2NQ7A

Crystal structure of type 1 human methionine aminopeptidase in complex with 3-(2,2-dimethylpropionylamino)pyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq7A00
1YW8A 5JI6A 2BH3A 2GG9A 2GG5A 2HOWA 2OKNA 4IKUA 5D6FA 5FCFA 2Q95A 4FLLA 2BWXA 1WLRA 2MATA 1C23A 2Q92A 4PNCA 2Q8KA 4ZWPA 4FUKA 4RZZA 1XGSA 2V3XA 1KP0A 1YW9A 2GA2A 2P99A 2Q93A 2BHAA 4U69A 5CIKA 1C22A 3MATA 1A16A 2BHBA 1W2MA 3BIQA 1WN1A 1QXYA 3BIPA 4IF7A 3FMQA 1B6AA 3TB5A 2Q96A 4MATA 1BN5A 3IG4A 2GG3A 1C27A 4S00A 4ZWOA 4RZYA 2V6CA 2EVMA 3CB5A 1C21A 4FLIA 3CB6A 2EA2A 3PKCA 4U71A 1WL9A 3IU8A 2GG7A 4PV4A 4IKSA 1M35A 4FLKA 5CDVA 2BWYA 4IDYA 2GG0A 4U70A 4RGZ1 1YJ3A 3S6BA 2NQ6A 2BWSA 2GU5A 4FO8A 4QR8A 1B59A 2BWTA 1W7VA 4FO7A 4U6JA 4U6WA 1CHMA 2G6PA 5D6EA 3RVAA 4EGEA 3RORA 1C24A 5FCHA 2EA4A 3D27A 3MX6A 1QXZA 2ADUA 4IU6A 2GZ5A 1QZYA 4U1BA 1MATA 1WKMA 5CDEA 1KQ0A 1YW7A 4S01A 3PKEA 4IECA 1XGMA 2GU7A 1WBQA 2BWUA 4KM3A 4Z7MA 1O0XA 1WL6A 1XNZA 3MR1A 4JUQA 4U6CA 4IKTA 1KQ9A 2P98A 1PV9A 1R58A 4U76A 2GG2A 3PKDA 4S2TP 1WY2A 2DFIA 2BHCA 2BWWA 3PKBA 1QXWA 3TAVA 4U6EA 2GG8A 3FM3A 4FLJA 2BWVA 5JFRA 1R5HA 1XGOA 4R60A 1XGNA 3IU7A 1R5GA 3PKAA 2P9AA 1Y1NA 3IU9A 4OOKA 4A6VA 4A6WA 2GGBA 2NQ7A 2ZSGA 3CTZA 2EVCA 5E5BA 3FMRA 4B28A 2GU4A 4FKCA 3Q6DA 1BOAA 2B3HA 2OAZA 1JAWA 4S2RP 2EVOA 1N51A 4ZWUA 2Q94A 4HXXA 5CE6A 2BHDA 2IW2A 4ZNGA 5CNXA 4U6ZA 2GTXA 5JHUA 1YVMA 4IKRA 2BN7A 2B3LA 4IPAA 2GGCA 5CLSA 5CDLA 3L7GA 4U73A 2B3KA 2V3ZA 2V3YA 3BITA 2BB7A 2GU6A 4U75A 3L24A
chains in the Genus database with same CATH superfamily
1YW8A 5JI6A 2BH3A 2GG9A 2GG5A 2HOWA 2OKNA 4IKUA 5D6FA 5FCFA 2Q95A 4FLLA 2BWXA 1WLRA 2MATA 1C23A 2Q92A 4PNCA 2Q8KA 4ZWPA 4FUKA 4RZZA 1XGSA 2V3XA 1KP0A 1YW9A 2GA2A 2P99A 2Q93A 2BHAA 4U69A 5CIKA 1C22A 3MATA 1A16A 2BHBA 1W2MA 3BIQA 1WN1A 1QXYA 3BIPA 4IF7A 3FMQA 1B6AA 3TB5A 2Q96A 4MATA 1BN5A 3IG4A 2GG3A 1C27A 4S00A 4ZWOA 4RZYA 2V6CA 2EVMA 3CB5A 1C21A 4FLIA 3CB6A 2EA2A 3PKCA 4U71A 1WL9A 3IU8A 2GG7A 4PV4A 4IKSA 1M35A 4FLKA 5CDVA 2BWYA 4IDYA 2GG0A 4U70A 4RGZ1 1YJ3A 3S6BA 2NQ6A 2BWSA 2GU5A 4FO8A 