2NQ7A

Crystal structure of type 1 human methionine aminopeptidase in complex with 3-(2,2-dimethylpropionylamino)pyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq7A00
2V3XA 1KQ0A 2P9AA 2GG9A 2ZSGA 2OAZA 4ZWPA 3RVAA 1WY2A 2IW2A 2BHBA 2Q8KA 1JAWA 1Y1NA 3L7GA 2Q95A 2BWWA 1N51A 2BWXA 2BH3A 2DFIA 5FCFA 4B28A 2HOWA 4S2RP 2NQ6A 1YW7A 1XNZA 3L24A 1W2MA 5CNXA 3IU9A 2B3KA 1YW9A 4U73A 1PV9A 2BN7A 2BHCA 4FUKA 4U71A 1QXWA 1C24A 3CB6A 1WLRA 2GA2A 4HXXA 4ZWUA 2MATA 4A6WA 3FM3A 2GG8A 2GU7A 4OOKA 3IU7A 2EA4A 4IKUA 3BIQA 1YW8A 2GG3A 4RGZ1 4U76A 1CHMA 4U6JA 2Q92A 3PKAA 1C23A 1R5GA 4FO7A 3RORA 2V6CA 2B3LA 4IKSA 4R60A 2V3ZA 1YVMA 1R58A 5D6EA 1R5HA 2NQ7A 3BITA 1C27A 2BHAA 3MX6A 2G6PA 2OKNA 3CB5A 4S01A 1BOAA 4IU6A 4ZNGA 2P99A 1QXYA 3FMRA 4S00A 4IECA 1XGMA 1WL9A 1C21A 1M35A 2GU6A 3TB5A 3PKCA 2GU4A 5CDEA 4IKTA 4U75A 4RZYA 4KM3A 1O0XA 4Z7MA 5JI6A 2GZ5A 4FLKA 4IDYA 4U6EA 4U69A 2Q96A 2BWUA 1QXZA 1XGNA 4RZZA 3MATA 2GGCA 4MATA 5CDVA 2GG7A 2Q93A 1YJ3A 1KP0A 2GG5A 4PV4A 5CLSA 4U6CA 3PKBA 2GTXA 4S2TP 1A16A 4U1BA 4A6VA 2GGBA 4QR8A 1B6AA 3S6BA 4FKCA 2GU5A 3PKDA 4FO8A 2V3YA 2EA2A 1MATA 4JUQA 1C22A 5FCHA 4FLIA 3PKEA 2ADUA 3Q6DA 3CTZA 4U6WA 1WN1A 2B3HA 4ZWOA 2Q94A 4FLLA 2P98A 1WBQA 3MR1A 5CDLA 4IPAA 1W7VA 1WKMA 3IU8A 1XGOA 1KQ9A 4FLJA 1BN5A 5E5BA 1QZYA 5D6FA 2GG2A 3IG4A 4U6ZA 4PNCA 1XGSA 2BWSA 2EVCA 2BWYA 4IF7A 2BWVA 4IKRA 3TAVA 5JFRA 1B59A 5CE6A 4U70A 5JHUA 2EVOA 5CIKA 2BB7A 2EVMA 3BIPA 3D27A 3FMQA 4EGEA 2GG0A 2BWTA 2BHDA 1WL6A
chains in the Genus database with same CATH superfamily
2V3XA 1KQ0A 2P9AA 2GG9A 2ZSGA 2OAZA 4ZWPA 3RVAA 1WY2A 2IW2A 2BHBA 2Q8KA 1JAWA 1Y1NA 3L7GA 2Q95A 2BWWA 1N51A 2BWXA 2BH3A 2DFIA 5FCFA 4B28A 2HOWA 4S2RP 2NQ6A 1YW7A 1XNZA 3L24A 1W2MA 5CNXA 3IU9A 2B3KA 1YW9A 4U73A 1PV9A 2BN7A 2BHCA 4FUKA 4U71A 1QXWA 1C24A 3CB6A 1WLRA 2GA2A 4HXXA 4ZWUA 2MATA 4A6WA 3FM3A 2GG8A 2GU7A 4OOKA 3IU7A 2EA4A 4IKUA 3BIQA 1YW8A 2GG3A 4RGZ1 4U76A 1CHMA 4U6JA 2Q92A 3PKAA 1C23A 1R5GA 4FO7A 3RORA 2V6CA 2B3LA 4IKSA 4R60A 2V3ZA 1YVMA 1R58A 5D6EA 1R5HA 2NQ7A 3BITA 1C27A 2BHAA 