1C27A

E. coli methionine aminopeptidase:norleucine phosphonate complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
molecule tags Hydrolase
source organism Escherichia coli
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
total genus 85
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c27A00
2ZSGA 2B3HA 4FLIA 5CDVA 4ZNGA 3IU8A 5FCHA 2Q93A 5CLSA 4FLJA 3CB6A 1YW9A 2EA2A 2EVMA 3MATA 3PKAA 2BWTA 1XGSA 5CNXA 1KQ0A 2MATA 1CHMA 4OOKA 1N51A 3PKEA 3RVAA 4IKSA 2EVCA 2NQ6A 2P99A 2Q94A 2Q92A 4RGZ1 2OAZA 1C27A 2EA4A 2V6CA 4A6VA 2V3YA 1WBQA 3PKBA 1QXZA 2V3ZA 4U6CA 2BHDA 3CTZA 2GU5A 4FLKA 4U6WA 2BWXA 4FKCA 2GA2A 4S2TP 4IKTA 4U73A 4S01A 4A6WA 3BITA 1WLRA 1YJ3A 4U76A 5FCFA 1QZYA 4Z7MA 4FO8A 3RORA 2BHBA 4FLLA 1B6AA 4IF7A 1WKMA 1WL9A 2BWWA 4U6EA 5JI6A 4EGEA 1A16A 2ADUA 2BWVA 3L7GA 4ZWPA 2DFIA 4PNCA 4IU6A 4IKRA 2IW2A 4MATA 1O0XA 1QXYA 2GGCA 4U70A 2G6PA 4PV4A 3IU9A 5JHUA 1YVMA 2GG9A 1QXWA 1YW8A 4U75A 4QR8A 2B3KA 3BIPA 2NQ7A 4R60A 2GG3A 4JUQA 4RZYA 1R5HA 1R5GA 3IU7A 1JAWA 1MATA 1WL6A 4U1BA 1WY2A 3FM3A 4RZZA 3Q6DA 2B3LA 1XGNA 4ZWOA 1R58A 2V3XA 3D27A 3TAVA 3IG4A 1C24A 1Y1NA 5E5BA 3S6BA 5CE6A 2GZ5A 1C22A 4U6ZA 2HOWA 2BWSA 3CB5A 2Q96A 3L24A 2GG7A 1YW7A 2GTXA 1W2MA 2GG5A 2OKNA 2P98A 3BIQA 2BWYA 3PKDA 1C23A 3PKCA 2P9AA 1KP0A 4IDYA 1W7VA 2BHAA 3FMQA 2BB7A 4S2RP 1PV9A 4ZWUA 4S00A 1BOAA 2GU4A 1C21A 1M35A 2BN7A 5D6EA 4HXXA 4IECA 5D6FA 2GG8A 4IPAA 2GG0A 3MR1A 2GU7A 5CDLA 4IKUA 4U69A 5CDEA 2GGBA 2GG2A 1KQ9A 2BH3A 2Q8KA 4U6JA 4FUKA 2GU6A 1XGMA 2EVOA 1B59A 1XGOA 4FO7A 4B28A 5JFRA 3FMRA 4U71A 1XNZA 4KM3A 2Q95A 1WN1A 3TB5A 2BWUA 5CIKA 2BHCA 3MX6A 1BN5A
chains in the Genus database with same CATH superfamily
2ZSGA 2B3HA 4FLIA 5CDVA 4ZNGA 3IU8A 5FCHA 2Q93A 5CLSA 4FLJA 3CB6A 1YW9A 2EA2A 2EVMA 3MATA 3PKAA 2BWTA 1XGSA 5CNXA 1KQ0A 2MATA 1CHMA 4OOKA 1N51A 3PKEA 3RVAA 4IKSA 2EVCA 2NQ6A 2P99A 2Q94A 2Q92A 4RGZ1 2OAZA 1C27A 2EA4A 2V6CA 4A6VA 2V3YA 1WBQA 3PKBA 1QXZA 2V3ZA 4U6CA 2BHDA 3CTZA 2GU5A 4FLKA 4U6WA 2BWXA 4FKCA 2GA2A 4S2TP 4IKTA 4U73A 4S01A 4A6WA 3BITA 1WLRA 1YJ3A 4U76A 5FCFA 1QZYA 4Z7MA 