1C27A

E. coli methionine aminopeptidase:norleucine phosphonate complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c27A00
1WKMA 1W7VA 4U76A 5JFRA 2GG8A 1C24A 5CLSA 4IKRA 5CDVA 1A16A 2OAZA 4ZWUA 4FLLA 3BIPA 4IU6A 2EA2A 4U6CA 2P9AA 1KQ9A 2B3KA 4FO8A 2GG3A 1O0XA 2B3LA 2BHBA 2BWUA 4ZWPA 4IDYA 5JI6A 5E5BA 3L7GA 2V3XA 4U6EA 2BWXA 1XGMA 2GU4A 2GU5A 3FM3A 2Q93A 1QXYA 4ZWOA 4FUKA 4U71A 1KQ0A 1YVMA 2Q94A 3CTZA 2EVOA 4S2RP 1WBQA 5CNXA 4R60A 2GG5A 3FMQA 4FKCA 4FO7A 3TB5A 3CB6A 2V3YA 1W2MA 3FMRA 4U70A 1QXZA 3PKEA 2NQ6A 4IKSA 1CHMA 1BN5A 4OOKA 4MATA 2EVMA 4U6ZA 2V3ZA 4FLKA 2BN7A 4A6VA 2BWWA 2NQ7A 1KP0A 1C22A 4KM3A 5D6FA 5FCHA 3MX6A 2BWTA 2MATA 2G6PA 4U73A 2Q95A 1XGNA 2GG0A 1WLRA 2ADUA 2B3HA 4U69A 1BOAA 2P99A 4RZZA 2EVCA 1C21A 3PKDA 4S2TP 1YJ3A 2GU6A 1QZYA 1XGSA 3IG4A 4IECA 3IU7A 2GA2A 3PKAA 3CB5A 1Y1NA 3BITA 5D6EA 3S6BA 4PV4A 4A6WA 5JHUA 2ZSGA 4RGZ1 4FLIA 2HOWA 1B6AA 1B59A 2GGCA 2BWYA 5FCFA 3MR1A 4IKUA 2GG7A 4ZNGA 2GTXA 1YW7A 2BHAA 2BWVA 2V6CA 4S00A 1MATA 4PNCA 1WL9A 1N51A 1XNZA 1WN1A 1C27A 1QXWA 1YW9A 4IKTA 3PKBA 4Z7MA 4U6WA 3IU9A 2GZ5A 3IU8A 2GGBA 1XGOA 5CE6A 2GG9A 1YW8A 1R58A 3BIQA 2Q8KA 4U75A 1R5HA 3Q6DA 4HXXA 4S01A 4FLJA 3RORA 4RZYA 4JUQA 1JAWA 2Q96A 4B28A 1M35A 2EA4A 1WL6A 2GU7A 2OKNA 4IF7A 2BH3A 4U6JA 1PV9A 1C23A 2BB7A 2BHDA 4QR8A 4EGEA 3L24A 4U1BA 2IW2A 1WY2A 3MATA 2Q92A 3PKCA 5CIKA 2DFIA 3TAVA 5CDLA 2BHCA 3RVAA 5CDEA 2BWSA 3D27A 1R5GA 2P98A 4IPAA 2GG2A
chains in the Genus database with same CATH superfamily
1WKMA 1W7VA 4U76A 5JFRA 2GG8A 1C24A 5CLSA 4IKRA 5CDVA 1A16A 2OAZA 4ZWUA 4FLLA 3BIPA 4IU6A 2EA2A 4U6CA 2P9AA 1KQ9A 2B3KA 4FO8A 2GG3A 1O0XA 2B3LA 2BHBA 2BWUA 4ZWPA 4IDYA 5JI6A 5E5BA 3L7GA 2V3XA 4U6EA 2BWXA 1XGMA 2GU4A 2GU5A 3FM3A 2Q93A 1QXYA 4ZWOA 4FUKA 4U71A 1KQ0A 1YVMA 2Q94A 3CTZA 2EVOA 4S2RP 1WBQA 5CNXA 4R60A 2GG5A 3FMQA 4FKCA 4FO7A 3TB5A 3CB6A 2V3YA 1W2MA 3FMRA 4U70A 1QXZA 3PKEA 2NQ6A 4IKSA 1CHMA 1BN5A 4OOKA 4MATA 2EVMA 4U6ZA 2V3ZA 4FLKA 2BN7A 4A6VA 2BWWA 2NQ7A 1KP0A 1C22A 4KM3A 5D6FA 5FCHA 3MX6A 2BWTA 2MATA 2G6PA 4U73A 