2NQ7A

Crystal structure of type 1 human methionine aminopeptidase in complex with 3-(2,2-dimethylpropionylamino)pyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq7A00
4R60A 2V3ZA 4FO7A 2GG5A 1BN5A 2P99A 2GU7A 3CB6A 5CDLA 4MATA 1C22A 2OAZA 4U6WA 1WL9A 3MX6A 4S00A 2ZSGA 4ZWOA 4S01A 1YW9A 4KM3A 4A6WA 5JI6A 1CHMA 1R5HA 2NQ6A 4RGZ1 5CE6A 1C27A 3FMRA 1C23A 3BIPA 2BB7A 3IU7A 1B59A 4IU6A 3L24A 2BHDA 2BWVA 4U73A 3D27A 2GA2A 5CDEA 2BWUA 2BWTA 3TB5A 2Q8KA 3MATA 4FKCA 3PKAA 1Y1NA 4FLKA 2B3LA 4U6JA 3RORA 4IF7A 3PKDA 4QR8A 1N51A 3FMQA 1PV9A 4IKSA 4OOKA 2GGBA 3CTZA 1C21A 1M35A 2MATA 5FCFA 1YW8A 1XGSA 4FLLA 4HXXA 4IKUA 4PNCA 1XNZA 5D6EA 3BITA 3IU8A 4B28A 1XGOA 2ADUA 4U6CA 2GZ5A 5CIKA 4ZWUA 1KQ9A 2GGCA 1KQ0A 2BWWA 4Z7MA 4U6EA 1YJ3A 5D6FA 2EVMA 4U76A 4U71A 4RZYA 2GU6A 4IECA 1C24A 1R5GA 4RZZA 1B6AA 2BHCA 3IG4A 2EVOA 5CNXA 1O0XA 2G6PA 3CB5A 3FM3A 1QXWA 1YW7A 5FCHA 2GU4A 1A16A 2V6CA 1WY2A 1W7VA 1WLRA 4ZNGA 3RVAA 2P9AA 3BIQA 2BWSA 2GG0A 4IKTA 4FUKA 2BHBA 2B3HA 5CDVA 2EA4A 2Q94A 1KP0A 4U75A 2GG9A 2BWXA 1QZYA 1WBQA 2Q95A 2BN7A 1R58A 2V3YA 4FLJA 4U69A 4U1BA 5E5BA 1BOAA 4ZWPA 2GG2A 2NQ7A 4U6ZA 1QXZA 2Q93A 4FLIA 5JHUA 5CLSA 4S2TP 2DFIA 4FO8A 1WKMA 3L7GA 1XGMA 2Q96A 3MR1A 1YVMA 3PKCA 1MATA 2BHAA 2BWYA 2HOWA 2Q92A 2P98A 1WL6A 2GTXA 4U70A 4S2RP 2BH3A 2GG8A 3TAVA 5JFRA 2GG7A 1QXYA 3Q6DA 1XGNA 1JAWA 2B3KA 2IW2A 2GG3A 3S6BA 1W2MA 2EVCA 2V3XA 2OKNA 4IPAA 3PKBA 4IDYA 3IU9A 1WN1A 3PKEA 4A6VA 4IKRA 4EGEA 4PV4A 2GU5A 4JUQA 2EA2A
chains in the Genus database with same CATH superfamily
4R60A 2V3ZA 4FO7A 2GG5A 1BN5A 2P99A 2GU7A 3CB6A 5CDLA 4MATA 1C22A 2OAZA 4U6WA 1WL9A 3MX6A 4S00A 2ZSGA 4ZWOA 4S01A 1YW9A 4KM3A 4A6WA 5JI6A 1CHMA 1R5HA 2NQ6A 4RGZ1 5CE6A 1C27A 3FMRA 1C23A 3BIPA 2BB7A 3IU7A 1B59A 4IU6A 3L24A 2BHDA 2BWVA 4U73A 3D27A 2GA2A 5CDEA 2BWUA 2BWTA 3TB5A 2Q8KA 3MATA 4FKCA 3PKAA 1Y1NA 4FLKA 2B3LA 4U6JA 3RORA 4IF7A 3PKDA 4QR8A 1N51A 3FMQA 1PV9A 4IKSA 4OOKA 2GGBA 3CTZA 1C21A 1M35A 2MATA 5FCFA 1YW8A 1XGSA 4FLLA 4HXXA 4IKUA 4PNCA 1XNZA 5D6EA 3BITA 3IU8A 4B28A 1XGOA 2ADUA 