4FO8A 3RORA 2BHBA 4FLLA 1B6AA 4IF7A 1WKMA 1WL9A 2BWWA 4U6EA 5JI6A 4EGEA 1A16A 2ADUA 2BWVA 3L7GA 4ZWPA 2DFIA 4PNCA 4IU6A 4IKRA 2IW2A 4MATA 1O0XA 1QXYA 2GGCA 4U70A 2G6PA 4PV4A 3IU9A 5JHUA 1YVMA 2GG9A 1QXWA 1YW8A 4U75A 4QR8A 2B3KA 3BIPA 2NQ7A 4R60A 2GG3A 4JUQA 4RZYA 1R5HA 1R5GA 3IU7A 1JAWA 1MATA 1WL6A 4U1BA 1WY2A 3FM3A 4RZZA 3Q6DA 2B3LA 1XGNA 4ZWOA 1R58A 2V3XA 3D27A 3TAVA 3IG4A 1C24A 1Y1NA 5E5BA 3S6BA 5CE6A 2GZ5A 1C22A 4U6ZA 2HOWA 2BWSA 3CB5A 2Q96A 3L24A 2GG7A 1YW7A 2GTXA 1W2MA 2GG5A 2OKNA 2P98A 3BIQA 2BWYA 3PKDA 1C23A 3PKCA 2P9AA 1KP0A 4IDYA 1W7VA 2BHAA 3FMQA 2BB7A 4S2RP 1PV9A 4ZWUA 4S00A 1BOAA 2GU4A 1C21A 1M35A 2BN7A 5D6EA 4HXXA 4IECA 5D6FA 2GG8A 4IPAA 2GG0A 3MR1A 2GU7A 5CDLA 4IKUA 4U69A 5CDEA 2GGBA 2GG2A 1KQ9A 2BH3A 2Q8KA 4U6JA 4FUKA 2GU6A 1XGMA 2EVOA 1B59A 1XGOA 4FO7A 4B28A 5JFRA 3FMRA 4U71A 1XNZA 4KM3A 2Q95A 1WN1A 3TB5A 2BWUA 5CIKA 2BHCA 3MX6A 1BN5A
chains in the Genus database with same CATH topology
2ZSGA 2B3HA 4FLIA 5CDVA 4ZNGA 3IU8A 5FCHA 2Q93A 5CLSA 4FLJA 3CB6A 1YW9A 2EA2A 2EVMA 3MATA 3PKAA 2BWTA 1XGSA 5CNXA 1KQ0A 2MATA 1CHMA 4OOKA 1N51A 3PKEA 3RVAA 4IKSA 2EVCA 2NQ6A 2P99A 2Q94A 2Q92A 4RGZ1 2OAZA 1C27A 2EA4A 2V6CA 4A6VA 2V3YA 1WBQA 3PKBA 1QXZA 2V3ZA 4U6CA 2BHDA 3CTZA 2GU5A 4FLKA 4U6WA 2BWXA 4FKCA 2GA2A 4S2TP 4IKTA 4U73A 4S01A 4A6WA 3BITA 1WLRA 1YJ3A 4U76A 5FCFA 1QZYA 4Z7MA 4FO8A 3RORA 2BHBA 4FLLA 1B6AA 4IF7A 1WKMA 1WL9A 2BWWA 4U6EA 5JI6A 4EGEA 1A16A 2ADUA 2BWVA 3L7GA 4ZWPA 2DFIA 4PNCA 4IU6A 4IKRA 2IW2A 4MATA 1O0XA 1QXYA 2GGCA 4U70A 2G6PA 4PV4A 3IU9A 5JHUA 1YVMA 2GG9A 1QXWA 1YW8A 4U75A 4QR8A 2B3KA 3BIPA 2NQ7A 4R60A 2GG3A 4JUQA 4RZYA 1R5HA 1R5GA 3IU7A 1JAWA 1MATA 1WL6A 4U1BA 1WY2A 3FM3A 4RZZA 3Q6DA 2B3LA 1XGNA 4ZWOA 1R58A 2V3XA 3D27A 3TAVA 3IG4A 1C24A 1Y1NA 5E5BA 3S6BA 5CE6A 2GZ5A 1C22A 4U6ZA 2HOWA 2BWSA 3CB5A 2Q96A 3L24A 2GG7A 1YW7A 2GTXA 1W2MA 2GG5A 2OKNA 2P98A 3BIQA 2BWYA 3PKDA 1C23A 3PKCA 2P9AA 1KP0A 4IDYA 1W7VA 2BHAA 3FMQA 2BB7A 4S2RP 1PV9A 4ZWUA 4S00A 1BOAA 2GU4A 1C21A 1M35A 2BN7A 5D6EA 4HXXA 4IECA 5D6FA 2GG8A 4IPAA 2GG0A 3MR1A 2GU7A 5CDLA 4IKUA 4U69A 