2EA4A 5D6EA 5CIKA 1YVMA 2BHAA 3MR1A 3TB5A 2GU5A 2BB7A 4FUKA 2BWTA 2V3XA 4FLJA 4MATA 4RZZA 4U69A 4RZYA 2BWWA 2EVOA 1QZYA 2MATA 5CNXA 2OKNA 4S2TP 1BOAA 2BWVA 4IPAA 1WLRA 1XGMA 3PKBA 2NQ7A 2GA2A 2P99A 3BIPA 4R60A 2EVMA 2Q93A 1BN5A 1C22A 3FMRA 1WN1A 2V3YA 3L7GA 4RGZ1 1WL9A 4U73A 4U70A 2DFIA 1YJ3A 2BH3A 2GG7A 2BN7A 1QXWA 2GG9A 2GZ5A 4IKSA 1XGSA 4S00A 4FKCA 1YW8A 3BITA 1Y1NA 3TAVA 2GU7A 5CE6A 4IDYA 4U6CA 2Q94A 3IU9A 3MX6A 2GG0A 1WKMA 3CB5A 3L24A 1YW9A 2B3HA 1KQ0A 3CB6A 3PKAA 1QXYA 5CLSA 2BHDA 5JFRA 1KP0A 4U75A 3FM3A 3RVAA 4FO8A 1C27A 2EA2A 3MATA 2G6PA 4FO7A 4EGEA 4KM3A 5E5BA 4ZWUA 2GG5A 4B28A 2V3ZA 2OAZA 4ZWOA 4JUQA 1WBQA 2GGBA 5CDVA 2GTXA 1MATA 1PV9A 2Q96A 4A6VA 1C21A 2Q8KA 1R5GA 4ZWPA 4OOKA 3BIQA 1XGNA 2ADUA 3Q6DA 4U6JA 4Z7MA 2B3LA 1JAWA 3CTZA 4ZNGA 4IF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1B A;  1C24 A;  4S2R P;  2Q92 A;  4IEC A;  3IU8 A;  4HXX A;  2HOW A;  4IKU A;  4IU6 A;  5CDE A;  4FLK A;  3ROR A;  4FLL A;  2GU6 A;  2BWS A;  2P98 A;  2IW2 A;  1WY2 A;  5CDL A;  1CHM A;  1QXZ A;  3FMQ A;  1XGO A;  3S6B A;  3PKC A;  4FLI A;  4U6E A;  3IU7 A;  3IG4 A;  4QR8 A;  2GU4 A;  1KQ9 A;  1R5H A;  1W2M A;  2GG3 A;  2EVC A;  3PKE A;  2Q95 A;  1N51 A;  2BWY A;  2V6C A;  1R58 A;  5JI6 A;  1YW7 A;  4U71 A;  2BHC A;  2GG2 A;  1O0X A;  3PKD A;  1WL6 A;  5FCH A;  4IKR A;  2B3K A;  3D27 A;  2BWU A;  4U76 A;  5D6F A;  1B59 A;  4PNC A;  1A16 A;  2ZSG A;  4S01 A;  5JHU A;  1M35 A;  1C23 A;  2GG8 A;  2BHB A;  4U6Z A;  4IKT A;  2BWX A;  2NQ6 A;  1W7V A;  4PV4 A;  2GGC A;  5FCF A;  1B6A A;  2P9A A;  4U6W A;  4A6W A;  1XNZ A;  2EA4 A;  5D6E A;  5CIK A;  1YVM A;  2BHA A;  3MR1 A;  3TB5 A;  2GU5 A;  2BB7 A;  4FUK A;  2BWT A;  2V3X A;  4FLJ A;  4MAT A;  4RZZ A;  4U69 A;  4RZY A;  2BWW A;  2EVO A;  1QZY A;  2MAT A;  5CNX A;  2OKN A;  4S2T P;  1BOA A;  2BWV A;  4IPA A;  1WLR A;  1XGM A;  3PKB A;  2NQ7 A;  2GA2 A;  2P99 A;  3BIP A;  4R60 A;  2EVM A;  2Q93 A;  1BN5 A;  1C22 A;  3FMR A;  1WN1 A;  2V3Y A;  3L7G A;  4RGZ 1;  1WL9 A;  4U73 A;  4U70 A;  2DFI A;  1YJ3 A;  2BH3 A;  2GG7 A;  2BN7 A;  1QXW A;  2GG9 A;  2GZ5 A;  4IKS A;  1XGS A;  4S00 A;  4FKC A;  1YW8 A;  3BIT A;  1Y1N A;  3TAV A;  2GU7 A;  5CE6 A;  4IDY A;  4U6C A;  2Q94 A;  3IU9 A;  3MX6 A;  2GG0 A;  1WKM A;  3CB5 A;  