2NQ7A

Crystal structure of type 1 human methionine aminopeptidase in complex with 3-(2,2-dimethylpropionylamino)pyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq7A00
1WBQA 4FUKA 1BN5A 2OKNA 1QXZA 5D6FA 4B28A 4FO7A 4FO8A 1XGNA 1YVMA 1XGMA 4IF7A 1XNZA 2EA2A 2GZ5A 1KQ0A 1M35A 4FLJA 1MATA 2GG9A 1QXYA 4HXXA 3IG4A 2GTXA 5CE6A 1PV9A 3CB6A 4U6CA 5JFRA 1R5HA 5E5BA 5CLSA 4U75A 2BWUA 1C24A 3FMRA 3IU7A 1YJ3A 3MX6A 4ZWUA 1YW8A 1QXWA 4A6WA 3BIPA 1WL6A 4S00A 2DFIA 1YW9A 2EVCA 2BHAA 4U6JA 1C21A 2BWVA 2BWSA 1A16A 1B59A 4IKSA 2MATA 2Q95A 2GA2A 4KM3A 2BHDA 5FCHA 4MATA 2HOWA 5CDLA 4U71A 2B3HA 4JUQA 4EGEA 4U76A 4OOKA 4IDYA 4S2TP 4IPAA 1Y1NA 4ZNGA 2BHBA 2GG7A 3PKAA 4ZWOA 3TAVA 1R58A 2IW2A 2EA4A 4IKTA 4U69A 3S6BA 2GGBA 2BWYA 4IKUA 4U1BA 2V3XA 3CTZA 4PV4A 2B3LA 1C22A 1JAWA 2OAZA 1WLRA 1C23A 2GG0A 4RZZA 3IU8A 2NQ7A 5D6EA 2G6PA 1R5GA 4RGZ1 1W2MA 2BWTA 2P99A 3MATA 2Q8KA 2GG8A 2GU5A 2GU6A 5CDVA 1O0XA 2P9AA 4S01A 3CB5A 2B3KA 2V3ZA 3L24A 1WKMA 4FLKA 5JI6A 4ZWPA 2BWXA 3TB5A 2EVOA 2NQ6A 4U70A 1KP0A 3FMQA 5JHUA 2V6CA 2BHCA 2BWWA 4A6VA 3PKCA 3FM3A 2EVMA 3D27A 5CNXA 3RVAA 5CDEA 2GU7A 3PKEA 2V3YA 3BITA 5CIKA 1YW7A 2Q93A 2Q92A 4U6ZA 1XGSA 4S2RP 4Z7MA 4U6EA 1C27A 4QR8A 1CHMA 2GG3A 2GU4A 1QZYA 3L7GA 5FCFA 3PKDA 1WN1A 3IU9A 4FLIA 1N51A 4FLLA 2ZSGA 1BOAA 3Q6DA 2BB7A 4IU6A 2GGCA 4PNCA 4RZYA 1WY2A 4FKCA 2Q96A 2GG2A 2P98A 2Q94A 4IKRA 3PKBA 1XGOA 3BIQA 4U6WA 2BN7A 1B6AA 2BH3A 2GG5A 4R60A 1W7VA 3RORA 2ADUA 4U73A 1KQ9A 1WL9A 4IECA 3MR1A
chains in the Genus database with same CATH superfamily
1WBQA 4FUKA 1BN5A 2OKNA 1QXZA 5D6FA 4B28A 4FO7A 4FO8A 1XGNA 1YVMA 1XGMA 4IF7A 1XNZA 2EA2A 2GZ5A 1KQ0A 1M35A 4FLJA 1MATA 2GG9A 1QXYA 4HXXA 3IG4A 2GTXA 5CE6A 1PV9A 3CB6A 4U6CA 5JFRA 1R5HA 5E5BA 5CLSA 4U75A 2BWUA 1C24A 3FMRA 3IU7A 1YJ3A 3MX6A 4ZWUA 1YW8A 1QXWA 4A6WA 3BIPA 1WL6A 4S00A 2DFIA 1YW9A 2EVCA 2BHAA 4U6JA 1C21A 2BWVA 2BWSA 1A16A 1B59A 4IKSA 2MATA 2Q95A 2GA2A 4KM3A 2BHDA 5FCHA 4MATA 2HOWA 5CDLA 4U71A 2B3HA 4JUQA 4EGEA 4U76A 4OOKA 4IDYA 4S2TP 4IPAA 1Y1NA 4ZNGA 2BHBA 2GG7A 3PKAA 4ZWOA 