2Q95A 1XGNA 2GG0A 1WLRA 2ADUA 2B3HA 4U69A 1BOAA 2P99A 4RZZA 2EVCA 1C21A 3PKDA 4S2TP 1YJ3A 2GU6A 1QZYA 1XGSA 3IG4A 4IECA 3IU7A 2GA2A 3PKAA 3CB5A 1Y1NA 3BITA 5D6EA 3S6BA 4PV4A 4A6WA 5JHUA 2ZSGA 4RGZ1 4FLIA 2HOWA 1B6AA 1B59A 2GGCA 2BWYA 5FCFA 3MR1A 4IKUA 2GG7A 4ZNGA 2GTXA 1YW7A 2BHAA 2BWVA 2V6CA 4S00A 1MATA 4PNCA 1WL9A 1N51A 1XNZA 1WN1A 1C27A 1QXWA 1YW9A 4IKTA 3PKBA 4Z7MA 4U6WA 3IU9A 2GZ5A 3IU8A 2GGBA 1XGOA 5CE6A 2GG9A 1YW8A 1R58A 3BIQA 2Q8KA 4U75A 1R5HA 3Q6DA 4HXXA 4S01A 4FLJA 3RORA 4RZYA 4JUQA 1JAWA 2Q96A 4B28A 1M35A 2EA4A 1WL6A 2GU7A 2OKNA 4IF7A 2BH3A 4U6JA 1PV9A 1C23A 2BB7A 2BHDA 4QR8A 4EGEA 3L24A 4U1BA 2IW2A 1WY2A 3MATA 2Q92A 3PKCA 5CIKA 2DFIA 3TAVA 5CDLA 2BHCA 3RVAA 5CDEA 2BWSA 3D27A 1R5GA 2P98A 4IPAA 2GG2A
chains in the Genus database with same CATH topology
1WKMA 1W7VA 4U76A 5JFRA 2GG8A 1C24A 5CLSA 4IKRA 5CDVA 1A16A 2OAZA 4ZWUA 4FLLA 3BIPA 4IU6A 2EA2A 4U6CA 2P9AA 1KQ9A 2B3KA 4FO8A 2GG3A 1O0XA 2B3LA 2BHBA 2BWUA 4ZWPA 4IDYA 5JI6A 5E5BA 3L7GA 2V3XA 4U6EA 2BWXA 1XGMA 2GU4A 2GU5A 3FM3A 2Q93A 1QXYA 4ZWOA 4FUKA 4U71A 1KQ0A 1YVMA 2Q94A 3CTZA 2EVOA 4S2RP 1WBQA 5CNXA 4R60A 2GG5A 3FMQA 4FKCA 4FO7A 3TB5A 3CB6A 2V3YA 1W2MA 3FMRA 4U70A 1QXZA 3PKEA 2NQ6A 4IKSA 1CHMA 1BN5A 4OOKA 4MATA 2EVMA 4U6ZA 2V3ZA 4FLKA 2BN7A 4A6VA 2BWWA 2NQ7A 1KP0A 1C22A 4KM3A 5D6FA 5FCHA 3MX6A 2BWTA 2MATA 2G6PA 4U73A 2Q95A 1XGNA 2GG0A 1WLRA 2ADUA 2B3HA 4U69A 1BOAA 2P99A 4RZZA 2EVCA 1C21A 3PKDA 4S2TP 1YJ3A 2GU6A 1QZYA 1XGSA 3IG4A 4IECA 3IU7A 2GA2A 3PKAA 3CB5A 1Y1NA 3BITA 5D6EA 3S6BA 4PV4A 4A6WA 5JHUA 2ZSGA 4RGZ1 4FLIA 2HOWA 1B6AA 1B59A 2GGCA 2BWYA 5FCFA 3MR1A 4IKUA 2GG7A 4ZNGA 2GTXA 1YW7A 2BHAA 2BWVA 2V6CA 4S00A 1MATA 4PNCA 1WL9A 1N51A 1XNZA 1WN1A 1C27A 1QXWA 1YW9A 4IKTA 3PKBA 4Z7MA 4U6WA 3IU9A 2GZ5A 3IU8A 2GGBA 1XGOA 5CE6A 2GG9A 1YW8A 1R58A 3BIQA 2Q8KA 4U75A 1R5HA 3Q6DA 4HXXA 4S01A 4FLJA 3RORA 4RZYA 4JUQA 1JAWA 2Q96A 4B28A 1M35A 2EA4A 1WL6A 2GU7A 2OKNA 4IF7A 2BH3A 4U6JA 1PV9A 1C23A 2BB7A 2BHDA 4QR8A 4EGEA 3L24A 4U1BA 2IW2A 1WY2A 3MATA 2Q92A 3PKCA 5CIKA 2DFIA 3TAVA 