2NQ7A

Crystal structure of type 1 human methionine aminopeptidase in complex with 3-(2,2-dimethylpropionylamino)pyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq7A00
2EA2A 4FO8A 4S00A 1O0XA 1W2MA 1WL9A 2GG0A 5CLSA 2Q96A 1N51A 5CDVA 4ZWUA 2GGBA 2V3XA 3BIQA 5FCHA 2V3YA 1C23A 1YVMA 2EVCA 4A6WA 2OAZA 2GG2A 4HXXA 2HOWA 4QR8A 4FKCA 2ADUA 2MATA 1MATA 1B59A 1C21A 1PV9A 2P99A 5CNXA 3RVAA 1KQ0A 4FLKA 1BN5A 2GTXA 3PKCA 2Q95A 2GG7A 2BWYA 4RGZ1 2V6CA 2EVMA 2IW2A 4IU6A 2Q93A 3RORA 1A16A 1WN1A 1WLRA 3FMQA 1R5HA 1R5GA 2BN7A 2GU4A 3BITA 3TB5A 5CDLA 2EVOA 1XGMA 2B3HA 4IKSA 1WL6A 4U73A 1BOAA 4S2TP 1C27A 4IPAA 5JFRA 2BH3A 3Q6DA 4RZZA 3PKAA 1YJ3A 2BHAA 3CB5A 2ZSGA 3D27A 4U6ZA 1KQ9A 4FLIA 2B3LA 1C22A 1QZYA 1CHMA 2GU6A 1XNZA 3IU9A 2BWSA 2DFIA 4IDYA 2Q8KA 4ZWPA 2GZ5A 2Q92A 4FLJA 4B28A 1YW7A 3FM3A 4JUQA 2G6PA 4FO7A 2GGCA 1XGSA 3S6BA 4U6EA 4PNCA 2GG9A 2BWUA 2Q94A 2P98A 3CB6A 5D6EA 2P9AA 2OKNA 2GU7A 1QXWA 3PKBA 4S01A 4U70A 1QXZA 1WY2A 1XGOA 1QXYA 3L24A 4S2RP 1WKMA 3IU8A 4U6CA 2BHBA 1W7VA 3MATA 3IG4A 2B3KA 1C24A 1WBQA 4IKTA 1XGNA 1YW8A 2BWTA 4FLLA 2GA2A 4U71A 4KM3A 3PKEA 2NQ6A 5E5BA 4ZWOA 5JHUA 2GG3A 4U6JA 4IF7A 5FCFA 4IKUA 3PKDA 4U69A 2BWWA 4OOKA 2GG8A 1YW9A 2BB7A 3L7GA 2BWVA 2BHDA 2GU5A 4U75A 4U1BA 2EA4A 5CDEA 1Y1NA 4PV4A 5JI6A 4ZNGA 4EGEA 1KP0A 1R58A 4R60A 3BIPA 5D6FA 2GG5A 4IECA 4U6WA 5CE6A 2V3ZA 4U76A 1B6AA 4IKRA 1M35A 3MX6A 2BHCA 3IU7A 3TAVA 5CIKA 3MR1A 1JAWA 4FUKA 3CTZA 4MATA 2NQ7A 4RZYA 4Z7MA 2BWXA 3FMRA 4A6VA
chains in the Genus database with same CATH superfamily
2EA2A 4FO8A 4S00A 1O0XA 1W2MA 1WL9A 2GG0A 5CLSA 2Q96A 1N51A 5CDVA 4ZWUA 2GGBA 2V3XA 3BIQA 5FCHA 2V3YA 1C23A 1YVMA 2EVCA 4A6WA 2OAZA 2GG2A 4HXXA 2HOWA 4QR8A 4FKCA 2ADUA 2MATA 1MATA 1B59A 1C21A 1PV9A 2P99A 5CNXA 3RVAA 1KQ0A 4FLKA 1BN5A 2GTXA 3PKCA 2Q95A 2GG7A 2BWYA 4RGZ1 2V6CA 2EVMA 2IW2A 4IU6A 2Q93A 3RORA 1A16A 1WN1A 1WLRA 3FMQA 1R5HA 1R5GA 2BN7A 2GU4A 3BITA 3TB5A 5CDLA 2EVOA 1XGMA 2B3HA 4IKSA 1WL6A 4U73A 1BOAA 4S2TP 1C27A 4IPAA 5JFRA 2BH3A 3Q6DA 4RZZA 3PKAA 1YJ3A 2BHAA 3CB5A 2ZSGA 3D27A 