4U6CA 2GZ5A 5CIKA 4ZWUA 1KQ9A 2GGCA 1KQ0A 2BWWA 4Z7MA 4U6EA 1YJ3A 5D6FA 2EVMA 4U76A 4U71A 4RZYA 2GU6A 4IECA 1C24A 1R5GA 4RZZA 1B6AA 2BHCA 3IG4A 2EVOA 5CNXA 1O0XA 2G6PA 3CB5A 3FM3A 1QXWA 1YW7A 5FCHA 2GU4A 1A16A 2V6CA 1WY2A 1W7VA 1WLRA 4ZNGA 3RVAA 2P9AA 3BIQA 2BWSA 2GG0A 4IKTA 4FUKA 2BHBA 2B3HA 5CDVA 2EA4A 2Q94A 1KP0A 4U75A 2GG9A 2BWXA 1QZYA 1WBQA 2Q95A 2BN7A 1R58A 2V3YA 4FLJA 4U69A 4U1BA 5E5BA 1BOAA 4ZWPA 2GG2A 2NQ7A 4U6ZA 1QXZA 2Q93A 4FLIA 5JHUA 5CLSA 4S2TP 2DFIA 4FO8A 1WKMA 3L7GA 1XGMA 2Q96A 3MR1A 1YVMA 3PKCA 1MATA 2BHAA 2BWYA 2HOWA 2Q92A 2P98A 1WL6A 2GTXA 4U70A 4S2RP 2BH3A 2GG8A 3TAVA 5JFRA 2GG7A 1QXYA 3Q6DA 1XGNA 1JAWA 2B3KA 2IW2A 2GG3A 3S6BA 1W2MA 2EVCA 2V3XA 2OKNA 4IPAA 3PKBA 4IDYA 3IU9A 1WN1A 3PKEA 4A6VA 4IKRA 4EGEA 4PV4A 2GU5A 4JUQA 2EA2A
chains in the Genus database with same CATH topology
4R60A 2V3ZA 4FO7A 2GG5A 1BN5A 2P99A 2GU7A 3CB6A 5CDLA 4MATA 1C22A 2OAZA 4U6WA 1WL9A 3MX6A 4S00A 2ZSGA 4ZWOA 4S01A 1YW9A 4KM3A 4A6WA 5JI6A 1CHMA 1R5HA 2NQ6A 4RGZ1 5CE6A 1C27A 3FMRA 1C23A 3BIPA 2BB7A 3IU7A 1B59A 4IU6A 3L24A 2BHDA 2BWVA 4U73A 3D27A 2GA2A 5CDEA 2BWUA 2BWTA 3TB5A 2Q8KA 3MATA 4FKCA 3PKAA 1Y1NA 4FLKA 2B3LA 4U6JA 3RORA 4IF7A 3PKDA 4QR8A 1N51A 3FMQA 1PV9A 4IKSA 4OOKA 2GGBA 3CTZA 1C21A 1M35A 2MATA 5FCFA 1YW8A 1XGSA 4FLLA 4HXXA 4IKUA 4PNCA 1XNZA 5D6EA 3BITA 3IU8A 4B28A 1XGOA 2ADUA 4U6CA 2GZ5A 5CIKA 4ZWUA 1KQ9A 2GGCA 1KQ0A 2BWWA 4Z7MA 4U6EA 1YJ3A 5D6FA 2EVMA 4U76A 4U71A 4RZYA 2GU6A 4IECA 1C24A 1R5GA 4RZZA 1B6AA 2BHCA 3IG4A 2EVOA 5CNXA 1O0XA 2G6PA 3CB5A 3FM3A 1QXWA 1YW7A 5FCHA 2GU4A 1A16A 2V6CA 1WY2A 1W7VA 1WLRA 4ZNGA 3RVAA 2P9AA 3BIQA 2BWSA 2GG0A 4IKTA 4FUKA 2BHBA 2B3HA 5CDVA 2EA4A 2Q94A 1KP0A 4U75A 2GG9A 2BWXA 1QZYA 1WBQA 2Q95A 2BN7A 1R58A 2V3YA 4FLJA 4U69A 4U1BA 5E5BA 1BOAA 4ZWPA 2GG2A 2NQ7A 4U6ZA 1QXZA 2Q93A 4FLIA 5JHUA 5CLSA 4S2TP 2DFIA 4FO8A 1WKMA 3L7GA 1XGMA 2Q96A 3MR1A 1YVMA 3PKCA 1MATA 2BHAA 2BWYA 2HOWA 2Q92A 2P98A 1WL6A 2GTXA 4U70A 4S2RP 2BH3A 2GG8A 3TAVA 5JFRA 2GG7A 1QXYA 3Q6DA 1XGNA 1JAWA 2B3KA 2IW2A 2GG3A 3S6BA 1W2MA 2EVCA 