4QR8A 1B59A 2BWTA 1W7VA 4FO7A 4U6JA 4U6WA 1CHMA 2G6PA 5D6EA 3RVAA 4EGEA 3RORA 1C24A 5FCHA 2EA4A 3D27A 3MX6A 1QXZA 2ADUA 4IU6A 2GZ5A 1QZYA 4U1BA 1MATA 1WKMA 5CDEA 1KQ0A 1YW7A 4S01A 3PKEA 4IECA 1XGMA 2GU7A 1WBQA 2BWUA 4KM3A 4Z7MA 1O0XA 1WL6A 1XNZA 3MR1A 4JUQA 4U6CA 4IKTA 1KQ9A 2P98A 1PV9A 1R58A 4U76A 2GG2A 3PKDA 4S2TP 1WY2A 2DFIA 2BHCA 2BWWA 3PKBA 1QXWA 3TAVA 4U6EA 2GG8A 3FM3A 4FLJA 2BWVA 5JFRA 1R5HA 1XGOA 4R60A 1XGNA 3IU7A 1R5GA 3PKAA 2P9AA 1Y1NA 3IU9A 4OOKA 4A6VA 4A6WA 2GGBA 2NQ7A 2ZSGA 3CTZA 2EVCA 5E5BA 3FMRA 4B28A 2GU4A 4FKCA 3Q6DA 1BOAA 2B3HA 2OAZA 1JAWA 4S2RP 2EVOA 1N51A 4ZWUA 2Q94A 4HXXA 5CE6A 2BHDA 2IW2A 4ZNGA 5CNXA 4U6ZA 2GTXA 5JHUA 1YVMA 4IKRA 2BN7A 2B3LA 4IPAA 2GGCA 5CLSA 5CDLA 3L7GA 4U73A 2B3KA 2V3ZA 2V3YA 3BITA 2BB7A 2GU6A 4U75A 3L24A
chains in the Genus database with same CATH topology
1YW8A 5JI6A 2BH3A 2GG9A 2GG5A 2HOWA 2OKNA 4IKUA 5D6FA 5FCFA 2Q95A 4FLLA 2BWXA 1WLRA 2MATA 1C23A 2Q92A 4PNCA 2Q8KA 4ZWPA 4FUKA 4RZZA 1XGSA 2V3XA 1KP0A 1YW9A 2GA2A 2P99A 2Q93A 2BHAA 4U69A 5CIKA 1C22A 3MATA 1A16A 2BHBA 1W2MA 3BIQA 1WN1A 1QXYA 3BIPA 4IF7A 3FMQA 1B6AA 3TB5A 2Q96A 4MATA 1BN5A 3IG4A 2GG3A 1C27A 4S00A 4ZWOA 4RZYA 2V6CA 2EVMA 3CB5A 1C21A 4FLIA 3CB6A 2EA2A 3PKCA 4U71A 1WL9A 3IU8A 2GG7A 4PV4A 4IKSA 1M35A 4FLKA 5CDVA 2BWYA 4IDYA 2GG0A 4U70A 4RGZ1 1YJ3A 3S6BA 2NQ6A 2BWSA 2GU5A 4FO8A 4QR8A 1B59A 2BWTA 1W7VA 4FO7A 4U6JA 4U6WA 1CHMA 2G6PA 5D6EA 3RVAA 4EGEA 3RORA 1C24A 5FCHA 2EA4A 3D27A 3MX6A 1QXZA 2ADUA 4IU6A 2GZ5A 1QZYA 4U1BA 1MATA 1WKMA 5CDEA 1KQ0A 1YW7A 4S01A 3PKEA 4IECA 1XGMA 2GU7A 1WBQA 2BWUA 4KM3A 4Z7MA 1O0XA 1WL6A 1XNZA 3MR1A 4JUQA 4U6CA 4IKTA 1KQ9A 2P98A 1PV9A 1R58A 4U76A 2GG2A 3PKDA 4S2TP 1WY2A 2DFIA 2BHCA 2BWWA 3PKBA 1QXWA 3TAVA 4U6EA 2GG8A 3FM3A 4FLJA 2BWVA 5JFRA 1R5HA 1XGOA 4R60A 1XGNA 3IU7A 1R5GA 3PKAA 2P9AA 1Y1NA 3IU9A 4OOKA 4A6VA 4A6WA 2GGBA 2NQ7A 2ZSGA 3CTZA 2EVCA 5E5BA 3FMRA 4B28A 2GU4A 4FKCA 3Q6DA 1BOAA 2B3HA 2OAZA 1JAWA 4S2RP 2EVOA 1N51A 4ZWUA 2Q94A 4HXXA 5CE6A 2BHDA 2IW2A 4ZNGA 5CNXA 4U6ZA 2GTXA 5JHUA 1YVMA 4IKRA 2BN7A 2B3LA 