5CDLA 2BHCA 3RVAA 5CDEA 2BWSA 3D27A 1R5GA 2P98A 4IPAA 2GG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKM A;  1W7V A;  4U76 A;  5JFR A;  2GG8 A;  1C24 A;  5CLS A;  4IKR A;  5CDV A;  1A16 A;  2OAZ A;  4ZWU A;  4FLL A;  3BIP A;  4IU6 A;  2EA2 A;  4U6C A;  2P9A A;  1KQ9 A;  2B3K A;  4FO8 A;  2GG3 A;  1O0X A;  2B3L A;  2BHB A;  2BWU A;  4ZWP A;  4IDY A;  5JI6 A;  5E5B A;  3L7G A;  2V3X A;  4U6E A;  2BWX A;  1XGM A;  2GU4 A;  2GU5 A;  3FM3 A;  2Q93 A;  1QXY A;  4ZWO A;  4FUK A;  4U71 A;  1KQ0 A;  1YVM A;  2Q94 A;  3CTZ A;  2EVO A;  4S2R P;  1WBQ A;  5CNX A;  4R60 A;  2GG5 A;  3FMQ A;  4FKC A;  4FO7 A;  3TB5 A;  3CB6 A;  2V3Y A;  1W2M A;  3FMR A;  4U70 A;  1QXZ A;  3PKE A;  2NQ6 A;  4IKS A;  1CHM A;  1BN5 A;  4OOK A;  4MAT A;  2EVM A;  4U6Z A;  2V3Z A;  4FLK A;  2BN7 A;  4A6V A;  2BWW A;  2NQ7 A;  1KP0 A;  1C22 A;  4KM3 A;  5D6F A;  5FCH A;  3MX6 A;  2BWT A;  2MAT A;  2G6P A;  4U73 A;  2Q95 A;  1XGN A;  2GG0 A;  1WLR A;  2ADU A;  2B3H A;  4U69 A;  1BOA A;  2P99 A;  4RZZ A;  2EVC A;  1C21 A;  3PKD A;  4S2T P;  1YJ3 A;  2GU6 A;  1QZY A;  1XGS A;  3IG4 A;  4IEC A;  3IU7 A;  2GA2 A;  3PKA A;  3CB5 A;  1Y1N A;  3BIT A;  5D6E A;  3S6B A;  4PV4 A;  4A6W A;  5JHU A;  2ZSG A;  4RGZ 1;  4FLI A;  2HOW A;  1B6A A;  1B59 A;  2GGC A;  2BWY A;  5FCF A;  3MR1 A;  4IKU A;  2GG7 A;  4ZNG A;  2GTX A;  1YW7 A;  2BHA A;  2BWV A;  2V6C A;  4S00 A;  1MAT A;  4PNC A;  1WL9 A;  1N51 A;  1XNZ A;  1WN1 A;  1C27 A;  1QXW A;  1YW9 A;  4IKT A;  3PKB A;  4Z7M A;  4U6W A;  3IU9 A;  2GZ5 A;  3IU8 A;  2GGB A;  1XGO A;  5CE6 A;  2GG9 A;  1YW8 A;  1R58 A;  3BIQ A;  2Q8K A;  4U75 A;  1R5H A;  3Q6D A;  4HXX A;  4S01 A;  4FLJ A;  3ROR A;  4RZY A;  4JUQ A;  1JAW A;  2Q96 A;  4B28 A;  1M35 A;  2EA4 A;  1WL6 A;  2GU7 A;  2OKN A;  4IF7 A;  2BH3 A;  4U6J A;  1PV9 A;  1C23 A;  2BB7 A;  2BHD A;  4QR8 A;  4EGE A;  3L24 A;  4U1B A;  2IW2 A;  1WY2 A;  3MAT A;  2Q92 A;  3PKC A;  5CIK A;  2DFI A;  3TAV A;  5CDL A;  2BHC A;  3RVA A;  5CDE A;  2BWS A;  3D27 A;  1R5G A;  2P98 A;  4IPA A;  2GG2 A; 