2V3XA 2OKNA 4IPAA 3PKBA 4IDYA 3IU9A 1WN1A 3PKEA 4A6VA 4IKRA 4EGEA 4PV4A 2GU5A 4JUQA 2EA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  2V3Z A;  4FO7 A;  2GG5 A;  1BN5 A;  2P99 A;  2GU7 A;  3CB6 A;  5CDL A;  4MAT A;  1C22 A;  2OAZ A;  4U6W A;  1WL9 A;  3MX6 A;  4S00 A;  2ZSG A;  4ZWO A;  4S01 A;  1YW9 A;  4KM3 A;  4A6W A;  5JI6 A;  1CHM A;  1R5H A;  2NQ6 A;  4RGZ 1;  5CE6 A;  1C27 A;  3FMR A;  1C23 A;  3BIP A;  2BB7 A;  3IU7 A;  1B59 A;  4IU6 A;  3L24 A;  2BHD A;  2BWV A;  4U73 A;  3D27 A;  2GA2 A;  5CDE A;  2BWU A;  2BWT A;  3TB5 A;  2Q8K A;  3MAT A;  4FKC A;  3PKA A;  1Y1N A;  4FLK A;  2B3L A;  4U6J A;  3ROR A;  4IF7 A;  3PKD A;  4QR8 A;  1N51 A;  3FMQ A;  1PV9 A;  4IKS A;  4OOK A;  2GGB A;  3CTZ A;  1C21 A;  1M35 A;  2MAT A;  5FCF A;  1YW8 A;  1XGS A;  4FLL A;  4HXX A;  4IKU A;  4PNC A;  1XNZ A;  5D6E A;  3BIT A;  3IU8 A;  4B28 A;  1XGO A;  2ADU A;  4U6C A;  2GZ5 A;  5CIK A;  4ZWU A;  1KQ9 A;  2GGC A;  1KQ0 A;  2BWW A;  4Z7M A;  4U6E A;  1YJ3 A;  5D6F A;  2EVM A;  4U76 A;  4U71 A;  4RZY A;  2GU6 A;  4IEC A;  1C24 A;  1R5G A;  4RZZ A;  1B6A A;  2BHC A;  3IG4 A;  2EVO A;  5CNX A;  1O0X A;  2G6P A;  3CB5 A;  3FM3 A;  1QXW A;  1YW7 A;  5FCH A;  2GU4 A;  1A16 A;  2V6C A;  1WY2 A;  1W7V A;  1WLR A;  4ZNG A;  3RVA A;  2P9A A;  3BIQ A;  2BWS A;  2GG0 A;  4IKT A;  4FUK A;  2BHB A;  2B3H A;  5CDV A;  2EA4 A;  2Q94 A;  1KP0 A;  4U75 A;  2GG9 A;  2BWX A;  1QZY A;  1WBQ A;  2Q95 A;  2BN7 A;  1R58 A;  2V3Y A;  4FLJ A;  4U69 A;  4U1B A;  5E5B A;  1BOA A;  4ZWP A;  2GG2 A;  2NQ7 A;  4U6Z A;  1QXZ A;  2Q93 A;  4FLI A;  5JHU A;  5CLS A;  4S2T P;  2DFI A;  4FO8 A;  1WKM A;  3L7G A;  1XGM A;  2Q96 A;  3MR1 A;  1YVM A;  3PKC A;  1MAT A;  2BHA A;  2BWY A;  2HOW A;  2Q92 A;  2P98 A;  1WL6 A;  2GTX A;  4U70 A;  4S2R P;  2BH3 A;  2GG8 A;  3TAV A;  5JFR A;  2GG7 A;  1QXY A;  3Q6D A;  1XGN A;  1JAW A;  2B3K A;  2IW2 A;  2GG3 A;  3S6B A;  1W2M A;  2EVC A;  2V3X A;  2OKN A;  4IPA A;  3PKB A;  4IDY A;  3IU9 A;  1WN1 A;  3PKE A;  4A6V A;  4IKR A;  4EGE A;  4PV4 A;  2GU5 A;  4JUQ A;  2EA2 A; 