5CDEA 2GGBA 2GG2A 1KQ9A 2BH3A 2Q8KA 4U6JA 4FUKA 2GU6A 1XGMA 2EVOA 1B59A 1XGOA 4FO7A 4B28A 5JFRA 3FMRA 4U71A 1XNZA 4KM3A 2Q95A 1WN1A 3TB5A 2BWUA 5CIKA 2BHCA 3MX6A 1BN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSG A;  2B3H A;  4FLI A;  5CDV A;  4ZNG A;  3IU8 A;  5FCH A;  2Q93 A;  5CLS A;  4FLJ A;  3CB6 A;  1YW9 A;  2EA2 A;  2EVM A;  3MAT A;  3PKA A;  2BWT A;  1XGS A;  5CNX A;  1KQ0 A;  2MAT A;  1CHM A;  4OOK A;  1N51 A;  3PKE A;  3RVA A;  4IKS A;  2EVC A;  2NQ6 A;  2P99 A;  2Q94 A;  2Q92 A;  4RGZ 1;  2OAZ A;  1C27 A;  2EA4 A;  2V6C A;  4A6V A;  2V3Y A;  1WBQ A;  3PKB A;  1QXZ A;  2V3Z A;  4U6C A;  2BHD A;  3CTZ A;  2GU5 A;  4FLK A;  4U6W A;  2BWX A;  4FKC A;  2GA2 A;  4S2T P;  4IKT A;  4U73 A;  4S01 A;  4A6W A;  3BIT A;  1WLR A;  1YJ3 A;  4U76 A;  5FCF A;  1QZY A;  4Z7M A;  4FO8 A;  3ROR A;  2BHB A;  4FLL A;  1B6A A;  4IF7 A;  1WKM A;  1WL9 A;  2BWW A;  4U6E A;  5JI6 A;  4EGE A;  1A16 A;  2ADU A;  2BWV A;  3L7G A;  4ZWP A;  2DFI A;  4PNC A;  4IU6 A;  4IKR A;  2IW2 A;  4MAT A;  1O0X A;  1QXY A;  2GGC A;  4U70 A;  2G6P A;  4PV4 A;  3IU9 A;  5JHU A;  1YVM A;  2GG9 A;  1QXW A;  1YW8 A;  4U75 A;  4QR8 A;  2B3K A;  3BIP A;  2NQ7 A;  4R60 A;  2GG3 A;  4JUQ A;  4RZY A;  1R5H A;  1R5G A;  3IU7 A;  1JAW A;  1MAT A;  1WL6 A;  4U1B A;  1WY2 A;  3FM3 A;  4RZZ A;  3Q6D A;  2B3L A;  1XGN A;  4ZWO A;  1R58 A;  2V3X A;  3D27 A;  3TAV A;  3IG4 A;  1C24 A;  1Y1N A;  5E5B A;  3S6B A;  5CE6 A;  2GZ5 A;  1C22 A;  4U6Z A;  2HOW A;  2BWS A;  3CB5 A;  2Q96 A;  3L24 A;  2GG7 A;  1YW7 A;  2GTX A;  1W2M A;  2GG5 A;  2OKN A;  2P98 A;  3BIQ A;  2BWY A;  3PKD A;  1C23 A;  3PKC A;  2P9A A;  1KP0 A;  4IDY A;  1W7V A;  2BHA A;  3FMQ A;  2BB7 A;  4S2R P;  1PV9 A;  4ZWU A;  4S00 A;  1BOA A;  2GU4 A;  1C21 A;  1M35 A;  2BN7 A;  5D6E A;  4HXX A;  4IEC A;  5D6F A;  2GG8 A;  4IPA A;  2GG0 A;  3MR1 A;  2GU7 A;  5CDL A;  4IKU A;  4U69 A;  5CDE A;  2GGB A;  2GG2 A;  1KQ9 A;  2BH3 A;  2Q8K A;  4U6J A;  4FUK A;  2GU6 A;  1XGM A;  2EVO A;  1B59 A;  1XGO A;  4FO7 A;  4B28 A;  5JFR A;  3FMR A;  4U71 A;  1XNZ A;  4KM3 A;  2Q95 A;  1WN1 A;  3TB5 A;  2BWU A;  5CIK A;  2BHC A;  3MX6 A;  1BN5 A; 