#chains in the Genus database with same CATH topology
 1WKM A;  1W7V A;  4U76 A;  5JFR A;  2GG8 A;  1C24 A;  5CLS A;  4IKR A;  5CDV A;  1A16 A;  2OAZ A;  4ZWU A;  4FLL A;  3BIP A;  4IU6 A;  2EA2 A;  4U6C A;  2P9A A;  1KQ9 A;  2B3K A;  4FO8 A;  2GG3 A;  1O0X A;  2B3L A;  2BHB A;  2BWU A;  4ZWP A;  4IDY A;  5JI6 A;  5E5B A;  3L7G A;  2V3X A;  4U6E A;  2BWX A;  1XGM A;  2GU4 A;  2GU5 A;  3FM3 A;  2Q93 A;  1QXY A;  4ZWO A;  4FUK A;  4U71 A;  1KQ0 A;  1YVM A;  2Q94 A;  3CTZ A;  2EVO A;  4S2R P;  1WBQ A;  5CNX A;  4R60 A;  2GG5 A;  3FMQ A;  4FKC A;  4FO7 A;  3TB5 A;  3CB6 A;  2V3Y A;  1W2M A;  3FMR A;  4U70 A;  1QXZ A;  3PKE A;  2NQ6 A;  4IKS A;  1CHM A;  1BN5 A;  4OOK A;  4MAT A;  2EVM A;  4U6Z A;  2V3Z A;  4FLK A;  2BN7 A;  4A6V A;  2BWW A;  2NQ7 A;  1KP0 A;  1C22 A;  4KM3 A;  5D6F A;  5FCH A;  3MX6 A;  2BWT A;  2MAT A;  2G6P A;  4U73 A;  2Q95 A;  1XGN A;  2GG0 A;  1WLR A;  2ADU A;  2B3H A;  4U69 A;  1BOA A;  2P99 A;  4RZZ A;  2EVC A;  1C21 A;  3PKD A;  4S2T P;  1YJ3 A;  2GU6 A;  1QZY A;  1XGS A;  3IG4 A;  4IEC A;  3IU7 A;  2GA2 A;  3PKA A;  3CB5 A;  1Y1N A;  3BIT A;  5D6E A;  3S6B A;  4PV4 A;  4A6W A;  5JHU A;  2ZSG A;  4RGZ 1;  4FLI A;  2HOW A;  1B6A A;  1B59 A;  2GGC A;  2BWY A;  5FCF A;  3MR1 A;  4IKU A;  2GG7 A;  4ZNG A;  2GTX A;  1YW7 A;  2BHA A;  2BWV A;  2V6C A;  4S00 A;  1MAT A;  4PNC A;  1WL9 A;  1N51 A;  1XNZ A;  1WN1 A;  1C27 A;  1QXW A;  1YW9 A;  4IKT A;  3PKB A;  4Z7M A;  4U6W A;  3IU9 A;  2GZ5 A;  3IU8 A;  2GGB A;  1XGO A;  5CE6 A;  2GG9 A;  1YW8 A;  1R58 A;  3BIQ A;  2Q8K A;  4U75 A;  1R5H A;  3Q6D A;  4HXX A;  4S01 A;  4FLJ A;  3ROR A;  4RZY A;  4JUQ A;  1JAW A;  2Q96 A;  4B28 A;  1M35 A;  2EA4 A;  1WL6 A;  2GU7 A;  2OKN A;  4IF7 A;  2BH3 A;  4U6J A;  1PV9 A;  1C23 A;  2BB7 A;  2BHD A;  4QR8 A;  4EGE A;  3L24 A;  4U1B A;  2IW2 A;  1WY2 A;  3MAT A;  2Q92 A;  3PKC A;  5CIK A;  2DFI A;  3TAV A;  5CDL A;  2BHC A;  3RVA A;  5CDE A;  2BWS A;  3D27 A;  1R5G A;  2P98 A;  4IPA A;  2GG2 A; 
