1C27A

E. coli methionine aminopeptidase:norleucine phosphonate complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 85
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c27A00
1C24A 4S00A 1YW7A 3BIQA 2Q96A 5JHUA 2P9AA 3PKAA 4IKUA 1XGOA 2P99A 2ZSGA 1KQ0A 4IKTA 2BHCA 4FLLA 4U76A 1KP0A 2BWTA 4FKCA 4QR8A 4IECA 1YVMA 4JUQA 3PKCA 1YW9A 1C23A 5E5BA 4Z7MA 2GU6A 2GGBA 2BWXA 4IU6A 3CB5A 2BHAA 2GG7A 2GU5A 2Q8KA 1XGNA 2OKNA 5CLSA 2GA2A 1R58A 3CTZA 2V3ZA 2GG8A 1WL9A 1R5HA 1QZYA 4R60A 1QXZA 5D6FA 4U71A 2MATA 1O0XA 3PKEA 2V3XA 2GGCA 1C27A 4S2TP 2V3YA 4FUKA 4IKSA 1N51A 1PV9A 1WKMA 3BITA 1KQ9A 4U6JA 4FLIA 4ZWUA 1R5GA 2BN7A 4HXXA 4ZNGA 3CB6A 4PV4A 5CDLA 4S01A 4U6WA 4A6VA 4PNCA 1W2MA 5FCHA 2BH3A 1XGSA 2BWYA 4U69A 1QXWA 1QXYA 1WBQA 4ZWOA 5CDVA 2GG3A 3BIPA 3FM3A 5D6EA 3IG4A 1WL6A 3PKBA 2EA2A 1JAWA 4U6EA 3IU8A 2EVCA 3PKDA 1W7VA 2Q93A 2DFIA 2NQ6A 4FO8A 3S6BA 2EVOA 4EGEA 2GU7A 2BB7A 2BHBA 2B3HA 2Q95A 2GG5A 4FLKA 4IPAA 4U6ZA 2B3KA 3FMRA 1C22A 3IU9A 1M35A 2BWVA 4IF7A 3D27A 4U6CA 2IW2A 5JI6A 1WY2A 2EVMA 4B28A 2EA4A 2GU4A 4U1BA 4FLJA 4U70A 2GZ5A 3FMQA 4FO7A 1B59A 2BHDA 1CHMA 2P98A 3MR1A 1MATA 4RGZ1 3RORA 5JFRA 2BWUA 3RVAA 4RZZA 1XGMA 3TB5A 1WN1A 2GG2A 1XNZA 1WLRA 3MX6A 4OOKA 1C21A 3Q6DA 4IKRA 4RZYA 1BN5A 2GTXA 4U73A 2V6CA 1B6AA 2ADUA 2B3LA 2Q92A 2Q94A 2BWSA 4A6WA 4S2RP 4KM3A 5CIKA 3TAVA 5FCFA 3L7GA 5CDEA 4ZWPA 3IU7A 1A16A 3L24A 2G6PA 2NQ7A 1YJ3A 1YW8A 2OAZA 5CE6A 2GG0A 5CNXA 1BOAA 1Y1NA 4MATA 4IDYA 2BWWA 2HOWA 3MATA 2GG9A 4U75A
chains in the Genus database with same CATH superfamily
1C24A 4S00A 1YW7A 3BIQA 2Q96A 5JHUA 2P9AA 3PKAA 4IKUA 1XGOA 2P99A 2ZSGA 1KQ0A 4IKTA 2BHCA 4FLLA 4U76A 1KP0A 2BWTA 4FKCA 4QR8A 4IECA 1YVMA 4JUQA 3PKCA 1YW9A 1C23A 5E5BA 4Z7MA 2GU6A 2GGBA 2BWXA 4IU6A 3CB5A 2BHAA 2GG7A 2GU5A 2Q8KA 1XGNA 2OKNA 5CLSA 2GA2A 1R58A 3CTZA 2V3ZA 2GG8A 1WL9A 1R5HA 1QZYA 4R60A 1QXZA 5D6FA 4U71A 2MATA 1O0XA 3PKEA 2V3XA 2GGCA 1C27A 4S2TP 2V3YA 4FUKA 4IKSA 1N51A 1PV9A 1WKMA 3BITA 1KQ9A 4U6JA 4FLIA 4ZWUA 1R5GA 2BN7A 4HXXA 4ZNGA 3CB6A 4PV4A 5CDLA 4S01A 4U6WA 4A6VA 