4U6ZA 1KQ9A 4FLIA 2B3LA 1C22A 1QZYA 1CHMA 2GU6A 1XNZA 3IU9A 2BWSA 2DFIA 4IDYA 2Q8KA 4ZWPA 2GZ5A 2Q92A 4FLJA 4B28A 1YW7A 3FM3A 4JUQA 2G6PA 4FO7A 2GGCA 1XGSA 3S6BA 4U6EA 4PNCA 2GG9A 2BWUA 2Q94A 2P98A 3CB6A 5D6EA 2P9AA 2OKNA 2GU7A 1QXWA 3PKBA 4S01A 4U70A 1QXZA 1WY2A 1XGOA 1QXYA 3L24A 4S2RP 1WKMA 3IU8A 4U6CA 2BHBA 1W7VA 3MATA 3IG4A 2B3KA 1C24A 1WBQA 4IKTA 1XGNA 1YW8A 2BWTA 4FLLA 2GA2A 4U71A 4KM3A 3PKEA 2NQ6A 5E5BA 4ZWOA 5JHUA 2GG3A 4U6JA 4IF7A 5FCFA 4IKUA 3PKDA 4U69A 2BWWA 4OOKA 2GG8A 1YW9A 2BB7A 3L7GA 2BWVA 2BHDA 2GU5A 4U75A 4U1BA 2EA4A 5CDEA 1Y1NA 4PV4A 5JI6A 4ZNGA 4EGEA 1KP0A 1R58A 4R60A 3BIPA 5D6FA 2GG5A 4IECA 4U6WA 5CE6A 2V3ZA 4U76A 1B6AA 4IKRA 1M35A 3MX6A 2BHCA 3IU7A 3TAVA 5CIKA 3MR1A 1JAWA 4FUKA 3CTZA 4MATA 2NQ7A 4RZYA 4Z7MA 2BWXA 3FMRA 4A6VA
chains in the Genus database with same CATH topology
2EA2A 4FO8A 4S00A 1O0XA 1W2MA 1WL9A 2GG0A 5CLSA 2Q96A 1N51A 5CDVA 4ZWUA 2GGBA 2V3XA 3BIQA 5FCHA 2V3YA 1C23A 1YVMA 2EVCA 4A6WA 2OAZA 2GG2A 4HXXA 2HOWA 4QR8A 4FKCA 2ADUA 2MATA 1MATA 1B59A 1C21A 1PV9A 2P99A 5CNXA 3RVAA 1KQ0A 4FLKA 1BN5A 2GTXA 3PKCA 2Q95A 2GG7A 2BWYA 4RGZ1 2V6CA 2EVMA 2IW2A 4IU6A 2Q93A 3RORA 1A16A 1WN1A 1WLRA 3FMQA 1R5HA 1R5GA 2BN7A 2GU4A 3BITA 3TB5A 5CDLA 2EVOA 1XGMA 2B3HA 4IKSA 1WL6A 4U73A 1BOAA 4S2TP 1C27A 4IPAA 5JFRA 2BH3A 3Q6DA 4RZZA 3PKAA 1YJ3A 2BHAA 3CB5A 2ZSGA 3D27A 4U6ZA 1KQ9A 4FLIA 2B3LA 1C22A 1QZYA 1CHMA 2GU6A 1XNZA 3IU9A 2BWSA 2DFIA 4IDYA 2Q8KA 4ZWPA 2GZ5A 2Q92A 4FLJA 4B28A 1YW7A 3FM3A 4JUQA 2G6PA 4FO7A 2GGCA 1XGSA 3S6BA 4U6EA 4PNCA 2GG9A 2BWUA 2Q94A 2P98A 3CB6A 5D6EA 2P9AA 2OKNA 2GU7A 1QXWA 3PKBA 4S01A 4U70A 1QXZA 1WY2A 1XGOA 1QXYA 3L24A 4S2RP 1WKMA 3IU8A 4U6CA 2BHBA 1W7VA 3MATA 3IG4A 2B3KA 1C24A 1WBQA 4IKTA 1XGNA 1YW8A 2BWTA 4FLLA 2GA2A 4U71A 4KM3A 3PKEA 2NQ6A 5E5BA 4ZWOA 5JHUA 2GG3A 4U6JA 4IF7A 5FCFA 4IKUA 3PKDA 4U69A 2BWWA 4OOKA 2GG8A 1YW9A 2BB7A 3L7GA 2BWVA 2BHDA 2GU5A 4U75A 4U1BA 2EA4A 5CDEA 1Y1NA 4PV4A 5JI6A 4ZNGA 4EGEA 1KP0A 1R58A 4R60A 3BIPA 5D6FA 2GG5A 4IECA 4U6WA 5CE6A 2V3ZA 4U76A 1B6AA 4IKRA 1M35A 3MX6A 2BHCA 