#chains in the Genus database with same CATH topology
 2ZSG A;  2B3H A;  4FLI A;  5CDV A;  4ZNG A;  3IU8 A;  5FCH A;  2Q93 A;  5CLS A;  4FLJ A;  3CB6 A;  1YW9 A;  2EA2 A;  2EVM A;  3MAT A;  3PKA A;  2BWT A;  1XGS A;  5CNX A;  1KQ0 A;  2MAT A;  1CHM A;  4OOK A;  1N51 A;  3PKE A;  3RVA A;  4IKS A;  2EVC A;  2NQ6 A;  2P99 A;  2Q94 A;  2Q92 A;  4RGZ 1;  2OAZ A;  1C27 A;  2EA4 A;  2V6C A;  4A6V A;  2V3Y A;  1WBQ A;  3PKB A;  1QXZ A;  2V3Z A;  4U6C A;  2BHD A;  3CTZ A;  2GU5 A;  4FLK A;  4U6W A;  2BWX A;  4FKC A;  2GA2 A;  4S2T P;  4IKT A;  4U73 A;  4S01 A;  4A6W A;  3BIT A;  1WLR A;  1YJ3 A;  4U76 A;  5FCF A;  1QZY A;  4Z7M A;  4FO8 A;  3ROR A;  2BHB A;  4FLL A;  1B6A A;  4IF7 A;  1WKM A;  1WL9 A;  2BWW A;  4U6E A;  5JI6 A;  4EGE A;  1A16 A;  2ADU A;  2BWV A;  3L7G A;  4ZWP A;  2DFI A;  4PNC A;  4IU6 A;  4IKR A;  2IW2 A;  4MAT A;  1O0X A;  1QXY A;  2GGC A;  4U70 A;  2G6P A;  4PV4 A;  3IU9 A;  5JHU A;  1YVM A;  2GG9 A;  1QXW A;  1YW8 A;  4U75 A;  4QR8 A;  2B3K A;  3BIP A;  2NQ7 A;  4R60 A;  2GG3 A;  4JUQ A;  4RZY A;  1R5H A;  1R5G A;  3IU7 A;  1JAW A;  1MAT A;  1WL6 A;  4U1B A;  1WY2 A;  3FM3 A;  4RZZ A;  3Q6D A;  2B3L A;  1XGN A;  4ZWO A;  1R58 A;  2V3X A;  3D27 A;  3TAV A;  3IG4 A;  1C24 A;  1Y1N A;  5E5B A;  3S6B A;  5CE6 A;  2GZ5 A;  1C22 A;  4U6Z A;  2HOW A;  2BWS A;  3CB5 A;  2Q96 A;  3L24 A;  2GG7 A;  1YW7 A;  2GTX A;  1W2M A;  2GG5 A;  2OKN A;  2P98 A;  3BIQ A;  2BWY A;  3PKD A;  1C23 A;  3PKC A;  2P9A A;  1KP0 A;  4IDY A;  1W7V A;  2BHA A;  3FMQ A;  2BB7 A;  4S2R P;  1PV9 A;  4ZWU A;  4S00 A;  1BOA A;  2GU4 A;  1C21 A;  1M35 A;  2BN7 A;  5D6E A;  4HXX A;  4IEC A;  5D6F A;  2GG8 A;  4IPA A;  2GG0 A;  3MR1 A;  2GU7 A;  5CDL A;  4IKU A;  4U69 A;  5CDE A;  2GGB A;  2GG2 A;  1KQ9 A;  2BH3 A;  2Q8K A;  4U6J A;  4FUK A;  2GU6 A;  1XGM A;  2EVO A;  1B59 A;  1XGO A;  4FO7 A;  4B28 A;  5JFR A;  3FMR A;  4U71 A;  1XNZ A;  4KM3 A;  2Q95 A;  1WN1 A;  3TB5 A;  2BWU A;  5CIK A;  2BHC A;  3MX6 A;  1BN5 A; 