3MX6A 2G6PA 2OKNA 3CB5A 4S01A 1BOAA 4IU6A 4ZNGA 2P99A 1QXYA 3FMRA 4S00A 4IECA 1XGMA 1WL9A 1C21A 1M35A 2GU6A 3TB5A 3PKCA 2GU4A 5CDEA 4IKTA 4U75A 4RZYA 4KM3A 1O0XA 4Z7MA 5JI6A 2GZ5A 4FLKA 4IDYA 4U6EA 4U69A 2Q96A 2BWUA 1QXZA 1XGNA 4RZZA 3MATA 2GGCA 4MATA 5CDVA 2GG7A 2Q93A 1YJ3A 1KP0A 2GG5A 4PV4A 5CLSA 4U6CA 3PKBA 2GTXA 4S2TP 1A16A 4U1BA 4A6VA 2GGBA 4QR8A 1B6AA 3S6BA 4FKCA 2GU5A 3PKDA 4FO8A 2V3YA 2EA2A 1MATA 4JUQA 1C22A 5FCHA 4FLIA 3PKEA 2ADUA 3Q6DA 3CTZA 4U6WA 1WN1A 2B3HA 4ZWOA 2Q94A 4FLLA 2P98A 1WBQA 3MR1A 5CDLA 4IPAA 1W7VA 1WKMA 3IU8A 1XGOA 1KQ9A 4FLJA 1BN5A 5E5BA 1QZYA 5D6FA 2GG2A 3IG4A 4U6ZA 4PNCA 1XGSA 2BWSA 2EVCA 2BWYA 4IF7A 2BWVA 4IKRA 3TAVA 5JFRA 1B59A 5CE6A 4U70A 5JHUA 2EVOA 5CIKA 2BB7A 2EVMA 3BIPA 3D27A 3FMQA 4EGEA 2GG0A 2BWTA 2BHDA 1WL6A
chains in the Genus database with same CATH topology
2V3XA 1KQ0A 2P9AA 2GG9A 2ZSGA 2OAZA 4ZWPA 3RVAA 1WY2A 2IW2A 2BHBA 2Q8KA 1JAWA 1Y1NA 3L7GA 2Q95A 2BWWA 1N51A 2BWXA 2BH3A 2DFIA 5FCFA 4B28A 2HOWA 4S2RP 2NQ6A 1YW7A 1XNZA 3L24A 1W2MA 5CNXA 3IU9A 2B3KA 1YW9A 4U73A 1PV9A 2BN7A 2BHCA 4FUKA 4U71A 1QXWA 1C24A 3CB6A 1WLRA 2GA2A 4HXXA 4ZWUA 2MATA 4A6WA 3FM3A 2GG8A 2GU7A 4OOKA 3IU7A 2EA4A 4IKUA 3BIQA 1YW8A 2GG3A 4RGZ1 4U76A 1CHMA 4U6JA 2Q92A 3PKAA 1C23A 1R5GA 4FO7A 3RORA 2V6CA 2B3LA 4IKSA 4R60A 2V3ZA 1YVMA 1R58A 5D6EA 1R5HA 2NQ7A 3BITA 1C27A 2BHAA 3MX6A 2G6PA 2OKNA 3CB5A 4S01A 1BOAA 4IU6A 4ZNGA 2P99A 1QXYA 3FMRA 4S00A 4IECA 1XGMA 1WL9A 1C21A 1M35A 2GU6A 3TB5A 3PKCA 2GU4A 5CDEA 4IKTA 4U75A 4RZYA 4KM3A 1O0XA 4Z7MA 5JI6A 2GZ5A 4FLKA 4IDYA 4U6EA 4U69A 2Q96A 2BWUA 1QXZA 1XGNA 4RZZA 3MATA 2GGCA 4MATA 5CDVA 2GG7A 2Q93A 1YJ3A 1KP0A 2GG5A 4PV4A 5CLSA 4U6CA 3PKBA 2GTXA 4S2TP 1A16A 4U1BA 4A6VA 2GGBA 4QR8A 1B6AA 3S6BA 4FKCA 2GU5A 3PKDA 4FO8A 2V3YA 2EA2A 1MATA 4JUQA 1C22A 5FCHA 4FLIA 3PKEA 2ADUA 3Q6DA 3CTZA 4U6WA 1WN1A 2B3HA 4ZWOA 2Q94A 4FLLA 2P98A 1WBQA 3MR1A 5CDLA 4IPAA 1W7VA 1WKMA 3IU8A 1XGOA 1KQ9A 4FLJA 1BN5A 5E5BA 1QZYA 5D6FA 2GG2A 3IG4A 4U6ZA 4PNCA 1XGSA 2BWSA 2EVCA 2BWYA 4IF7A 2BWVA 4IKRA 3TAVA 5JFRA 1B59A 5CE6A 