4PNCA 1W2MA 5FCHA 2BH3A 1XGSA 2BWYA 4U69A 1QXWA 1QXYA 1WBQA 4ZWOA 5CDVA 2GG3A 3BIPA 3FM3A 5D6EA 3IG4A 1WL6A 3PKBA 2EA2A 1JAWA 4U6EA 3IU8A 2EVCA 3PKDA 1W7VA 2Q93A 2DFIA 2NQ6A 4FO8A 3S6BA 2EVOA 4EGEA 2GU7A 2BB7A 2BHBA 2B3HA 2Q95A 2GG5A 4FLKA 4IPAA 4U6ZA 2B3KA 3FMRA 1C22A 3IU9A 1M35A 2BWVA 4IF7A 3D27A 4U6CA 2IW2A 5JI6A 1WY2A 2EVMA 4B28A 2EA4A 2GU4A 4U1BA 4FLJA 4U70A 2GZ5A 3FMQA 4FO7A 1B59A 2BHDA 1CHMA 2P98A 3MR1A 1MATA 4RGZ1 3RORA 5JFRA 2BWUA 3RVAA 4RZZA 1XGMA 3TB5A 1WN1A 2GG2A 1XNZA 1WLRA 3MX6A 4OOKA 1C21A 3Q6DA 4IKRA 4RZYA 1BN5A 2GTXA 4U73A 2V6CA 1B6AA 2ADUA 2B3LA 2Q92A 2Q94A 2BWSA 4A6WA 4S2RP 4KM3A 5CIKA 3TAVA 5FCFA 3L7GA 5CDEA 4ZWPA 3IU7A 1A16A 3L24A 2G6PA 2NQ7A 1YJ3A 1YW8A 2OAZA 5CE6A 2GG0A 5CNXA 1BOAA 1Y1NA 4MATA 4IDYA 2BWWA 2HOWA 3MATA 2GG9A 4U75A
chains in the Genus database with same CATH topology
1C24A 4S00A 1YW7A 3BIQA 2Q96A 5JHUA 2P9AA 3PKAA 4IKUA 1XGOA 2P99A 2ZSGA 1KQ0A 4IKTA 2BHCA 4FLLA 4U76A 1KP0A 2BWTA 4FKCA 4QR8A 4IECA 1YVMA 4JUQA 3PKCA 1YW9A 1C23A 5E5BA 4Z7MA 2GU6A 2GGBA 2BWXA 4IU6A 3CB5A 2BHAA 2GG7A 2GU5A 2Q8KA 1XGNA 2OKNA 5CLSA 2GA2A 1R58A 3CTZA 2V3ZA 2GG8A 1WL9A 1R5HA 1QZYA 4R60A 1QXZA 5D6FA 4U71A 2MATA 1O0XA 3PKEA 2V3XA 2GGCA 1C27A 4S2TP 2V3YA 4FUKA 4IKSA 1N51A 1PV9A 1WKMA 3BITA 1KQ9A 4U6JA 4FLIA 4ZWUA 1R5GA 2BN7A 4HXXA 4ZNGA 3CB6A 4PV4A 5CDLA 4S01A 4U6WA 4A6VA 4PNCA 1W2MA 5FCHA 2BH3A 1XGSA 2BWYA 4U69A 1QXWA 1QXYA 1WBQA 4ZWOA 5CDVA 2GG3A 3BIPA 3FM3A 5D6EA 3IG4A 1WL6A 3PKBA 2EA2A 1JAWA 4U6EA 3IU8A 2EVCA 3PKDA 1W7VA 2Q93A 2DFIA 2NQ6A 4FO8A 3S6BA 2EVOA 4EGEA 2GU7A 2BB7A 2BHBA 2B3HA 2Q95A 2GG5A 4FLKA 4IPAA 4U6ZA 2B3KA 3FMRA 1C22A 3IU9A 1M35A 2BWVA 4IF7A 3D27A 4U6CA 2IW2A 5JI6A 1WY2A 2EVMA 4B28A 2EA4A 2GU4A 4U1BA 4FLJA 4U70A 2GZ5A 3FMQA 4FO7A 1B59A 2BHDA 1CHMA 2P98A 3MR1A 1MATA 4RGZ1 3RORA 5JFRA 2BWUA 3RVAA 4RZZA 1XGMA 3TB5A 1WN1A 2GG2A 1XNZA 1WLRA 3MX6A 4OOKA 1C21A 3Q6DA 4IKRA 4RZYA 1BN5A 2GTXA 4U73A 2V6CA 1B6AA 2ADUA 2B3LA 2Q92A 2Q94A 2BWSA 4A6WA 4S2RP 4KM3A 5CIKA 3TAVA 5FCFA 3L7GA 5CDEA 4ZWPA 3IU7A 1A16A 3L24A 2G6PA 2NQ7A 