3IU7A 3TAVA 5CIKA 3MR1A 1JAWA 4FUKA 3CTZA 4MATA 2NQ7A 4RZYA 4Z7MA 2BWXA 3FMRA 4A6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA2 A;  4FO8 A;  4S00 A;  1O0X A;  1W2M A;  1WL9 A;  2GG0 A;  5CLS A;  2Q96 A;  1N51 A;  5CDV A;  4ZWU A;  2GGB A;  2V3X A;  3BIQ A;  5FCH A;  2V3Y A;  1C23 A;  1YVM A;  2EVC A;  4A6W A;  2OAZ A;  2GG2 A;  4HXX A;  2HOW A;  4QR8 A;  4FKC A;  2ADU A;  2MAT A;  1MAT A;  1B59 A;  1C21 A;  1PV9 A;  2P99 A;  5CNX A;  3RVA A;  1KQ0 A;  4FLK A;  1BN5 A;  2GTX A;  3PKC A;  2Q95 A;  2GG7 A;  2BWY A;  4RGZ 1;  2V6C A;  2EVM A;  2IW2 A;  4IU6 A;  2Q93 A;  3ROR A;  1A16 A;  1WN1 A;  1WLR A;  3FMQ A;  1R5H A;  1R5G A;  2BN7 A;  2GU4 A;  3BIT A;  3TB5 A;  5CDL A;  2EVO A;  1XGM A;  2B3H A;  4IKS A;  1WL6 A;  4U73 A;  1BOA A;  4S2T P;  1C27 A;  4IPA A;  5JFR A;  2BH3 A;  3Q6D A;  4RZZ A;  3PKA A;  1YJ3 A;  2BHA A;  3CB5 A;  2ZSG A;  3D27 A;  4U6Z A;  1KQ9 A;  4FLI A;  2B3L A;  1C22 A;  1QZY A;  1CHM A;  2GU6 A;  1XNZ A;  3IU9 A;  2BWS A;  2DFI A;  4IDY A;  2Q8K A;  4ZWP A;  2GZ5 A;  2Q92 A;  4FLJ A;  4B28 A;  1YW7 A;  3FM3 A;  4JUQ A;  2G6P A;  4FO7 A;  2GGC A;  1XGS A;  3S6B A;  4U6E A;  4PNC A;  2GG9 A;  2BWU A;  2Q94 A;  2P98 A;  3CB6 A;  5D6E A;  2P9A A;  2OKN A;  2GU7 A;  1QXW A;  3PKB A;  4S01 A;  4U70 A;  1QXZ A;  1WY2 A;  1XGO A;  1QXY A;  3L24 A;  4S2R P;  1WKM A;  3IU8 A;  4U6C A;  2BHB A;  1W7V A;  3MAT A;  3IG4 A;  2B3K A;  1C24 A;  1WBQ A;  4IKT A;  1XGN A;  1YW8 A;  2BWT A;  4FLL A;  2GA2 A;  4U71 A;  4KM3 A;  3PKE A;  2NQ6 A;  5E5B A;  4ZWO A;  5JHU A;  2GG3 A;  4U6J A;  4IF7 A;  5FCF A;  4IKU A;  3PKD A;  4U69 A;  2BWW A;  4OOK A;  2GG8 A;  1YW9 A;  2BB7 A;  3L7G A;  2BWV A;  2BHD A;  2GU5 A;  4U75 A;  4U1B A;  2EA4 A;  5CDE A;  1Y1N A;  4PV4 A;  5JI6 A;  4ZNG A;  4EGE A;  1KP0 A;  1R58 A;  4R60 A;  3BIP A;  5D6F A;  2GG5 A;  4IEC A;  4U6W A;  5CE6 A;  2V3Z A;  4U76 A;  1B6A A;  4IKR A;  1M35 A;  3MX6 A;  2BHC A;  3IU7 A;  3TAV A;  5CIK A;  3MR1 A;  1JAW A;  4FUK A;  3CTZ A;  4MAT A;  2NQ7 A;  4RZY A;  4Z7M A;  2BWX A;  3FMR A;  4A6V A; 