4IPAA 2GGCA 5CLSA 5CDLA 3L7GA 4U73A 2B3KA 2V3ZA 2V3YA 3BITA 2BB7A 2GU6A 4U75A 3L24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW8 A;  5JI6 A;  2BH3 A;  2GG9 A;  2GG5 A;  2HOW A;  2OKN A;  4IKU A;  5D6F A;  5FCF A;  2Q95 A;  4FLL A;  2BWX A;  1WLR A;  2MAT A;  1C23 A;  2Q92 A;  4PNC A;  2Q8K A;  4ZWP A;  4FUK A;  4RZZ A;  1XGS A;  2V3X A;  1KP0 A;  1YW9 A;  2GA2 A;  2P99 A;  2Q93 A;  2BHA A;  4U69 A;  5CIK A;  1C22 A;  3MAT A;  1A16 A;  2BHB A;  1W2M A;  3BIQ A;  1WN1 A;  1QXY A;  3BIP A;  4IF7 A;  3FMQ A;  1B6A A;  3TB5 A;  2Q96 A;  4MAT A;  1BN5 A;  3IG4 A;  2GG3 A;  1C27 A;  4S00 A;  4ZWO A;  4RZY A;  2V6C A;  2EVM A;  3CB5 A;  1C21 A;  4FLI A;  3CB6 A;  2EA2 A;  3PKC A;  4U71 A;  1WL9 A;  3IU8 A;  2GG7 A;  4PV4 A;  4IKS A;  1M35 A;  4FLK A;  5CDV A;  2BWY A;  4IDY A;  2GG0 A;  4U70 A;  4RGZ 1;  1YJ3 A;  3S6B A;  2NQ6 A;  2BWS A;  2GU5 A;  4FO8 A;  4QR8 A;  1B59 A;  2BWT A;  1W7V A;  4FO7 A;  4U6J A;  4U6W A;  1CHM A;  2G6P A;  5D6E A;  3RVA A;  4EGE A;  3ROR A;  1C24 A;  5FCH A;  2EA4 A;  3D27 A;  3MX6 A;  1QXZ A;  2ADU A;  4IU6 A;  2GZ5 A;  1QZY A;  4U1B A;  1MAT A;  1WKM A;  5CDE A;  1KQ0 A;  1YW7 A;  4S01 A;  3PKE A;  4IEC A;  1XGM A;  2GU7 A;  1WBQ A;  2BWU A;  4KM3 A;  4Z7M A;  1O0X A;  1WL6 A;  1XNZ A;  3MR1 A;  4JUQ A;  4U6C A;  4IKT A;  1KQ9 A;  2P98 A;  1PV9 A;  1R58 A;  4U76 A;  2GG2 A;  3PKD A;  4S2T P;  1WY2 A;  2DFI A;  2BHC A;  2BWW A;  3PKB A;  1QXW A;  3TAV A;  4U6E A;  2GG8 A;  3FM3 A;  4FLJ A;  2BWV A;  5JFR A;  1R5H A;  1XGO A;  4R60 A;  1XGN A;  3IU7 A;  1R5G A;  3PKA A;  2P9A A;  1Y1N A;  3IU9 A;  4OOK A;  4A6V A;  4A6W A;  2GGB A;  2NQ7 A;  2ZSG A;  3CTZ A;  2EVC A;  5E5B A;  3FMR A;  4B28 A;  2GU4 A;  4FKC A;  3Q6D A;  1BOA A;  2B3H A;  2OAZ A;  1JAW A;  4S2R P;  2EVO A;  1N51 A;  4ZWU A;  2Q94 A;  4HXX A;  5CE6 A;  2BHD A;  2IW2 A;  4ZNG A;  5CNX A;  4U6Z A;  2GTX A;  5JHU A;  1YVM A;  4IKR A;  2BN7 A;  2B3L A;  4IPA A;  2GGC A;  5CLS A;  5CDL A;  3L7G A;  4U73 A;  2B3K A;  2V3Z A;  2V3Y A;  3BIT A;  2BB7 A;  2GU6 A;  4U75 A;  3L24 A; 