#chains in the Genus database with same CATH homology
 2ZSG A;  2B3H A;  4FLI A;  5CDV A;  4ZNG A;  3IU8 A;  5FCH A;  2Q93 A;  5CLS A;  4FLJ A;  3CB6 A;  1YW9 A;  2EA2 A;  2EVM A;  3MAT A;  3PKA A;  2BWT A;  1XGS A;  5CNX A;  1KQ0 A;  2MAT A;  1CHM A;  4OOK A;  1N51 A;  3PKE A;  3RVA A;  4IKS A;  2EVC A;  2NQ6 A;  2P99 A;  2Q94 A;  2Q92 A;  4RGZ 1;  2OAZ A;  1C27 A;  2EA4 A;  2V6C A;  4A6V A;  2V3Y A;  1WBQ A;  3PKB A;  1QXZ A;  2V3Z A;  4U6C A;  2BHD A;  3CTZ A;  2GU5 A;  4FLK A;  4U6W A;  2BWX A;  4FKC A;  2GA2 A;  4S2T P;  4IKT A;  4U73 A;  4S01 A;  4A6W A;  3BIT A;  1WLR A;  1YJ3 A;  4U76 A;  5FCF A;  1QZY A;  4Z7M A;  4FO8 A;  3ROR A;  2BHB A;  4FLL A;  1B6A A;  4IF7 A;  1WKM A;  1WL9 A;  2BWW A;  4U6E A;  5JI6 A;  4EGE A;  1A16 A;  2ADU A;  2BWV A;  3L7G A;  4ZWP A;  2DFI A;  4PNC A;  4IU6 A;  4IKR A;  2IW2 A;  4MAT A;  1O0X A;  1QXY A;  2GGC A;  4U70 A;  2G6P A;  4PV4 A;  3IU9 A;  5JHU A;  1YVM A;  2GG9 A;  1QXW A;  1YW8 A;  4U75 A;  4QR8 A;  2B3K A;  3BIP A;  2NQ7 A;  4R60 A;  2GG3 A;  4JUQ A;  4RZY A;  1R5H A;  1R5G A;  3IU7 A;  1JAW A;  1MAT A;  1WL6 A;  4U1B A;  1WY2 A;  3FM3 A;  4RZZ A;  3Q6D A;  2B3L A;  1XGN A;  4ZWO A;  1R58 A;  2V3X A;  3D27 A;  3TAV A;  3IG4 A;  1C24 A;  1Y1N A;  5E5B A;  3S6B A;  5CE6 A;  2GZ5 A;  1C22 A;  4U6Z A;  2HOW A;  2BWS A;  3CB5 A;  2Q96 A;  3L24 A;  2GG7 A;  1YW7 A;  2GTX A;  1W2M A;  2GG5 A;  2OKN A;  2P98 A;  3BIQ A;  2BWY A;  3PKD A;  1C23 A;  3PKC A;  2P9A A;  1KP0 A;  4IDY A;  1W7V A;  2BHA A;  3FMQ A;  2BB7 A;  4S2R P;  1PV9 A;  4ZWU A;  4S00 A;  1BOA A;  2GU4 A;  1C21 A;  1M35 A;  2BN7 A;  5D6E A;  4HXX A;  4IEC A;  5D6F A;  2GG8 A;  4IPA A;  2GG0 A;  3MR1 A;  2GU7 A;  5CDL A;  4IKU A;  4U69 A;  5CDE A;  2GGB A;  2GG2 A;  1KQ9 A;  2BH3 A;  2Q8K A;  4U6J A;  4FUK A;  2GU6 A;  1XGM A;  2EVO A;  1B59 A;  1XGO A;  4FO7 A;  4B28 A;  5JFR A;  3FMR A;  4U71 A;  1XNZ A;  4KM3 A;  2Q95 A;  1WN1 A;  3TB5 A;  2BWU A;  5CIK A;  2BHC A;  3MX6 A;  1BN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...