#chains in the Genus database with same CATH topology
 2EA2 A;  4FO8 A;  4S00 A;  1O0X A;  1W2M A;  1WL9 A;  2GG0 A;  5CLS A;  2Q96 A;  1N51 A;  5CDV A;  4ZWU A;  2GGB A;  2V3X A;  3BIQ A;  5FCH A;  2V3Y A;  1C23 A;  1YVM A;  2EVC A;  4A6W A;  2OAZ A;  2GG2 A;  4HXX A;  2HOW A;  4QR8 A;  4FKC A;  2ADU A;  2MAT A;  1MAT A;  1B59 A;  1C21 A;  1PV9 A;  2P99 A;  5CNX A;  3RVA A;  1KQ0 A;  4FLK A;  1BN5 A;  2GTX A;  3PKC A;  2Q95 A;  2GG7 A;  2BWY A;  4RGZ 1;  2V6C A;  2EVM A;  2IW2 A;  4IU6 A;  2Q93 A;  3ROR A;  1A16 A;  1WN1 A;  1WLR A;  3FMQ A;  1R5H A;  1R5G A;  2BN7 A;  2GU4 A;  3BIT A;  3TB5 A;  5CDL A;  2EVO A;  1XGM A;  2B3H A;  4IKS A;  1WL6 A;  4U73 A;  1BOA A;  4S2T P;  1C27 A;  4IPA A;  5JFR A;  2BH3 A;  3Q6D A;  4RZZ A;  3PKA A;  1YJ3 A;  2BHA A;  3CB5 A;  2ZSG A;  3D27 A;  4U6Z A;  1KQ9 A;  4FLI A;  2B3L A;  1C22 A;  1QZY A;  1CHM A;  2GU6 A;  1XNZ A;  3IU9 A;  2BWS A;  2DFI A;  4IDY A;  2Q8K A;  4ZWP A;  2GZ5 A;  2Q92 A;  4FLJ A;  4B28 A;  1YW7 A;  3FM3 A;  4JUQ A;  2G6P A;  4FO7 A;  2GGC A;  1XGS A;  3S6B A;  4U6E A;  4PNC A;  2GG9 A;  2BWU A;  2Q94 A;  2P98 A;  3CB6 A;  5D6E A;  2P9A A;  2OKN A;  2GU7 A;  1QXW A;  3PKB A;  4S01 A;  4U70 A;  1QXZ A;  1WY2 A;  1XGO A;  1QXY A;  3L24 A;  4S2R P;  1WKM A;  3IU8 A;  4U6C A;  2BHB A;  1W7V A;  3MAT A;  3IG4 A;  2B3K A;  1C24 A;  1WBQ A;  4IKT A;  1XGN A;  1YW8 A;  2BWT A;  4FLL A;  2GA2 A;  4U71 A;  4KM3 A;  3PKE A;  2NQ6 A;  5E5B A;  4ZWO A;  5JHU A;  2GG3 A;  4U6J A;  4IF7 A;  5FCF A;  4IKU A;  3PKD A;  4U69 A;  2BWW A;  4OOK A;  2GG8 A;  1YW9 A;  2BB7 A;  3L7G A;  2BWV A;  2BHD A;  2GU5 A;  4U75 A;  4U1B A;  2EA4 A;  5CDE A;  1Y1N A;  4PV4 A;  5JI6 A;  4ZNG A;  4EGE A;  1KP0 A;  1R58 A;  4R60 A;  3BIP A;  5D6F A;  2GG5 A;  4IEC A;  4U6W A;  5CE6 A;  2V3Z A;  4U76 A;  1B6A A;  4IKR A;  1M35 A;  3MX6 A;  2BHC A;  3IU7 A;  3TAV A;  5CIK A;  3MR1 A;  1JAW A;  4FUK A;  3CTZ A;  4MAT A;  2NQ7 A;  4RZY A;  4Z7M A;  2BWX A;  3FMR A;  4A6V A; 