#chains in the Genus database with same CATH topology
 4R60 A;  2V3Z A;  4FO7 A;  2GG5 A;  1BN5 A;  2P99 A;  2GU7 A;  3CB6 A;  5CDL A;  4MAT A;  1C22 A;  2OAZ A;  4U6W A;  1WL9 A;  3MX6 A;  4S00 A;  2ZSG A;  4ZWO A;  4S01 A;  1YW9 A;  4KM3 A;  4A6W A;  5JI6 A;  1CHM A;  1R5H A;  2NQ6 A;  4RGZ 1;  5CE6 A;  1C27 A;  3FMR A;  1C23 A;  3BIP A;  2BB7 A;  3IU7 A;  1B59 A;  4IU6 A;  3L24 A;  2BHD A;  2BWV A;  4U73 A;  3D27 A;  2GA2 A;  5CDE A;  2BWU A;  2BWT A;  3TB5 A;  2Q8K A;  3MAT A;  4FKC A;  3PKA A;  1Y1N A;  4FLK A;  2B3L A;  4U6J A;  3ROR A;  4IF7 A;  3PKD A;  4QR8 A;  1N51 A;  3FMQ A;  1PV9 A;  4IKS A;  4OOK A;  2GGB A;  3CTZ A;  1C21 A;  1M35 A;  2MAT A;  5FCF A;  1YW8 A;  1XGS A;  4FLL A;  4HXX A;  4IKU A;  4PNC A;  1XNZ A;  5D6E A;  3BIT A;  3IU8 A;  4B28 A;  1XGO A;  2ADU A;  4U6C A;  2GZ5 A;  5CIK A;  4ZWU A;  1KQ9 A;  2GGC A;  1KQ0 A;  2BWW A;  4Z7M A;  4U6E A;  1YJ3 A;  5D6F A;  2EVM A;  4U76 A;  4U71 A;  4RZY A;  2GU6 A;  4IEC A;  1C24 A;  1R5G A;  4RZZ A;  1B6A A;  2BHC A;  3IG4 A;  2EVO A;  5CNX A;  1O0X A;  2G6P A;  3CB5 A;  3FM3 A;  1QXW A;  1YW7 A;  5FCH A;  2GU4 A;  1A16 A;  2V6C A;  1WY2 A;  1W7V A;  1WLR A;  4ZNG A;  3RVA A;  2P9A A;  3BIQ A;  2BWS A;  2GG0 A;  4IKT A;  4FUK A;  2BHB A;  2B3H A;  5CDV A;  2EA4 A;  2Q94 A;  1KP0 A;  4U75 A;  2GG9 A;  2BWX A;  1QZY A;  1WBQ A;  2Q95 A;  2BN7 A;  1R58 A;  2V3Y A;  4FLJ A;  4U69 A;  4U1B A;  5E5B A;  1BOA A;  4ZWP A;  2GG2 A;  2NQ7 A;  4U6Z A;  1QXZ A;  2Q93 A;  4FLI A;  5JHU A;  5CLS A;  4S2T P;  2DFI A;  4FO8 A;  1WKM A;  3L7G A;  1XGM A;  2Q96 A;  3MR1 A;  1YVM A;  3PKC A;  1MAT A;  2BHA A;  2BWY A;  2HOW A;  2Q92 A;  2P98 A;  1WL6 A;  2GTX A;  4U70 A;  4S2R P;  2BH3 A;  2GG8 A;  3TAV A;  5JFR A;  2GG7 A;  1QXY A;  3Q6D A;  1XGN A;  1JAW A;  2B3K A;  2IW2 A;  2GG3 A;  3S6B A;  1W2M A;  2EVC A;  2V3X A;  2OKN A;  4IPA A;  3PKB A;  4IDY A;  3IU9 A;  1WN1 A;  3PKE A;  4A6V A;  4IKR A;  4EGE A;  4PV4 A;  2GU5 A;  4JUQ A;  2EA2 A; 