1YJ3A 1YW8A 2OAZA 5CE6A 2GG0A 5CNXA 1BOAA 1Y1NA 4MATA 4IDYA 2BWWA 2HOWA 3MATA 2GG9A 4U75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C24 A;  4S00 A;  1YW7 A;  3BIQ A;  2Q96 A;  5JHU A;  2P9A A;  3PKA A;  4IKU A;  1XGO A;  2P99 A;  2ZSG A;  1KQ0 A;  4IKT A;  2BHC A;  4FLL A;  4U76 A;  1KP0 A;  2BWT A;  4FKC A;  4QR8 A;  4IEC A;  1YVM A;  4JUQ A;  3PKC A;  1YW9 A;  1C23 A;  5E5B A;  4Z7M A;  2GU6 A;  2GGB A;  2BWX A;  4IU6 A;  3CB5 A;  2BHA A;  2GG7 A;  2GU5 A;  2Q8K A;  1XGN A;  2OKN A;  5CLS A;  2GA2 A;  1R58 A;  3CTZ A;  2V3Z A;  2GG8 A;  1WL9 A;  1R5H A;  1QZY A;  4R60 A;  1QXZ A;  5D6F A;  4U71 A;  2MAT A;  1O0X A;  3PKE A;  2V3X A;  2GGC A;  1C27 A;  4S2T P;  2V3Y A;  4FUK A;  4IKS A;  1N51 A;  1PV9 A;  1WKM A;  3BIT A;  1KQ9 A;  4U6J A;  4FLI A;  4ZWU A;  1R5G A;  2BN7 A;  4HXX A;  4ZNG A;  3CB6 A;  4PV4 A;  5CDL A;  4S01 A;  4U6W A;  4A6V A;  4PNC A;  1W2M A;  5FCH A;  2BH3 A;  1XGS A;  2BWY A;  4U69 A;  1QXW A;  1QXY A;  1WBQ A;  4ZWO A;  5CDV A;  2GG3 A;  3BIP A;  3FM3 A;  5D6E A;  3IG4 A;  1WL6 A;  3PKB A;  2EA2 A;  1JAW A;  4U6E A;  3IU8 A;  2EVC A;  3PKD A;  1W7V A;  2Q93 A;  2DFI A;  2NQ6 A;  4FO8 A;  3S6B A;  2EVO A;  4EGE A;  2GU7 A;  2BB7 A;  2BHB A;  2B3H A;  2Q95 A;  2GG5 A;  4FLK A;  4IPA A;  4U6Z A;  2B3K A;  3FMR A;  1C22 A;  3IU9 A;  1M35 A;  2BWV A;  4IF7 A;  3D27 A;  4U6C A;  2IW2 A;  5JI6 A;  1WY2 A;  2EVM A;  4B28 A;  2EA4 A;  2GU4 A;  4U1B A;  4FLJ A;  4U70 A;  2GZ5 A;  3FMQ A;  4FO7 A;  1B59 A;  2BHD A;  1CHM A;  2P98 A;  3MR1 A;  1MAT A;  4RGZ 1;  3ROR A;  5JFR A;  2BWU A;  3RVA A;  4RZZ A;  1XGM A;  3TB5 A;  1WN1 A;  2GG2 A;  1XNZ A;  1WLR A;  3MX6 A;  4OOK A;  1C21 A;  3Q6D A;  4IKR A;  4RZY A;  1BN5 A;  2GTX A;  4U73 A;  2V6C A;  1B6A A;  2ADU A;  2B3L A;  2Q92 A;  2Q94 A;  2BWS A;  4A6W A;  4S2R P;  4KM3 A;  5CIK A;  3TAV A;  5FCF A;  3L7G A;  5CDE A;  4ZWP A;  3IU7 A;  1A16 A;  3L24 A;  2G6P A;  2NQ7 A;  1YJ3 A;  1YW8 A;  2OAZ A;  5CE6 A;  2GG0 A;  5CNX A;  1BOA A;  1Y1N A;  4MAT A;  4IDY A;  2BWW A;  2HOW A;  3MAT A;  2GG9 A;  4U75 A; 
