1C27A

E. coli methionine aminopeptidase:norleucine phosphonate complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Insights into the mechanism of Escherichia coli methionine aminopeptidase from the structural analysis of reaction products and phosphorus-based transition-state analogues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1c27A00
4IU6A 3PKAA 4U70A 3BIQA 4FLLA 4PV4A 1C22A 4IKSA 1W2MA 5FCFA 5CDLA 3PKDA 2BHBA 1W7VA 2Q94A 4IPAA 4U75A 1BN5A 2P99A 2V3YA 2ADUA 2GG8A 4B28A 1BOAA 1B59A 5CLSA 3FM3A 5E5BA 2EVMA 2Q8KA 3TAVA 2NQ7A 1MATA 2HOWA 5CDVA 2GG9A 2GG2A 4S2TP 4U6CA 2DFIA 3IU9A 1YW8A 4A6VA 1XNZA 2BWXA 1QZYA 2BN7A 1XGNA 2BB7A 4U6WA 2GGBA 4IKTA 2BWUA 2NQ6A 5CIKA 4IKRA 3PKCA 4U71A 1CHMA 4S00A 4ZWUA 2P9AA 2B3LA 4ZNGA 3TB5A 1Y1NA 5D6EA 4FKCA 3L7GA 3CTZA 2BWTA 4U6ZA 4RZZA 1WLRA 1YVMA 4U73A 1PV9A 2BWWA 2Q93A 1KQ9A 3PKBA 1R5HA 4ZWOA 4IF7A 1C21A 2EVCA 2GU5A 1WN1A 1M35A 3IU8A 3IU7A 4A6WA 2BHDA 5JI6A 1KP0A 3BIPA 3MATA 1WKMA 4U6EA 4IKUA 2GGCA 1JAWA 4HXXA 4IDYA 3FMQA 1O0XA 4FLIA 4S01A 5CNXA 1A16A 4S2RP 3L24A 4ZWPA 1YJ3A 1YW9A 2BH3A 2EA2A 3BITA 4U6JA 2V6CA 2GU6A 3FMRA 3MX6A 2GA2A 3RORA 2GG5A 2Q96A 4FO7A 5D6FA 1C23A 3Q6DA 4MATA 4U69A 1R5GA 1KQ0A 4FLKA 5CDEA 1XGMA 1C27A 4IECA 2GG7A 4OOKA 4RZYA 2BHCA 2OAZA 1QXZA 5JFRA 4RGZ1 2GTXA 4R60A 3MR1A 2GU4A 2GZ5A 2BHAA 2B3KA 2Q92A 1YW7A 2B3HA 2BWYA 2EVOA 3PKEA 1WL9A 2P98A 4FUKA 2BWSA 4Z7MA 2GG0A 1R58A 1QXWA 2GG3A 3IG4A 4U76A 4EGEA 2IW2A 2ZSGA 2V3XA 4PNCA 2G6PA 3D27A 1WBQA 2EA4A 1XGOA 1QXYA 1WL6A 3S6BA 3CB5A 1C24A 3CB6A 4KM3A 3RVAA 2MATA 5FCHA 5CE6A 1WY2A 4QR8A 2OKNA 2V3ZA 4FO8A 2BWVA 1N51A 2Q95A 4JUQA 4FLJA 1B6AA 2GU7A 5JHUA 1XGSA 4U1BA
chains in the Genus database with same CATH superfamily
4IU6A 3PKAA 4U70A 3BIQA 4FLLA 4PV4A 1C22A 4IKSA 1W2MA 5FCFA 5CDLA 3PKDA 2BHBA 1W7VA 2Q94A 4IPAA 4U75A 1BN5A 2P99A 2V3YA 2ADUA 2GG8A 4B28A 1BOAA 1B59A 5CLSA 3FM3A 5E5BA 2EVMA 2Q8KA 3TAVA 2NQ7A 1MATA 2HOWA 5CDVA 2GG9A 2GG2A 4S2TP 4U6CA 2DFIA 3IU9A 1YW8A 4A6VA 1XNZA 2BWXA 1QZYA 2BN7A 1XGNA 2BB7A 4U6WA 2GGBA 4IKTA 2BWUA 2NQ6A 5CIKA 4IKRA 3PKCA 4U71A 