#chains in the Genus database with same CATH homology
 4R60 A;  2V3Z A;  4FO7 A;  2GG5 A;  1BN5 A;  2P99 A;  2GU7 A;  3CB6 A;  5CDL A;  4MAT A;  1C22 A;  2OAZ A;  4U6W A;  1WL9 A;  3MX6 A;  4S00 A;  2ZSG A;  4ZWO A;  4S01 A;  1YW9 A;  4KM3 A;  4A6W A;  5JI6 A;  1CHM A;  1R5H A;  2NQ6 A;  4RGZ 1;  5CE6 A;  1C27 A;  3FMR A;  1C23 A;  3BIP A;  2BB7 A;  3IU7 A;  1B59 A;  4IU6 A;  3L24 A;  2BHD A;  2BWV A;  4U73 A;  3D27 A;  2GA2 A;  5CDE A;  2BWU A;  2BWT A;  3TB5 A;  2Q8K A;  3MAT A;  4FKC A;  3PKA A;  1Y1N A;  4FLK A;  2B3L A;  4U6J A;  3ROR A;  4IF7 A;  3PKD A;  4QR8 A;  1N51 A;  3FMQ A;  1PV9 A;  4IKS A;  4OOK A;  2GGB A;  3CTZ A;  1C21 A;  1M35 A;  2MAT A;  5FCF A;  1YW8 A;  1XGS A;  4FLL A;  4HXX A;  4IKU A;  4PNC A;  1XNZ A;  5D6E A;  3BIT A;  3IU8 A;  4B28 A;  1XGO A;  2ADU A;  4U6C A;  2GZ5 A;  5CIK A;  4ZWU A;  1KQ9 A;  2GGC A;  1KQ0 A;  2BWW A;  4Z7M A;  4U6E A;  1YJ3 A;  5D6F A;  2EVM A;  4U76 A;  4U71 A;  4RZY A;  2GU6 A;  4IEC A;  1C24 A;  1R5G A;  4RZZ A;  1B6A A;  2BHC A;  3IG4 A;  2EVO A;  5CNX A;  1O0X A;  2G6P A;  3CB5 A;  3FM3 A;  1QXW A;  1YW7 A;  5FCH A;  2GU4 A;  1A16 A;  2V6C A;  1WY2 A;  1W7V A;  1WLR A;  4ZNG A;  3RVA A;  2P9A A;  3BIQ A;  2BWS A;  2GG0 A;  4IKT A;  4FUK A;  2BHB A;  2B3H A;  5CDV A;  2EA4 A;  2Q94 A;  1KP0 A;  4U75 A;  2GG9 A;  2BWX A;  1QZY A;  1WBQ A;  2Q95 A;  2BN7 A;  1R58 A;  2V3Y A;  4FLJ A;  4U69 A;  4U1B A;  5E5B A;  1BOA A;  4ZWP A;  2GG2 A;  2NQ7 A;  4U6Z A;  1QXZ A;  2Q93 A;  4FLI A;  5JHU A;  5CLS A;  4S2T P;  2DFI A;  4FO8 A;  1WKM A;  3L7G A;  1XGM A;  2Q96 A;  3MR1 A;  1YVM A;  3PKC A;  1MAT A;  2BHA A;  2BWY A;  2HOW A;  2Q92 A;  2P98 A;  1WL6 A;  2GTX A;  4U70 A;  4S2R P;  2BH3 A;  2GG8 A;  3TAV A;  5JFR A;  2GG7 A;  1QXY A;  3Q6D A;  1XGN A;  1JAW A;  2B3K A;  2IW2 A;  2GG3 A;  3S6B A;  1W2M A;  2EVC A;  2V3X A;  2OKN A;  4IPA A;  3PKB A;  4IDY A;  3IU9 A;  1WN1 A;  3PKE A;  4A6V A;  4IKR A;  4EGE A;  4PV4 A;  2GU5 A;  4JUQ A;  2EA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...