#chains in the Genus database with same CATH topology
 1C24 A;  4S00 A;  1YW7 A;  3BIQ A;  2Q96 A;  5JHU A;  2P9A A;  3PKA A;  4IKU A;  1XGO A;  2P99 A;  2ZSG A;  1KQ0 A;  4IKT A;  2BHC A;  4FLL A;  4U76 A;  1KP0 A;  2BWT A;  4FKC A;  4QR8 A;  4IEC A;  1YVM A;  4JUQ A;  3PKC A;  1YW9 A;  1C23 A;  5E5B A;  4Z7M A;  2GU6 A;  2GGB A;  2BWX A;  4IU6 A;  3CB5 A;  2BHA A;  2GG7 A;  2GU5 A;  2Q8K A;  1XGN A;  2OKN A;  5CLS A;  2GA2 A;  1R58 A;  3CTZ A;  2V3Z A;  2GG8 A;  1WL9 A;  1R5H A;  1QZY A;  4R60 A;  1QXZ A;  5D6F A;  4U71 A;  2MAT A;  1O0X A;  3PKE A;  2V3X A;  2GGC A;  1C27 A;  4S2T P;  2V3Y A;  4FUK A;  4IKS A;  1N51 A;  1PV9 A;  1WKM A;  3BIT A;  1KQ9 A;  4U6J A;  4FLI A;  4ZWU A;  1R5G A;  2BN7 A;  4HXX A;  4ZNG A;  3CB6 A;  4PV4 A;  5CDL A;  4S01 A;  4U6W A;  4A6V A;  4PNC A;  1W2M A;  5FCH A;  2BH3 A;  1XGS A;  2BWY A;  4U69 A;  1QXW A;  1QXY A;  1WBQ A;  4ZWO A;  5CDV A;  2GG3 A;  3BIP A;  3FM3 A;  5D6E A;  3IG4 A;  1WL6 A;  3PKB A;  2EA2 A;  1JAW A;  4U6E A;  3IU8 A;  2EVC A;  3PKD A;  1W7V A;  2Q93 A;  2DFI A;  2NQ6 A;  4FO8 A;  3S6B A;  2EVO A;  4EGE A;  2GU7 A;  2BB7 A;  2BHB A;  2B3H A;  2Q95 A;  2GG5 A;  4FLK A;  4IPA A;  4U6Z A;  2B3K A;  3FMR A;  1C22 A;  3IU9 A;  1M35 A;  2BWV A;  4IF7 A;  3D27 A;  4U6C A;  2IW2 A;  5JI6 A;  1WY2 A;  2EVM A;  4B28 A;  2EA4 A;  2GU4 A;  4U1B A;  4FLJ A;  4U70 A;  2GZ5 A;  3FMQ A;  4FO7 A;  1B59 A;  2BHD A;  1CHM A;  2P98 A;  3MR1 A;  1MAT A;  4RGZ 1;  3ROR A;  5JFR A;  2BWU A;  3RVA A;  4RZZ A;  1XGM A;  3TB5 A;  1WN1 A;  2GG2 A;  1XNZ A;  1WLR A;  3MX6 A;  4OOK A;  1C21 A;  3Q6D A;  4IKR A;  4RZY A;  1BN5 A;  2GTX A;  4U73 A;  2V6C A;  1B6A A;  2ADU A;  2B3L A;  2Q92 A;  2Q94 A;  2BWS A;  4A6W A;  4S2R P;  4KM3 A;  5CIK A;  3TAV A;  5FCF A;  3L7G A;  5CDE A;  4ZWP A;  3IU7 A;  1A16 A;  3L24 A;  2G6P A;  2NQ7 A;  1YJ3 A;  1YW8 A;  2OAZ A;  5CE6 A;  2GG0 A;  5CNX A;  1BOA A;  1Y1N A;  4MAT A;  4IDY A;  2BWW A;  2HOW A;  3MAT A;  2GG9 A;  4U75 A; 