1CHMA 4S00A 4ZWUA 2P9AA 2B3LA 4ZNGA 3TB5A 1Y1NA 5D6EA 4FKCA 3L7GA 3CTZA 2BWTA 4U6ZA 4RZZA 1WLRA 1YVMA 4U73A 1PV9A 2BWWA 2Q93A 1KQ9A 3PKBA 1R5HA 4ZWOA 4IF7A 1C21A 2EVCA 2GU5A 1WN1A 1M35A 3IU8A 3IU7A 4A6WA 2BHDA 5JI6A 1KP0A 3BIPA 3MATA 1WKMA 4U6EA 4IKUA 2GGCA 1JAWA 4HXXA 4IDYA 3FMQA 1O0XA 4FLIA 4S01A 5CNXA 1A16A 4S2RP 3L24A 4ZWPA 1YJ3A 1YW9A 2BH3A 2EA2A 3BITA 4U6JA 2V6CA 2GU6A 3FMRA 3MX6A 2GA2A 3RORA 2GG5A 2Q96A 4FO7A 5D6FA 1C23A 3Q6DA 4MATA 4U69A 1R5GA 1KQ0A 4FLKA 5CDEA 1XGMA 1C27A 4IECA 2GG7A 4OOKA 4RZYA 2BHCA 2OAZA 1QXZA 5JFRA 4RGZ1 2GTXA 4R60A 3MR1A 2GU4A 2GZ5A 2BHAA 2B3KA 2Q92A 1YW7A 2B3HA 2BWYA 2EVOA 3PKEA 1WL9A 2P98A 4FUKA 2BWSA 4Z7MA 2GG0A 1R58A 1QXWA 2GG3A 3IG4A 4U76A 4EGEA 2IW2A 2ZSGA 2V3XA 4PNCA 2G6PA 3D27A 1WBQA 2EA4A 1XGOA 1QXYA 1WL6A 3S6BA 3CB5A 1C24A 3CB6A 4KM3A 3RVAA 2MATA 5FCHA 5CE6A 1WY2A 4QR8A 2OKNA 2V3ZA 4FO8A 2BWVA 1N51A 2Q95A 4JUQA 4FLJA 1B6AA 2GU7A 5JHUA 1XGSA 4U1BA
chains in the Genus database with same CATH topology
4IU6A 3PKAA 4U70A 3BIQA 4FLLA 4PV4A 1C22A 4IKSA 1W2MA 5FCFA 5CDLA 3PKDA 2BHBA 1W7VA 2Q94A 4IPAA 4U75A 1BN5A 2P99A 2V3YA 2ADUA 2GG8A 4B28A 1BOAA 1B59A 5CLSA 3FM3A 5E5BA 2EVMA 2Q8KA 3TAVA 2NQ7A 1MATA 2HOWA 5CDVA 2GG9A 2GG2A 4S2TP 4U6CA 2DFIA 3IU9A 1YW8A 4A6VA 1XNZA 2BWXA 1QZYA 2BN7A 1XGNA 2BB7A 4U6WA 2GGBA 4IKTA 2BWUA 2NQ6A 5CIKA 4IKRA 3PKCA 4U71A 1CHMA 4S00A 4ZWUA 2P9AA 2B3LA 4ZNGA 3TB5A 1Y1NA 5D6EA 4FKCA 3L7GA 3CTZA 2BWTA 4U6ZA 4RZZA 1WLRA 1YVMA 4U73A 1PV9A 2BWWA 2Q93A 1KQ9A 3PKBA 1R5HA 4ZWOA 4IF7A 1C21A 2EVCA 2GU5A 1WN1A 1M35A 3IU8A 3IU7A 4A6WA 2BHDA 5JI6A 1KP0A 3BIPA 3MATA 1WKMA 4U6EA 4IKUA 2GGCA 1JAWA 4HXXA 4IDYA 3FMQA 1O0XA 4FLIA 4S01A 5CNXA 1A16A 4S2RP 3L24A 4ZWPA 1YJ3A 1YW9A 2BH3A 2EA2A 3BITA 4U6JA 2V6CA 2GU6A 3FMRA 3MX6A 2GA2A 3RORA 2GG5A 2Q96A 4FO7A 5D6FA 1C23A 3Q6DA 4MATA 4U69A 1R5GA 1KQ0A 4FLKA 5CDEA 1XGMA 1C27A 4IECA 2GG7A 4OOKA 4RZYA 2BHCA 2OAZA 1QXZA 5JFRA 4RGZ1 2GTXA 4R60A 3MR1A 2GU4A 2GZ5A 2BHAA 2B3KA 2Q92A 1YW7A 2B3HA 2BWYA 2EVOA 3PKEA 1WL9A 2P98A 4FUKA 2BWSA 4Z7MA 2GG0A 1R58A 1QXWA 2GG3A 3IG4A 4U76A 4EGEA 2IW2A 2ZSGA 2V3XA 