4U70A 5JHUA 2EVOA 5CIKA 2BB7A 2EVMA 3BIPA 3D27A 3FMQA 4EGEA 2GG0A 2BWTA 2BHDA 1WL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3X A;  1KQ0 A;  2P9A A;  2GG9 A;  2ZSG A;  2OAZ A;  4ZWP A;  3RVA A;  1WY2 A;  2IW2 A;  2BHB A;  2Q8K A;  1JAW A;  1Y1N A;  3L7G A;  2Q95 A;  2BWW A;  1N51 A;  2BWX A;  2BH3 A;  2DFI A;  5FCF A;  4B28 A;  2HOW A;  4S2R P;  2NQ6 A;  1YW7 A;  1XNZ A;  3L24 A;  1W2M A;  5CNX A;  3IU9 A;  2B3K A;  1YW9 A;  4U73 A;  1PV9 A;  2BN7 A;  2BHC A;  4FUK A;  4U71 A;  1QXW A;  1C24 A;  3CB6 A;  1WLR A;  2GA2 A;  4HXX A;  4ZWU A;  2MAT A;  4A6W A;  3FM3 A;  2GG8 A;  2GU7 A;  4OOK A;  3IU7 A;  2EA4 A;  4IKU A;  3BIQ A;  1YW8 A;  2GG3 A;  4RGZ 1;  4U76 A;  1CHM A;  4U6J A;  2Q92 A;  3PKA A;  1C23 A;  1R5G A;  4FO7 A;  3ROR A;  2V6C A;  2B3L A;  4IKS A;  4R60 A;  2V3Z A;  1YVM A;  1R58 A;  5D6E A;  1R5H A;  2NQ7 A;  3BIT A;  1C27 A;  2BHA A;  3MX6 A;  2G6P A;  2OKN A;  3CB5 A;  4S01 A;  1BOA A;  4IU6 A;  4ZNG A;  2P99 A;  1QXY A;  3FMR A;  4S00 A;  4IEC A;  1XGM A;  1WL9 A;  1C21 A;  1M35 A;  2GU6 A;  3TB5 A;  3PKC A;  2GU4 A;  5CDE A;  4IKT A;  4U75 A;  4RZY A;  4KM3 A;  1O0X A;  4Z7M A;  5JI6 A;  2GZ5 A;  4FLK A;  4IDY A;  4U6E A;  4U69 A;  2Q96 A;  2BWU A;  1QXZ A;  1XGN A;  4RZZ A;  3MAT A;  2GGC A;  4MAT A;  5CDV A;  2GG7 A;  2Q93 A;  1YJ3 A;  1KP0 A;  2GG5 A;  4PV4 A;  5CLS A;  4U6C A;  3PKB A;  2GTX A;  4S2T P;  1A16 A;  4U1B A;  4A6V A;  2GGB A;  4QR8 A;  1B6A A;  3S6B A;  4FKC A;  2GU5 A;  3PKD A;  4FO8 A;  2V3Y A;  2EA2 A;  1MAT A;  4JUQ A;  1C22 A;  5FCH A;  4FLI A;  3PKE A;  2ADU A;  3Q6D A;  3CTZ A;  4U6W A;  1WN1 A;  2B3H A;  4ZWO A;  2Q94 A;  4FLL A;  2P98 A;  1WBQ A;  3MR1 A;  5CDL A;  4IPA A;  1W7V A;  1WKM A;  3IU8 A;  1XGO A;  1KQ9 A;  4FLJ A;  1BN5 A;  5E5B A;  1QZY A;  5D6F A;  2GG2 A;  3IG4 A;  4U6Z A;  4PNC A;  1XGS A;  2BWS A;  2EVC A;  2BWY A;  4IF7 A;  2BWV A;  4IKR A;  3TAV A;  5JFR A;  1B59 A;  5CE6 A;  4U70 A;  5JHU A;  2EVO A;  5CIK A;  2BB7 A;  2EVM A;  3BIP A;  3D27 A;  3FMQ A;  4EGE A;  2GG0 A;  2BWT A;  2BHD A;  1WL6 A; 