3TAVA 1R58A 2IW2A 2EA4A 4IKTA 4U69A 3S6BA 2GGBA 2BWYA 4IKUA 4U1BA 2V3XA 3CTZA 4PV4A 2B3LA 1C22A 1JAWA 2OAZA 1WLRA 1C23A 2GG0A 4RZZA 3IU8A 2NQ7A 5D6EA 2G6PA 1R5GA 4RGZ1 1W2MA 2BWTA 2P99A 3MATA 2Q8KA 2GG8A 2GU5A 2GU6A 5CDVA 1O0XA 2P9AA 4S01A 3CB5A 2B3KA 2V3ZA 3L24A 1WKMA 4FLKA 5JI6A 4ZWPA 2BWXA 3TB5A 2EVOA 2NQ6A 4U70A 1KP0A 3FMQA 5JHUA 2V6CA 2BHCA 2BWWA 4A6VA 3PKCA 3FM3A 2EVMA 3D27A 5CNXA 3RVAA 5CDEA 2GU7A 3PKEA 2V3YA 3BITA 5CIKA 1YW7A 2Q93A 2Q92A 4U6ZA 1XGSA 4S2RP 4Z7MA 4U6EA 1C27A 4QR8A 1CHMA 2GG3A 2GU4A 1QZYA 3L7GA 5FCFA 3PKDA 1WN1A 3IU9A 4FLIA 1N51A 4FLLA 2ZSGA 1BOAA 3Q6DA 2BB7A 4IU6A 2GGCA 4PNCA 4RZYA 1WY2A 4FKCA 2Q96A 2GG2A 2P98A 2Q94A 4IKRA 3PKBA 1XGOA 3BIQA 4U6WA 2BN7A 1B6AA 2BH3A 2GG5A 4R60A 1W7VA 3RORA 2ADUA 4U73A 1KQ9A 1WL9A 4IECA 3MR1A
chains in the Genus database with same CATH topology
1WBQA 4FUKA 1BN5A 2OKNA 1QXZA 5D6FA 4B28A 4FO7A 4FO8A 1XGNA 1YVMA 1XGMA 4IF7A 1XNZA 2EA2A 2GZ5A 1KQ0A 1M35A 4FLJA 1MATA 2GG9A 1QXYA 4HXXA 3IG4A 2GTXA 5CE6A 1PV9A 3CB6A 4U6CA 5JFRA 1R5HA 5E5BA 5CLSA 4U75A 2BWUA 1C24A 3FMRA 3IU7A 1YJ3A 3MX6A 4ZWUA 1YW8A 1QXWA 4A6WA 3BIPA 1WL6A 4S00A 2DFIA 1YW9A 2EVCA 2BHAA 4U6JA 1C21A 2BWVA 2BWSA 1A16A 1B59A 4IKSA 2MATA 2Q95A 2GA2A 4KM3A 2BHDA 5FCHA 4MATA 2HOWA 5CDLA 4U71A 2B3HA 4JUQA 4EGEA 4U76A 4OOKA 4IDYA 4S2TP 4IPAA 1Y1NA 4ZNGA 2BHBA 2GG7A 3PKAA 4ZWOA 3TAVA 1R58A 2IW2A 2EA4A 4IKTA 4U69A 3S6BA 2GGBA 2BWYA 4IKUA 4U1BA 2V3XA 3CTZA 4PV4A 2B3LA 1C22A 1JAWA 2OAZA 1WLRA 1C23A 2GG0A 4RZZA 3IU8A 2NQ7A 5D6EA 2G6PA 1R5GA 4RGZ1 1W2MA 2BWTA 2P99A 3MATA 2Q8KA 2GG8A 2GU5A 2GU6A 5CDVA 1O0XA 2P9AA 4S01A 3CB5A 2B3KA 2V3ZA 3L24A 1WKMA 4FLKA 5JI6A 4ZWPA 2BWXA 3TB5A 2EVOA 2NQ6A 4U70A 1KP0A 3FMQA 5JHUA 2V6CA 2BHCA 2BWWA 4A6VA 3PKCA 3FM3A 2EVMA 3D27A 5CNXA 3RVAA 5CDEA 2GU7A 3PKEA 2V3YA 3BITA 5CIKA 1YW7A 2Q93A 2Q92A 4U6ZA 1XGSA 4S2RP 4Z7MA 4U6EA 1C27A 4QR8A 1CHMA 2GG3A 2GU4A 1QZYA 3L7GA 5FCFA 3PKDA 1WN1A 3IU9A 4FLIA 1N51A 4FLLA 2ZSGA 1BOAA 3Q6DA 2BB7A 4IU6A 2GGCA 4PNCA 4RZYA 1WY2A 4FKCA 2Q96A 2GG2A 2P98A 2Q94A 4IKRA 3PKBA 1XGOA 3BIQA 