4PNCA 2G6PA 3D27A 1WBQA 2EA4A 1XGOA 1QXYA 1WL6A 3S6BA 3CB5A 1C24A 3CB6A 4KM3A 3RVAA 2MATA 5FCHA 5CE6A 1WY2A 4QR8A 2OKNA 2V3ZA 4FO8A 2BWVA 1N51A 2Q95A 4JUQA 4FLJA 1B6AA 2GU7A 5JHUA 1XGSA 4U1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU6 A;  3PKA A;  4U70 A;  3BIQ A;  4FLL A;  4PV4 A;  1C22 A;  4IKS A;  1W2M A;  5FCF A;  5CDL A;  3PKD A;  2BHB A;  1W7V A;  2Q94 A;  4IPA A;  4U75 A;  1BN5 A;  2P99 A;  2V3Y A;  2ADU A;  2GG8 A;  4B28 A;  1BOA A;  1B59 A;  5CLS A;  3FM3 A;  5E5B A;  2EVM A;  2Q8K A;  3TAV A;  2NQ7 A;  1MAT A;  2HOW A;  5CDV A;  2GG9 A;  2GG2 A;  4S2T P;  4U6C A;  2DFI A;  3IU9 A;  1YW8 A;  4A6V A;  1XNZ A;  2BWX A;  1QZY A;  2BN7 A;  1XGN A;  2BB7 A;  4U6W A;  2GGB A;  4IKT A;  2BWU A;  2NQ6 A;  5CIK A;  4IKR A;  3PKC A;  4U71 A;  1CHM A;  4S00 A;  4ZWU A;  2P9A A;  2B3L A;  4ZNG A;  3TB5 A;  1Y1N A;  5D6E A;  4FKC A;  3L7G A;  3CTZ A;  2BWT A;  4U6Z A;  4RZZ A;  1WLR A;  1YVM A;  4U73 A;  1PV9 A;  2BWW A;  2Q93 A;  1KQ9 A;  3PKB A;  1R5H A;  4ZWO A;  4IF7 A;  1C21 A;  2EVC A;  2GU5 A;  1WN1 A;  1M35 A;  3IU8 A;  3IU7 A;  4A6W A;  2BHD A;  5JI6 A;  1KP0 A;  3BIP A;  3MAT A;  1WKM A;  4U6E A;  4IKU A;  2GGC A;  1JAW A;  4HXX A;  4IDY A;  3FMQ A;  1O0X A;  4FLI A;  4S01 A;  5CNX A;  1A16 A;  4S2R P;  3L24 A;  4ZWP A;  1YJ3 A;  1YW9 A;  2BH3 A;  2EA2 A;  3BIT A;  4U6J A;  2V6C A;  2GU6 A;  3FMR A;  3MX6 A;  2GA2 A;  3ROR A;  2GG5 A;  2Q96 A;  4FO7 A;  5D6F A;  1C23 A;  3Q6D A;  4MAT A;  4U69 A;  1R5G A;  1KQ0 A;  4FLK A;  5CDE A;  1XGM A;  1C27 A;  4IEC A;  2GG7 A;  4OOK A;  4RZY A;  2BHC A;  2OAZ A;  1QXZ A;  5JFR A;  4RGZ 1;  2GTX A;  4R60 A;  3MR1 A;  2GU4 A;  2GZ5 A;  2BHA A;  2B3K A;  2Q92 A;  1YW7 A;  2B3H A;  2BWY A;  2EVO A;  3PKE A;  1WL9 A;  2P98 A;  4FUK A;  2BWS A;  4Z7M A;  2GG0 A;  1R58 A;  1QXW A;  2GG3 A;  3IG4 A;  4U76 A;  4EGE A;  2IW2 A;  2ZSG A;  2V3X A;  4PNC A;  2G6P A;  3D27 A;  1WBQ A;  2EA4 A;  1XGO A;  1QXY A;  1WL6 A;  3S6B A;  3CB5 A;  1C24 A;  3CB6 A;  4KM3 A;  3RVA A;  2MAT A;  5FCH A;  5CE6 A;  1WY2 A;  4QR8 A;  2OKN A;  2V3Z A;  4FO8 A;  2BWV A;  1N51 A;  2Q95 A;  4JUQ A;  4FLJ A;  1B6A A;  2GU7 A;  5JHU A;  1XGS A;  4U1B A; 