#chains in the Genus database with same CATH topology
 2V3X A;  1KQ0 A;  2P9A A;  2GG9 A;  2ZSG A;  2OAZ A;  4ZWP A;  3RVA A;  1WY2 A;  2IW2 A;  2BHB A;  2Q8K A;  1JAW A;  1Y1N A;  3L7G A;  2Q95 A;  2BWW A;  1N51 A;  2BWX A;  2BH3 A;  2DFI A;  5FCF A;  4B28 A;  2HOW A;  4S2R P;  2NQ6 A;  1YW7 A;  1XNZ A;  3L24 A;  1W2M A;  5CNX A;  3IU9 A;  2B3K A;  1YW9 A;  4U73 A;  1PV9 A;  2BN7 A;  2BHC A;  4FUK A;  4U71 A;  1QXW A;  1C24 A;  3CB6 A;  1WLR A;  2GA2 A;  4HXX A;  4ZWU A;  2MAT A;  4A6W A;  3FM3 A;  2GG8 A;  2GU7 A;  4OOK A;  3IU7 A;  2EA4 A;  4IKU A;  3BIQ A;  1YW8 A;  2GG3 A;  4RGZ 1;  4U76 A;  1CHM A;  4U6J A;  2Q92 A;  3PKA A;  1C23 A;  1R5G A;  4FO7 A;  3ROR A;  2V6C A;  2B3L A;  4IKS A;  4R60 A;  2V3Z A;  1YVM A;  1R58 A;  5D6E A;  1R5H A;  2NQ7 A;  3BIT A;  1C27 A;  2BHA A;  3MX6 A;  2G6P A;  2OKN A;  3CB5 A;  4S01 A;  1BOA A;  4IU6 A;  4ZNG A;  2P99 A;  1QXY A;  3FMR A;  4S00 A;  4IEC A;  1XGM A;  1WL9 A;  1C21 A;  1M35 A;  2GU6 A;  3TB5 A;  3PKC A;  2GU4 A;  5CDE A;  4IKT A;  4U75 A;  4RZY A;  4KM3 A;  1O0X A;  4Z7M A;  5JI6 A;  2GZ5 A;  4FLK A;  4IDY A;  4U6E A;  4U69 A;  2Q96 A;  2BWU A;  1QXZ A;  1XGN A;  4RZZ A;  3MAT A;  2GGC A;  4MAT A;  5CDV A;  2GG7 A;  2Q93 A;  1YJ3 A;  1KP0 A;  2GG5 A;  4PV4 A;  5CLS A;  4U6C A;  3PKB A;  2GTX A;  4S2T P;  1A16 A;  4U1B A;  4A6V A;  2GGB A;  4QR8 A;  1B6A A;  3S6B A;  4FKC A;  2GU5 A;  3PKD A;  4FO8 A;  2V3Y A;  2EA2 A;  1MAT A;  4JUQ A;  1C22 A;  5FCH A;  4FLI A;  3PKE A;  2ADU A;  3Q6D A;  3CTZ A;  4U6W A;  1WN1 A;  2B3H A;  4ZWO A;  2Q94 A;  4FLL A;  2P98 A;  1WBQ A;  3MR1 A;  5CDL A;  4IPA A;  1W7V A;  1WKM A;  3IU8 A;  1XGO A;  1KQ9 A;  4FLJ A;  1BN5 A;  5E5B A;  1QZY A;  5D6F A;  2GG2 A;  3IG4 A;  4U6Z A;  4PNC A;  1XGS A;  2BWS A;  2EVC A;  2BWY A;  4IF7 A;  2BWV A;  4IKR A;  3TAV A;  5JFR A;  1B59 A;  5CE6 A;  4U70 A;  5JHU A;  2EVO A;  5CIK A;  2BB7 A;  2EVM A;  3BIP A;  3D27 A;  3FMQ A;  4EGE A;  2GG0 A;  2BWT A;  2BHD A;  1WL6 A; 