4U6WA 2BN7A 1B6AA 2BH3A 2GG5A 4R60A 1W7VA 3RORA 2ADUA 4U73A 1KQ9A 1WL9A 4IECA 3MR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WBQ A;  4FUK A;  1BN5 A;  2OKN A;  1QXZ A;  5D6F A;  4B28 A;  4FO7 A;  4FO8 A;  1XGN A;  1YVM A;  1XGM A;  4IF7 A;  1XNZ A;  2EA2 A;  2GZ5 A;  1KQ0 A;  1M35 A;  4FLJ A;  1MAT A;  2GG9 A;  1QXY A;  4HXX A;  3IG4 A;  2GTX A;  5CE6 A;  1PV9 A;  3CB6 A;  4U6C A;  5JFR A;  1R5H A;  5E5B A;  5CLS A;  4U75 A;  2BWU A;  1C24 A;  3FMR A;  3IU7 A;  1YJ3 A;  3MX6 A;  4ZWU A;  1YW8 A;  1QXW A;  4A6W A;  3BIP A;  1WL6 A;  4S00 A;  2DFI A;  1YW9 A;  2EVC A;  2BHA A;  4U6J A;  1C21 A;  2BWV A;  2BWS A;  1A16 A;  1B59 A;  4IKS A;  2MAT A;  2Q95 A;  2GA2 A;  4KM3 A;  2BHD A;  5FCH A;  4MAT A;  2HOW A;  5CDL A;  4U71 A;  2B3H A;  4JUQ A;  4EGE A;  4U76 A;  4OOK A;  4IDY A;  4S2T P;  4IPA A;  1Y1N A;  4ZNG A;  2BHB A;  2GG7 A;  3PKA A;  4ZWO A;  3TAV A;  1R58 A;  2IW2 A;  2EA4 A;  4IKT A;  4U69 A;  3S6B A;  2GGB A;  2BWY A;  4IKU A;  4U1B A;  2V3X A;  3CTZ A;  4PV4 A;  2B3L A;  1C22 A;  1JAW A;  2OAZ A;  1WLR A;  1C23 A;  2GG0 A;  4RZZ A;  3IU8 A;  2NQ7 A;  5D6E A;  2G6P A;  1R5G A;  4RGZ 1;  1W2M A;  2BWT A;  2P99 A;  3MAT A;  2Q8K A;  2GG8 A;  2GU5 A;  2GU6 A;  5CDV A;  1O0X A;  2P9A A;  4S01 A;  3CB5 A;  2B3K A;  2V3Z A;  3L24 A;  1WKM A;  4FLK A;  5JI6 A;  4ZWP A;  2BWX A;  3TB5 A;  2EVO A;  2NQ6 A;  4U70 A;  1KP0 A;  3FMQ A;  5JHU A;  2V6C A;  2BHC A;  2BWW A;  4A6V A;  3PKC A;  3FM3 A;  2EVM A;  3D27 A;  5CNX A;  3RVA A;  5CDE A;  2GU7 A;  3PKE A;  2V3Y A;  3BIT A;  5CIK A;  1YW7 A;  2Q93 A;  2Q92 A;  4U6Z A;  1XGS A;  4S2R P;  4Z7M A;  4U6E A;  1C27 A;  4QR8 A;  1CHM A;  2GG3 A;  2GU4 A;  1QZY A;  3L7G A;  5FCF A;  3PKD A;  1WN1 A;  3IU9 A;  4FLI A;  1N51 A;  4FLL A;  2ZSG A;  1BOA A;  3Q6D A;  2BB7 A;  4IU6 A;  2GGC A;  4PNC A;  4RZY A;  1WY2 A;  4FKC A;  2Q96 A;  2GG2 A;  2P98 A;  2Q94 A;  4IKR A;  3PKB A;  1XGO A;  3BIQ A;  4U6W A;  2BN7 A;  1B6A A;  2BH3 A;  2GG5 A;  4R60 A;  1W7V A;  3ROR A;  2ADU A;  4U73 A;  1KQ9 A;  1WL9 A;  4IEC A;  3MR1 A; 