#chains in the Genus database with same CATH topology
 1YW8 A;  5JI6 A;  2BH3 A;  2GG9 A;  2GG5 A;  2HOW A;  2OKN A;  4IKU A;  5D6F A;  5FCF A;  2Q95 A;  4FLL A;  2BWX A;  1WLR A;  2MAT A;  1C23 A;  2Q92 A;  4PNC A;  2Q8K A;  4ZWP A;  4FUK A;  4RZZ A;  1XGS A;  2V3X A;  1KP0 A;  1YW9 A;  2GA2 A;  2P99 A;  2Q93 A;  2BHA A;  4U69 A;  5CIK A;  1C22 A;  3MAT A;  1A16 A;  2BHB A;  1W2M A;  3BIQ A;  1WN1 A;  1QXY A;  3BIP A;  4IF7 A;  3FMQ A;  1B6A A;  3TB5 A;  2Q96 A;  4MAT A;  1BN5 A;  3IG4 A;  2GG3 A;  1C27 A;  4S00 A;  4ZWO A;  4RZY A;  2V6C A;  2EVM A;  3CB5 A;  1C21 A;  4FLI A;  3CB6 A;  2EA2 A;  3PKC A;  4U71 A;  1WL9 A;  3IU8 A;  2GG7 A;  4PV4 A;  4IKS A;  1M35 A;  4FLK A;  5CDV A;  2BWY A;  4IDY A;  2GG0 A;  4U70 A;  4RGZ 1;  1YJ3 A;  3S6B A;  2NQ6 A;  2BWS A;  2GU5 A;  4FO8 A;  4QR8 A;  1B59 A;  2BWT A;  1W7V A;  4FO7 A;  4U6J A;  4U6W A;  1CHM A;  2G6P A;  5D6E A;  3RVA A;  4EGE A;  3ROR A;  1C24 A;  5FCH A;  2EA4 A;  3D27 A;  3MX6 A;  1QXZ A;  2ADU A;  4IU6 A;  2GZ5 A;  1QZY A;  4U1B A;  1MAT A;  1WKM A;  5CDE A;  1KQ0 A;  1YW7 A;  4S01 A;  3PKE A;  4IEC A;  1XGM A;  2GU7 A;  1WBQ A;  2BWU A;  4KM3 A;  4Z7M A;  1O0X A;  1WL6 A;  1XNZ A;  3MR1 A;  4JUQ A;  4U6C A;  4IKT A;  1KQ9 A;  2P98 A;  1PV9 A;  1R58 A;  4U76 A;  2GG2 A;  3PKD A;  4S2T P;  1WY2 A;  2DFI A;  2BHC A;  2BWW A;  3PKB A;  1QXW A;  3TAV A;  4U6E A;  2GG8 A;  3FM3 A;  4FLJ A;  2BWV A;  5JFR A;  1R5H A;  1XGO A;  4R60 A;  1XGN A;  3IU7 A;  1R5G A;  3PKA A;  2P9A A;  1Y1N A;  3IU9 A;  4OOK A;  4A6V A;  4A6W A;  2GGB A;  2NQ7 A;  2ZSG A;  3CTZ A;  2EVC A;  5E5B A;  3FMR A;  4B28 A;  2GU4 A;  4FKC A;  3Q6D A;  1BOA A;  2B3H A;  2OAZ A;  1JAW A;  4S2R P;  2EVO A;  1N51 A;  4ZWU A;  2Q94 A;  4HXX A;  5CE6 A;  2BHD A;  2IW2 A;  4ZNG A;  5CNX A;  4U6Z A;  2GTX A;  5JHU A;  1YVM A;  4IKR A;  2BN7 A;  2B3L A;  4IPA A;  2GGC A;  5CLS A;  5CDL A;  3L7G A;  4U73 A;  2B3K A;  2V3Z A;  2V3Y A;  3BIT A;  2BB7 A;  2GU6 A;  4U75 A;  3L24 A; 