#chains in the Genus database with same CATH homology
 2V3X A;  1KQ0 A;  2P9A A;  2GG9 A;  2ZSG A;  2OAZ A;  4ZWP A;  3RVA A;  1WY2 A;  2IW2 A;  2BHB A;  2Q8K A;  1JAW A;  1Y1N A;  3L7G A;  2Q95 A;  2BWW A;  1N51 A;  2BWX A;  2BH3 A;  2DFI A;  5FCF A;  4B28 A;  2HOW A;  4S2R P;  2NQ6 A;  1YW7 A;  1XNZ A;  3L24 A;  1W2M A;  5CNX A;  3IU9 A;  2B3K A;  1YW9 A;  4U73 A;  1PV9 A;  2BN7 A;  2BHC A;  4FUK A;  4U71 A;  1QXW A;  1C24 A;  3CB6 A;  1WLR A;  2GA2 A;  4HXX A;  4ZWU A;  2MAT A;  4A6W A;  3FM3 A;  2GG8 A;  2GU7 A;  4OOK A;  3IU7 A;  2EA4 A;  4IKU A;  3BIQ A;  1YW8 A;  2GG3 A;  4RGZ 1;  4U76 A;  1CHM A;  4U6J A;  2Q92 A;  3PKA A;  1C23 A;  1R5G A;  4FO7 A;  3ROR A;  2V6C A;  2B3L A;  4IKS A;  4R60 A;  2V3Z A;  1YVM A;  1R58 A;  5D6E A;  1R5H A;  2NQ7 A;  3BIT A;  1C27 A;  2BHA A;  3MX6 A;  2G6P A;  2OKN A;  3CB5 A;  4S01 A;  1BOA A;  4IU6 A;  4ZNG A;  2P99 A;  1QXY A;  3FMR A;  4S00 A;  4IEC A;  1XGM A;  1WL9 A;  1C21 A;  1M35 A;  2GU6 A;  3TB5 A;  3PKC A;  2GU4 A;  5CDE A;  4IKT A;  4U75 A;  4RZY A;  4KM3 A;  1O0X A;  4Z7M A;  5JI6 A;  2GZ5 A;  4FLK A;  4IDY A;  4U6E A;  4U69 A;  2Q96 A;  2BWU A;  1QXZ A;  1XGN A;  4RZZ A;  3MAT A;  2GGC A;  4MAT A;  5CDV A;  2GG7 A;  2Q93 A;  1YJ3 A;  1KP0 A;  2GG5 A;  4PV4 A;  5CLS A;  4U6C A;  3PKB A;  2GTX A;  4S2T P;  1A16 A;  4U1B A;  4A6V A;  2GGB A;  4QR8 A;  1B6A A;  3S6B A;  4FKC A;  2GU5 A;  3PKD A;  4FO8 A;  2V3Y A;  2EA2 A;  1MAT A;  4JUQ A;  1C22 A;  5FCH A;  4FLI A;  3PKE A;  2ADU A;  3Q6D A;  3CTZ A;  4U6W A;  1WN1 A;  2B3H A;  4ZWO A;  2Q94 A;  4FLL A;  2P98 A;  1WBQ A;  3MR1 A;  5CDL A;  4IPA A;  1W7V A;  1WKM A;  3IU8 A;  1XGO A;  1KQ9 A;  4FLJ A;  1BN5 A;  5E5B A;  1QZY A;  5D6F A;  2GG2 A;  3IG4 A;  4U6Z A;  4PNC A;  1XGS A;  2BWS A;  2EVC A;  2BWY A;  4IF7 A;  2BWV A;  4IKR A;  3TAV A;  5JFR A;  1B59 A;  5CE6 A;  4U70 A;  5JHU A;  2EVO A;  5CIK A;  2BB7 A;  2EVM A;  3BIP A;  3D27 A;  3FMQ A;  4EGE A;  2GG0 A;  2BWT A;  2BHD A;  1WL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...