#chains in the Genus database with same CATH topology
 4IU6 A;  3PKA A;  4U70 A;  3BIQ A;  4FLL A;  4PV4 A;  1C22 A;  4IKS A;  1W2M A;  5FCF A;  5CDL A;  3PKD A;  2BHB A;  1W7V A;  2Q94 A;  4IPA A;  4U75 A;  1BN5 A;  2P99 A;  2V3Y A;  2ADU A;  2GG8 A;  4B28 A;  1BOA A;  1B59 A;  5CLS A;  3FM3 A;  5E5B A;  2EVM A;  2Q8K A;  3TAV A;  2NQ7 A;  1MAT A;  2HOW A;  5CDV A;  2GG9 A;  2GG2 A;  4S2T P;  4U6C A;  2DFI A;  3IU9 A;  1YW8 A;  4A6V A;  1XNZ A;  2BWX A;  1QZY A;  2BN7 A;  1XGN A;  2BB7 A;  4U6W A;  2GGB A;  4IKT A;  2BWU A;  2NQ6 A;  5CIK A;  4IKR A;  3PKC A;  4U71 A;  1CHM A;  4S00 A;  4ZWU A;  2P9A A;  2B3L A;  4ZNG A;  3TB5 A;  1Y1N A;  5D6E A;  4FKC A;  3L7G A;  3CTZ A;  2BWT A;  4U6Z A;  4RZZ A;  1WLR A;  1YVM A;  4U73 A;  1PV9 A;  2BWW A;  2Q93 A;  1KQ9 A;  3PKB A;  1R5H A;  4ZWO A;  4IF7 A;  1C21 A;  2EVC A;  2GU5 A;  1WN1 A;  1M35 A;  3IU8 A;  3IU7 A;  4A6W A;  2BHD A;  5JI6 A;  1KP0 A;  3BIP A;  3MAT A;  1WKM A;  4U6E A;  4IKU A;  2GGC A;  1JAW A;  4HXX A;  4IDY A;  3FMQ A;  1O0X A;  4FLI A;  4S01 A;  5CNX A;  1A16 A;  4S2R P;  3L24 A;  4ZWP A;  1YJ3 A;  1YW9 A;  2BH3 A;  2EA2 A;  3BIT A;  4U6J A;  2V6C A;  2GU6 A;  3FMR A;  3MX6 A;  2GA2 A;  3ROR A;  2GG5 A;  2Q96 A;  4FO7 A;  5D6F A;  1C23 A;  3Q6D A;  4MAT A;  4U69 A;  1R5G A;  1KQ0 A;  4FLK A;  5CDE A;  1XGM A;  1C27 A;  4IEC A;  2GG7 A;  4OOK A;  4RZY A;  2BHC A;  2OAZ A;  1QXZ A;  5JFR A;  4RGZ 1;  2GTX A;  4R60 A;  3MR1 A;  2GU4 A;  2GZ5 A;  2BHA A;  2B3K A;  2Q92 A;  1YW7 A;  2B3H A;  2BWY A;  2EVO A;  3PKE A;  1WL9 A;  2P98 A;  4FUK A;  2BWS A;  4Z7M A;  2GG0 A;  1R58 A;  1QXW A;  2GG3 A;  3IG4 A;  4U76 A;  4EGE A;  2IW2 A;  2ZSG A;  2V3X A;  4PNC A;  2G6P A;  3D27 A;  1WBQ A;  2EA4 A;  1XGO A;  1QXY A;  1WL6 A;  3S6B A;  3CB5 A;  1C24 A;  3CB6 A;  4KM3 A;  3RVA A;  2MAT A;  5FCH A;  5CE6 A;  1WY2 A;  4QR8 A;  2OKN A;  2V3Z A;  4FO8 A;  2BWV A;  1N51 A;  2Q95 A;  4JUQ A;  4FLJ A;  1B6A A;  2GU7 A;  5JHU A;  1XGS A;  4U1B A; 