#chains in the Genus database with same CATH homology
 1WKM A;  1W7V A;  4U76 A;  5JFR A;  2GG8 A;  1C24 A;  5CLS A;  4IKR A;  5CDV A;  1A16 A;  2OAZ A;  4ZWU A;  4FLL A;  3BIP A;  4IU6 A;  2EA2 A;  4U6C A;  2P9A A;  1KQ9 A;  2B3K A;  4FO8 A;  2GG3 A;  1O0X A;  2B3L A;  2BHB A;  2BWU A;  4ZWP A;  4IDY A;  5JI6 A;  5E5B A;  3L7G A;  2V3X A;  4U6E A;  2BWX A;  1XGM A;  2GU4 A;  2GU5 A;  3FM3 A;  2Q93 A;  1QXY A;  4ZWO A;  4FUK A;  4U71 A;  1KQ0 A;  1YVM A;  2Q94 A;  3CTZ A;  2EVO A;  4S2R P;  1WBQ A;  5CNX A;  4R60 A;  2GG5 A;  3FMQ A;  4FKC A;  4FO7 A;  3TB5 A;  3CB6 A;  2V3Y A;  1W2M A;  3FMR A;  4U70 A;  1QXZ A;  3PKE A;  2NQ6 A;  4IKS A;  1CHM A;  1BN5 A;  4OOK A;  4MAT A;  2EVM A;  4U6Z A;  2V3Z A;  4FLK A;  2BN7 A;  4A6V A;  2BWW A;  2NQ7 A;  1KP0 A;  1C22 A;  4KM3 A;  5D6F A;  5FCH A;  3MX6 A;  2BWT A;  2MAT A;  2G6P A;  4U73 A;  2Q95 A;  1XGN A;  2GG0 A;  1WLR A;  2ADU A;  2B3H A;  4U69 A;  1BOA A;  2P99 A;  4RZZ A;  2EVC A;  1C21 A;  3PKD A;  4S2T P;  1YJ3 A;  2GU6 A;  1QZY A;  1XGS A;  3IG4 A;  4IEC A;  3IU7 A;  2GA2 A;  3PKA A;  3CB5 A;  1Y1N A;  3BIT A;  5D6E A;  3S6B A;  4PV4 A;  4A6W A;  5JHU A;  2ZSG A;  4RGZ 1;  4FLI A;  2HOW A;  1B6A A;  1B59 A;  2GGC A;  2BWY A;  5FCF A;  3MR1 A;  4IKU A;  2GG7 A;  4ZNG A;  2GTX A;  1YW7 A;  2BHA A;  2BWV A;  2V6C A;  4S00 A;  1MAT A;  4PNC A;  1WL9 A;  1N51 A;  1XNZ A;  1WN1 A;  1C27 A;  1QXW A;  1YW9 A;  4IKT A;  3PKB A;  4Z7M A;  4U6W A;  3IU9 A;  2GZ5 A;  3IU8 A;  2GGB A;  1XGO A;  5CE6 A;  2GG9 A;  1YW8 A;  1R58 A;  3BIQ A;  2Q8K A;  4U75 A;  1R5H A;  3Q6D A;  4HXX A;  4S01 A;  4FLJ A;  3ROR A;  4RZY A;  4JUQ A;  1JAW A;  2Q96 A;  4B28 A;  1M35 A;  2EA4 A;  1WL6 A;  2GU7 A;  2OKN A;  4IF7 A;  2BH3 A;  4U6J A;  1PV9 A;  1C23 A;  2BB7 A;  2BHD A;  4QR8 A;  4EGE A;  3L24 A;  4U1B A;  2IW2 A;  1WY2 A;  3MAT A;  2Q92 A;  3PKC A;  5CIK A;  2DFI A;  3TAV A;  5CDL A;  2BHC A;  3RVA A;  5CDE A;  2BWS A;  3D27 A;  1R5G A;  2P98 A;  4IPA A;  2GG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...