3L24 A;  1YW9 A;  2B3H A;  1KQ0 A;  3CB6 A;  3PKA A;  1QXY A;  5CLS A;  2BHD A;  5JFR A;  1KP0 A;  4U75 A;  3FM3 A;  3RVA A;  4FO8 A;  1C27 A;  2EA2 A;  3MAT A;  2G6P A;  4FO7 A;  4EGE A;  4KM3 A;  5E5B A;  4ZWU A;  2GG5 A;  4B28 A;  2V3Z A;  2OAZ A;  4ZWO A;  4JUQ A;  1WBQ A;  2GGB A;  5CDV A;  2GTX A;  1MAT A;  1PV9 A;  2Q96 A;  4A6V A;  1C21 A;  2Q8K A;  1R5G A;  4ZWP A;  4OOK A;  3BIQ A;  1XGN A;  2ADU A;  3Q6D A;  4U6J A;  4Z7M A;  2B3L A;  1JAW A;  3CTZ A;  4ZNG A;  4IF7 A; 
#chains in the Genus database with same CATH topology
 4U1B A;  1C24 A;  4S2R P;  2Q92 A;  4IEC A;  3IU8 A;  4HXX A;  2HOW A;  4IKU A;  4IU6 A;  5CDE A;  4FLK A;  3ROR A;  4FLL A;  2GU6 A;  2BWS A;  2P98 A;  2IW2 A;  1WY2 A;  5CDL A;  1CHM A;  1QXZ A;  3FMQ A;  1XGO A;  3S6B A;  3PKC A;  4FLI A;  4U6E A;  3IU7 A;  3IG4 A;  4QR8 A;  2GU4 A;  1KQ9 A;  1R5H A;  1W2M A;  2GG3 A;  2EVC A;  3PKE A;  2Q95 A;  1N51 A;  2BWY A;  2V6C A;  1R58 A;  5JI6 A;  1YW7 A;  4U71 A;  2BHC A;  2GG2 A;  1O0X A;  3PKD A;  1WL6 A;  5FCH A;  4IKR A;  2B3K A;  3D27 A;  2BWU A;  4U76 A;  5D6F A;  1B59 A;  4PNC A;  1A16 A;  2ZSG A;  4S01 A;  5JHU A;  1M35 A;  1C23 A;  2GG8 A;  2BHB A;  4U6Z A;  4IKT A;  2BWX A;  2NQ6 A;  1W7V A;  4PV4 A;  2GGC A;  5FCF A;  1B6A A;  2P9A A;  4U6W A;  4A6W A;  1XNZ A;  2EA4 A;  5D6E A;  5CIK A;  1YVM A;  2BHA A;  3MR1 A;  3TB5 A;  2GU5 A;  2BB7 A;  4FUK A;  2BWT A;  2V3X A;  4FLJ A;  4MAT A;  4RZZ A;  4U69 A;  4RZY A;  2BWW A;  2EVO A;  1QZY A;  2MAT A;  5CNX A;  2OKN A;  4S2T P;  1BOA A;  2BWV A;  4IPA A;  1WLR A;  1XGM A;  3PKB A;  2NQ7 A;  2GA2 A;  2P99 A;  3BIP A;  4R60 A;  2EVM A;  2Q93 A;  1BN5 A;  1C22 A;  3FMR A;  1WN1 A;  2V3Y A;  3L7G A;  4RGZ 1;  1WL9 A;  4U73 A;  4U70 A;  2DFI A;  1YJ3 A;  2BH3 A;  2GG7 A;  2BN7 A;  1QXW A;  2GG9 A;  2GZ5 A;  4IKS A;  1XGS A;  4S00 A;  4FKC A;  1YW8 A;  3BIT A;  1Y1N A;  3TAV A;  2GU7 A;  5CE6 A;  4IDY A;  4U6C A;  2Q94 A;  3IU9 A;  3MX6 A;  2GG0 A;  1WKM A;  3CB5 A;  3L24 A;  1YW9 A;  2B3H A;  1KQ0 A;  3CB6 A;  3PKA A;  1QXY A;  5CLS A;  2BHD A;  5JFR A;  1KP0 A;  4U75 A;  3FM3 A;  3RVA A;  4FO8 A;  1C27 A;  2EA2 A;  3MAT A;  2G6P A;  4FO7 A;  4EGE A;  4KM3 A;  5E5B A;  4ZWU A;  2GG5 A;  4B28 A;  2V3Z A;  2OAZ A;  4ZWO A;  4JUQ A;  1WBQ A;  2GGB A;  5CDV A;  2GTX A;  1MAT A;  1PV9 A;  2Q96 A;  4A6V A;  1C21 A;  2Q8K A;  1R5G A;  4ZWP A;  4OOK A;  3BIQ A;  1XGN A;  2ADU A;  3Q6D A;  4U6J A;  4Z7M A;  2B3L A;  1JAW A;  3CTZ A;  4ZNG A;  4IF7 A; 