#chains in the Genus database with same CATH topology
 1WBQ A;  4FUK A;  1BN5 A;  2OKN A;  1QXZ A;  5D6F A;  4B28 A;  4FO7 A;  4FO8 A;  1XGN A;  1YVM A;  1XGM A;  4IF7 A;  1XNZ A;  2EA2 A;  2GZ5 A;  1KQ0 A;  1M35 A;  4FLJ A;  1MAT A;  2GG9 A;  1QXY A;  4HXX A;  3IG4 A;  2GTX A;  5CE6 A;  1PV9 A;  3CB6 A;  4U6C A;  5JFR A;  1R5H A;  5E5B A;  5CLS A;  4U75 A;  2BWU A;  1C24 A;  3FMR A;  3IU7 A;  1YJ3 A;  3MX6 A;  4ZWU A;  1YW8 A;  1QXW A;  4A6W A;  3BIP A;  1WL6 A;  4S00 A;  2DFI A;  1YW9 A;  2EVC A;  2BHA A;  4U6J A;  1C21 A;  2BWV A;  2BWS A;  1A16 A;  1B59 A;  4IKS A;  2MAT A;  2Q95 A;  2GA2 A;  4KM3 A;  2BHD A;  5FCH A;  4MAT A;  2HOW A;  5CDL A;  4U71 A;  2B3H A;  4JUQ A;  4EGE A;  4U76 A;  4OOK A;  4IDY A;  4S2T P;  4IPA A;  1Y1N A;  4ZNG A;  2BHB A;  2GG7 A;  3PKA A;  4ZWO A;  3TAV A;  1R58 A;  2IW2 A;  2EA4 A;  4IKT A;  4U69 A;  3S6B A;  2GGB A;  2BWY A;  4IKU A;  4U1B A;  2V3X A;  3CTZ A;  4PV4 A;  2B3L A;  1C22 A;  1JAW A;  2OAZ A;  1WLR A;  1C23 A;  2GG0 A;  4RZZ A;  3IU8 A;  2NQ7 A;  5D6E A;  2G6P A;  1R5G A;  4RGZ 1;  1W2M A;  2BWT A;  2P99 A;  3MAT A;  2Q8K A;  2GG8 A;  2GU5 A;  2GU6 A;  5CDV A;  1O0X A;  2P9A A;  4S01 A;  3CB5 A;  2B3K A;  2V3Z A;  3L24 A;  1WKM A;  4FLK A;  5JI6 A;  4ZWP A;  2BWX A;  3TB5 A;  2EVO A;  2NQ6 A;  4U70 A;  1KP0 A;  3FMQ A;  5JHU A;  2V6C A;  2BHC A;  2BWW A;  4A6V A;  3PKC A;  3FM3 A;  2EVM A;  3D27 A;  5CNX A;  3RVA A;  5CDE A;  2GU7 A;  3PKE A;  2V3Y A;  3BIT A;  5CIK A;  1YW7 A;  2Q93 A;  2Q92 A;  4U6Z A;  1XGS A;  4S2R P;  4Z7M A;  4U6E A;  1C27 A;  4QR8 A;  1CHM A;  2GG3 A;  2GU4 A;  1QZY A;  3L7G A;  5FCF A;  3PKD A;  1WN1 A;  3IU9 A;  4FLI A;  1N51 A;  4FLL A;  2ZSG A;  1BOA A;  3Q6D A;  2BB7 A;  4IU6 A;  2GGC A;  4PNC A;  4RZY A;  1WY2 A;  4FKC A;  2Q96 A;  2GG2 A;  2P98 A;  2Q94 A;  4IKR A;  3PKB A;  1XGO A;  3BIQ A;  4U6W A;  2BN7 A;  1B6A A;  2BH3 A;  2GG5 A;  4R60 A;  1W7V A;  3ROR A;  2ADU A;  4U73 A;  1KQ9 A;  1WL9 A;  4IEC A;  3MR1 A; 