#chains in the Genus database with same CATH homology
 2EA2 A;  4FO8 A;  4S00 A;  1O0X A;  1W2M A;  1WL9 A;  2GG0 A;  5CLS A;  2Q96 A;  1N51 A;  5CDV A;  4ZWU A;  2GGB A;  2V3X A;  3BIQ A;  5FCH A;  2V3Y A;  1C23 A;  1YVM A;  2EVC A;  4A6W A;  2OAZ A;  2GG2 A;  4HXX A;  2HOW A;  4QR8 A;  4FKC A;  2ADU A;  2MAT A;  1MAT A;  1B59 A;  1C21 A;  1PV9 A;  2P99 A;  5CNX A;  3RVA A;  1KQ0 A;  4FLK A;  1BN5 A;  2GTX A;  3PKC A;  2Q95 A;  2GG7 A;  2BWY A;  4RGZ 1;  2V6C A;  2EVM A;  2IW2 A;  4IU6 A;  2Q93 A;  3ROR A;  1A16 A;  1WN1 A;  1WLR A;  3FMQ A;  1R5H A;  1R5G A;  2BN7 A;  2GU4 A;  3BIT A;  3TB5 A;  5CDL A;  2EVO A;  1XGM A;  2B3H A;  4IKS A;  1WL6 A;  4U73 A;  1BOA A;  4S2T P;  1C27 A;  4IPA A;  5JFR A;  2BH3 A;  3Q6D A;  4RZZ A;  3PKA A;  1YJ3 A;  2BHA A;  3CB5 A;  2ZSG A;  3D27 A;  4U6Z A;  1KQ9 A;  4FLI A;  2B3L A;  1C22 A;  1QZY A;  1CHM A;  2GU6 A;  1XNZ A;  3IU9 A;  2BWS A;  2DFI A;  4IDY A;  2Q8K A;  4ZWP A;  2GZ5 A;  2Q92 A;  4FLJ A;  4B28 A;  1YW7 A;  3FM3 A;  4JUQ A;  2G6P A;  4FO7 A;  2GGC A;  1XGS A;  3S6B A;  4U6E A;  4PNC A;  2GG9 A;  2BWU A;  2Q94 A;  2P98 A;  3CB6 A;  5D6E A;  2P9A A;  2OKN A;  2GU7 A;  1QXW A;  3PKB A;  4S01 A;  4U70 A;  1QXZ A;  1WY2 A;  1XGO A;  1QXY A;  3L24 A;  4S2R P;  1WKM A;  3IU8 A;  4U6C A;  2BHB A;  1W7V A;  3MAT A;  3IG4 A;  2B3K A;  1C24 A;  1WBQ A;  4IKT A;  1XGN A;  1YW8 A;  2BWT A;  4FLL A;  2GA2 A;  4U71 A;  4KM3 A;  3PKE A;  2NQ6 A;  5E5B A;  4ZWO A;  5JHU A;  2GG3 A;  4U6J A;  4IF7 A;  5FCF A;  4IKU A;  3PKD A;  4U69 A;  2BWW A;  4OOK A;  2GG8 A;  1YW9 A;  2BB7 A;  3L7G A;  2BWV A;  2BHD A;  2GU5 A;  4U75 A;  4U1B A;  2EA4 A;  5CDE A;  1Y1N A;  4PV4 A;  5JI6 A;  4ZNG A;  4EGE A;  1KP0 A;  1R58 A;  4R60 A;  3BIP A;  5D6F A;  2GG5 A;  4IEC A;  4U6W A;  5CE6 A;  2V3Z A;  4U76 A;  1B6A A;  4IKR A;  1M35 A;  3MX6 A;  2BHC A;  3IU7 A;  3TAV A;  5CIK A;  3MR1 A;  1JAW A;  4FUK A;  3CTZ A;  4MAT A;  2NQ7 A;  4RZY A;  4Z7M A;  2BWX A;  3FMR A;  4A6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...