#chains in the Genus database with same CATH homology
 1YW8 A;  5JI6 A;  2BH3 A;  2GG9 A;  2GG5 A;  2HOW A;  2OKN A;  4IKU A;  5D6F A;  5FCF A;  2Q95 A;  4FLL A;  2BWX A;  1WLR A;  2MAT A;  1C23 A;  2Q92 A;  4PNC A;  2Q8K A;  4ZWP A;  4FUK A;  4RZZ A;  1XGS A;  2V3X A;  1KP0 A;  1YW9 A;  2GA2 A;  2P99 A;  2Q93 A;  2BHA A;  4U69 A;  5CIK A;  1C22 A;  3MAT A;  1A16 A;  2BHB A;  1W2M A;  3BIQ A;  1WN1 A;  1QXY A;  3BIP A;  4IF7 A;  3FMQ A;  1B6A A;  3TB5 A;  2Q96 A;  4MAT A;  1BN5 A;  3IG4 A;  2GG3 A;  1C27 A;  4S00 A;  4ZWO A;  4RZY A;  2V6C A;  2EVM A;  3CB5 A;  1C21 A;  4FLI A;  3CB6 A;  2EA2 A;  3PKC A;  4U71 A;  1WL9 A;  3IU8 A;  2GG7 A;  4PV4 A;  4IKS A;  1M35 A;  4FLK A;  5CDV A;  2BWY A;  4IDY A;  2GG0 A;  4U70 A;  4RGZ 1;  1YJ3 A;  3S6B A;  2NQ6 A;  2BWS A;  2GU5 A;  4FO8 A;  4QR8 A;  1B59 A;  2BWT A;  1W7V A;  4FO7 A;  4U6J A;  4U6W A;  1CHM A;  2G6P A;  5D6E A;  3RVA A;  4EGE A;  3ROR A;  1C24 A;  5FCH A;  2EA4 A;  3D27 A;  3MX6 A;  1QXZ A;  2ADU A;  4IU6 A;  2GZ5 A;  1QZY A;  4U1B A;  1MAT A;  1WKM A;  5CDE A;  1KQ0 A;  1YW7 A;  4S01 A;  3PKE A;  4IEC A;  1XGM A;  2GU7 A;  1WBQ A;  2BWU A;  4KM3 A;  4Z7M A;  1O0X A;  1WL6 A;  1XNZ A;  3MR1 A;  4JUQ A;  4U6C A;  4IKT A;  1KQ9 A;  2P98 A;  1PV9 A;  1R58 A;  4U76 A;  2GG2 A;  3PKD A;  4S2T P;  1WY2 A;  2DFI A;  2BHC A;  2BWW A;  3PKB A;  1QXW A;  3TAV A;  4U6E A;  2GG8 A;  3FM3 A;  4FLJ A;  2BWV A;  5JFR A;  1R5H A;  1XGO A;  4R60 A;  1XGN A;  3IU7 A;  1R5G A;  3PKA A;  2P9A A;  1Y1N A;  3IU9 A;  4OOK A;  4A6V A;  4A6W A;  2GGB A;  2NQ7 A;  2ZSG A;  3CTZ A;  2EVC A;  5E5B A;  3FMR A;  4B28 A;  2GU4 A;  4FKC A;  3Q6D A;  1BOA A;  2B3H A;  2OAZ A;  1JAW A;  4S2R P;  2EVO A;  1N51 A;  4ZWU A;  2Q94 A;  4HXX A;  5CE6 A;  2BHD A;  2IW2 A;  4ZNG A;  5CNX A;  4U6Z A;  2GTX A;  5JHU A;  1YVM A;  4IKR A;  2BN7 A;  2B3L A;  4IPA A;  2GGC A;  5CLS A;  5CDL A;  3L7G A;  4U73 A;  2B3K A;  2V3Z A;  2V3Y A;  3BIT A;  2BB7 A;  2GU6 A;  4U75 A;  3L24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...