#chains in the Genus database with same CATH homology
 1WBQ A;  4FUK A;  1BN5 A;  2OKN A;  1QXZ A;  5D6F A;  4B28 A;  4FO7 A;  4FO8 A;  1XGN A;  1YVM A;  1XGM A;  4IF7 A;  1XNZ A;  2EA2 A;  2GZ5 A;  1KQ0 A;  1M35 A;  4FLJ A;  1MAT A;  2GG9 A;  1QXY A;  4HXX A;  3IG4 A;  2GTX A;  5CE6 A;  1PV9 A;  3CB6 A;  4U6C A;  5JFR A;  1R5H A;  5E5B A;  5CLS A;  4U75 A;  2BWU A;  1C24 A;  3FMR A;  3IU7 A;  1YJ3 A;  3MX6 A;  4ZWU A;  1YW8 A;  1QXW A;  4A6W A;  3BIP A;  1WL6 A;  4S00 A;  2DFI A;  1YW9 A;  2EVC A;  2BHA A;  4U6J A;  1C21 A;  2BWV A;  2BWS A;  1A16 A;  1B59 A;  4IKS A;  2MAT A;  2Q95 A;  2GA2 A;  4KM3 A;  2BHD A;  5FCH A;  4MAT A;  2HOW A;  5CDL A;  4U71 A;  2B3H A;  4JUQ A;  4EGE A;  4U76 A;  4OOK A;  4IDY A;  4S2T P;  4IPA A;  1Y1N A;  4ZNG A;  2BHB A;  2GG7 A;  3PKA A;  4ZWO A;  3TAV A;  1R58 A;  2IW2 A;  2EA4 A;  4IKT A;  4U69 A;  3S6B A;  2GGB A;  2BWY A;  4IKU A;  4U1B A;  2V3X A;  3CTZ A;  4PV4 A;  2B3L A;  1C22 A;  1JAW A;  2OAZ A;  1WLR A;  1C23 A;  2GG0 A;  4RZZ A;  3IU8 A;  2NQ7 A;  5D6E A;  2G6P A;  1R5G A;  4RGZ 1;  1W2M A;  2BWT A;  2P99 A;  3MAT A;  2Q8K A;  2GG8 A;  2GU5 A;  2GU6 A;  5CDV A;  1O0X A;  2P9A A;  4S01 A;  3CB5 A;  2B3K A;  2V3Z A;  3L24 A;  1WKM A;  4FLK A;  5JI6 A;  4ZWP A;  2BWX A;  3TB5 A;  2EVO A;  2NQ6 A;  4U70 A;  1KP0 A;  3FMQ A;  5JHU A;  2V6C A;  2BHC A;  2BWW A;  4A6V A;  3PKC A;  3FM3 A;  2EVM A;  3D27 A;  5CNX A;  3RVA A;  5CDE A;  2GU7 A;  3PKE A;  2V3Y A;  3BIT A;  5CIK A;  1YW7 A;  2Q93 A;  2Q92 A;  4U6Z A;  1XGS A;  4S2R P;  4Z7M A;  4U6E A;  1C27 A;  4QR8 A;  1CHM A;  2GG3 A;  2GU4 A;  1QZY A;  3L7G A;  5FCF A;  3PKD A;  1WN1 A;  3IU9 A;  4FLI A;  1N51 A;  4FLL A;  2ZSG A;  1BOA A;  3Q6D A;  2BB7 A;  4IU6 A;  2GGC A;  4PNC A;  4RZY A;  1WY2 A;  4FKC A;  2Q96 A;  2GG2 A;  2P98 A;  2Q94 A;  4IKR A;  3PKB A;  1XGO A;  3BIQ A;  4U6W A;  2BN7 A;  1B6A A;  2BH3 A;  2GG5 A;  4R60 A;  1W7V A;  3ROR A;  2ADU A;  4U73 A;  1KQ9 A;  1WL9 A;  4IEC A;  3MR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...