#chains in the Genus database with same CATH homology
 4IU6 A;  3PKA A;  4U70 A;  3BIQ A;  4FLL A;  4PV4 A;  1C22 A;  4IKS A;  1W2M A;  5FCF A;  5CDL A;  3PKD A;  2BHB A;  1W7V A;  2Q94 A;  4IPA A;  4U75 A;  1BN5 A;  2P99 A;  2V3Y A;  2ADU A;  2GG8 A;  4B28 A;  1BOA A;  1B59 A;  5CLS A;  3FM3 A;  5E5B A;  2EVM A;  2Q8K A;  3TAV A;  2NQ7 A;  1MAT A;  2HOW A;  5CDV A;  2GG9 A;  2GG2 A;  4S2T P;  4U6C A;  2DFI A;  3IU9 A;  1YW8 A;  4A6V A;  1XNZ A;  2BWX A;  1QZY A;  2BN7 A;  1XGN A;  2BB7 A;  4U6W A;  2GGB A;  4IKT A;  2BWU A;  2NQ6 A;  5CIK A;  4IKR A;  3PKC A;  4U71 A;  1CHM A;  4S00 A;  4ZWU A;  2P9A A;  2B3L A;  4ZNG A;  3TB5 A;  1Y1N A;  5D6E A;  4FKC A;  3L7G A;  3CTZ A;  2BWT A;  4U6Z A;  4RZZ A;  1WLR A;  1YVM A;  4U73 A;  1PV9 A;  2BWW A;  2Q93 A;  1KQ9 A;  3PKB A;  1R5H A;  4ZWO A;  4IF7 A;  1C21 A;  2EVC A;  2GU5 A;  1WN1 A;  1M35 A;  3IU8 A;  3IU7 A;  4A6W A;  2BHD A;  5JI6 A;  1KP0 A;  3BIP A;  3MAT A;  1WKM A;  4U6E A;  4IKU A;  2GGC A;  1JAW A;  4HXX A;  4IDY A;  3FMQ A;  1O0X A;  4FLI A;  4S01 A;  5CNX A;  1A16 A;  4S2R P;  3L24 A;  4ZWP A;  1YJ3 A;  1YW9 A;  2BH3 A;  2EA2 A;  3BIT A;  4U6J A;  2V6C A;  2GU6 A;  3FMR A;  3MX6 A;  2GA2 A;  3ROR A;  2GG5 A;  2Q96 A;  4FO7 A;  5D6F A;  1C23 A;  3Q6D A;  4MAT A;  4U69 A;  1R5G A;  1KQ0 A;  4FLK A;  5CDE A;  1XGM A;  1C27 A;  4IEC A;  2GG7 A;  4OOK A;  4RZY A;  2BHC A;  2OAZ A;  1QXZ A;  5JFR A;  4RGZ 1;  2GTX A;  4R60 A;  3MR1 A;  2GU4 A;  2GZ5 A;  2BHA A;  2B3K A;  2Q92 A;  1YW7 A;  2B3H A;  2BWY A;  2EVO A;  3PKE A;  1WL9 A;  2P98 A;  4FUK A;  2BWS A;  4Z7M A;  2GG0 A;  1R58 A;  1QXW A;  2GG3 A;  3IG4 A;  4U76 A;  4EGE A;  2IW2 A;  2ZSG A;  2V3X A;  4PNC A;  2G6P A;  3D27 A;  1WBQ A;  2EA4 A;  1XGO A;  1QXY A;  1WL6 A;  3S6B A;  3CB5 A;  1C24 A;  3CB6 A;  4KM3 A;  3RVA A;  2MAT A;  5FCH A;  5CE6 A;  1WY2 A;  4QR8 A;  2OKN A;  2V3Z A;  4FO8 A;  2BWV A;  1N51 A;  2Q95 A;  4JUQ A;  4FLJ A;  1B6A A;  2GU7 A;  5JHU A;  1XGS A;  4U1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...