#chains in the Genus database with same CATH homology
 1C24 A;  4S00 A;  1YW7 A;  3BIQ A;  2Q96 A;  5JHU A;  2P9A A;  3PKA A;  4IKU A;  1XGO A;  2P99 A;  2ZSG A;  1KQ0 A;  4IKT A;  2BHC A;  4FLL A;  4U76 A;  1KP0 A;  2BWT A;  4FKC A;  4QR8 A;  4IEC A;  1YVM A;  4JUQ A;  3PKC A;  1YW9 A;  1C23 A;  5E5B A;  4Z7M A;  2GU6 A;  2GGB A;  2BWX A;  4IU6 A;  3CB5 A;  2BHA A;  2GG7 A;  2GU5 A;  2Q8K A;  1XGN A;  2OKN A;  5CLS A;  2GA2 A;  1R58 A;  3CTZ A;  2V3Z A;  2GG8 A;  1WL9 A;  1R5H A;  1QZY A;  4R60 A;  1QXZ A;  5D6F A;  4U71 A;  2MAT A;  1O0X A;  3PKE A;  2V3X A;  2GGC A;  1C27 A;  4S2T P;  2V3Y A;  4FUK A;  4IKS A;  1N51 A;  1PV9 A;  1WKM A;  3BIT A;  1KQ9 A;  4U6J A;  4FLI A;  4ZWU A;  1R5G A;  2BN7 A;  4HXX A;  4ZNG A;  3CB6 A;  4PV4 A;  5CDL A;  4S01 A;  4U6W A;  4A6V A;  4PNC A;  1W2M A;  5FCH A;  2BH3 A;  1XGS A;  2BWY A;  4U69 A;  1QXW A;  1QXY A;  1WBQ A;  4ZWO A;  5CDV A;  2GG3 A;  3BIP A;  3FM3 A;  5D6E A;  3IG4 A;  1WL6 A;  3PKB A;  2EA2 A;  1JAW A;  4U6E A;  3IU8 A;  2EVC A;  3PKD A;  1W7V A;  2Q93 A;  2DFI A;  2NQ6 A;  4FO8 A;  3S6B A;  2EVO A;  4EGE A;  2GU7 A;  2BB7 A;  2BHB A;  2B3H A;  2Q95 A;  2GG5 A;  4FLK A;  4IPA A;  4U6Z A;  2B3K A;  3FMR A;  1C22 A;  3IU9 A;  1M35 A;  2BWV A;  4IF7 A;  3D27 A;  4U6C A;  2IW2 A;  5JI6 A;  1WY2 A;  2EVM A;  4B28 A;  2EA4 A;  2GU4 A;  4U1B A;  4FLJ A;  4U70 A;  2GZ5 A;  3FMQ A;  4FO7 A;  1B59 A;  2BHD A;  1CHM A;  2P98 A;  3MR1 A;  1MAT A;  4RGZ 1;  3ROR A;  5JFR A;  2BWU A;  3RVA A;  4RZZ A;  1XGM A;  3TB5 A;  1WN1 A;  2GG2 A;  1XNZ A;  1WLR A;  3MX6 A;  4OOK A;  1C21 A;  3Q6D A;  4IKR A;  4RZY A;  1BN5 A;  2GTX A;  4U73 A;  2V6C A;  1B6A A;  2ADU A;  2B3L A;  2Q92 A;  2Q94 A;  2BWS A;  4A6W A;  4S2R P;  4KM3 A;  5CIK A;  3TAV A;  5FCF A;  3L7G A;  5CDE A;  4ZWP A;  3IU7 A;  1A16 A;  3L24 A;  2G6P A;  2NQ7 A;  1YJ3 A;  1YW8 A;  2OAZ A;  5CE6 A;  2GG0 A;  5CNX A;  1BOA A;  1Y1N A;  4MAT A;  4IDY A;  2BWW A;  2HOW A;  3MAT A;  2GG9 A;  4U75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...