#chains in the Genus database with same CATH homology
 4U1B A;  1C24 A;  4S2R P;  2Q92 A;  4IEC A;  3IU8 A;  4HXX A;  2HOW A;  4IKU A;  4IU6 A;  5CDE A;  4FLK A;  3ROR A;  4FLL A;  2GU6 A;  2BWS A;  2P98 A;  2IW2 A;  1WY2 A;  5CDL A;  1CHM A;  1QXZ A;  3FMQ A;  1XGO A;  3S6B A;  3PKC A;  4FLI A;  4U6E A;  3IU7 A;  3IG4 A;  4QR8 A;  2GU4 A;  1KQ9 A;  1R5H A;  1W2M A;  2GG3 A;  2EVC A;  3PKE A;  2Q95 A;  1N51 A;  2BWY A;  2V6C A;  1R58 A;  5JI6 A;  1YW7 A;  4U71 A;  2BHC A;  2GG2 A;  1O0X A;  3PKD A;  1WL6 A;  5FCH A;  4IKR A;  2B3K A;  3D27 A;  2BWU A;  4U76 A;  5D6F A;  1B59 A;  4PNC A;  1A16 A;  2ZSG A;  4S01 A;  5JHU A;  1M35 A;  1C23 A;  2GG8 A;  2BHB A;  4U6Z A;  4IKT A;  2BWX A;  2NQ6 A;  1W7V A;  4PV4 A;  2GGC A;  5FCF A;  1B6A A;  2P9A A;  4U6W A;  4A6W A;  1XNZ A;  2EA4 A;  5D6E A;  5CIK A;  1YVM A;  2BHA A;  3MR1 A;  3TB5 A;  2GU5 A;  2BB7 A;  4FUK A;  2BWT A;  2V3X A;  4FLJ A;  4MAT A;  4RZZ A;  4U69 A;  4RZY A;  2BWW A;  2EVO A;  1QZY A;  2MAT A;  5CNX A;  2OKN A;  4S2T P;  1BOA A;  2BWV A;  4IPA A;  1WLR A;  1XGM A;  3PKB A;  2NQ7 A;  2GA2 A;  2P99 A;  3BIP A;  4R60 A;  2EVM A;  2Q93 A;  1BN5 A;  1C22 A;  3FMR A;  1WN1 A;  2V3Y A;  3L7G A;  4RGZ 1;  1WL9 A;  4U73 A;  4U70 A;  2DFI A;  1YJ3 A;  2BH3 A;  2GG7 A;  2BN7 A;  1QXW A;  2GG9 A;  2GZ5 A;  4IKS A;  1XGS A;  4S00 A;  4FKC A;  1YW8 A;  3BIT A;  1Y1N A;  3TAV A;  2GU7 A;  5CE6 A;  4IDY A;  4U6C A;  2Q94 A;  3IU9 A;  3MX6 A;  2GG0 A;  1WKM A;  3CB5 A;  3L24 A;  1YW9 A;  2B3H A;  1KQ0 A;  3CB6 A;  3PKA A;  1QXY A;  5CLS A;  2BHD A;  5JFR A;  1KP0 A;  4U75 A;  3FM3 A;  3RVA A;  4FO8 A;  1C27 A;  2EA2 A;  3MAT A;  2G6P A;  4FO7 A;  4EGE A;  4KM3 A;  5E5B A;  4ZWU A;  2GG5 A;  4B28 A;  2V3Z A;  2OAZ A;  4ZWO A;  4JUQ A;  1WBQ A;  2GGB A;  5CDV A;  2GTX A;  1MAT A;  1PV9 A;  2Q96 A;  4A6V A;  1C21 A;  2Q8K A;  1R5G A;  4ZWP A;  4OOK A;  3BIQ A;  1XGN A;  2ADU A;  3Q6D A;  4U6J A;  4Z7M A;  2B3L A;  1JAW A;  3CTZ A;  4ZNG A;  4IF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...