2NQ7A

Crystal structure of type 1 human methionine aminopeptidase in complex with 3-(2,2-dimethylpropionylamino)pyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq7A00
4IKSA 2GGCA 3CTZA 4IDYA 1WLRA 2BHBA 2V6CA 4PV4A 2Q92A 2V3YA 4U69A 5FCFA 4ZWUA 2EVMA 2BWTA 2V3ZA 1KQ0A 2GZ5A 5JFRA 1JAWA 1WN1A 3MX6A 4U75A 3D27A 2EVOA 2GG8A 4FLLA 1BOAA 1QZYA 4HXXA 4IF7A 1YW8A 2Q93A 2ADUA 2BB7A 4FLKA 1YJ3A 4U6CA 1XNZA 4B28A 3PKAA 4IKTA 2GA2A 5CDEA 2GU6A 2P99A 4U76A 2BHAA 5CNXA 3BITA 4IPAA 5FCHA 5D6EA 4U70A 1CHMA 1YW9A 1WKMA 1WBQA 2GGBA 1QXYA 1KP0A 2Q94A 5D6FA 3IU7A 2NQ6A 1XGOA 3PKEA 4S2RP 3IU9A 5E5BA 2EVCA 3Q6DA 2GG2A 2GG9A 1XGNA 2GG5A 2MATA 3CB6A 4FLIA 2GG3A 3MATA 1XGSA 2Q8KA 1C24A 1W7VA 2G6PA 2OAZA 4IKRA 3FM3A 4RZZA 1YW7A 2B3HA 1C27A 5CDVA 2BWUA 1C21A 2GTXA 3PKBA 2GG7A 5CDLA 4IU6A 1A16A 4PNCA 2GU5A 5JHUA 4JUQA 2GU7A 3FMRA 2BWVA 4QR8A 2BWWA 4A6VA 2P9AA 4U1BA 4A6WA 2BHDA 4RZYA 1C22A 4OOKA 5CE6A 1WL6A 4KM3A 5JI6A 2BHCA 4S2TP 1O0XA 2GU4A 4Z7MA 2B3KA 2BWXA 3MR1A 2EA2A 2GG0A 1M35A 2V3XA 4FKCA 1PV9A 4FO8A 4R60A 3TAVA 4ZNGA 1YVMA 2Q96A 1WL9A 4S01A 2IW2A 3L24A 2DFIA 1R5GA 4U6EA 3RORA 4U71A 1R5HA 2BN7A 2P98A 3CB5A 3TB5A 1XGMA 4U73A 4ZWOA 4EGEA 2ZSGA 1R58A 3PKDA 2HOWA 4U6WA 1Y1NA 2BWYA 4U6ZA 2B3LA 3PKCA 4FUKA 1QXWA 4S00A 4IKUA 3RVAA 2BWSA 3S6BA 3BIQA 4ZWPA 1N51A 3IU8A 4U6JA 1B59A 2Q95A 1C23A 1MATA 1BN5A 1W2MA 2NQ7A 3FMQA 4IECA 5CIKA 4RGZ1 4FO7A 2OKNA 4FLJA 3IG4A 1WY2A 2BH3A 3BIPA 4MATA 2EA4A 1KQ9A 1B6AA 5CLSA 1QXZA 3L7GA
chains in the Genus database with same CATH superfamily
4IKSA 2GGCA 3CTZA 4IDYA 1WLRA 2BHBA 2V6CA 4PV4A 2Q92A 2V3YA 4U69A 5FCFA 4ZWUA 2EVMA 2BWTA 2V3ZA 1KQ0A 2GZ5A 5JFRA 1JAWA 1WN1A 3MX6A 4U75A 3D27A 2EVOA 2GG8A 4FLLA 1BOAA 1QZYA 4HXXA 4IF7A 1YW8A 2Q93A 2ADUA 2BB7A 4FLKA 1YJ3A 4U6CA 1XNZA 4B28A 3PKAA 4IKTA 2GA2A 5CDEA 2GU6A 2P99A 4U76A 2BHAA 5CNXA 3BITA 4IPAA 5FCHA 5D6EA 4U70A 1CHMA 1YW9A 1WKMA 1WBQA 2GGBA 1QXYA 1KP0A 2Q94A 5D6FA 3IU7A 2NQ6A 1XGOA 3PKEA 4S2RP 3IU9A 5E5BA 2EVCA 3Q6DA 2GG2A 2GG9A 1XGNA 2GG5A 2MATA 3CB6A 4FLIA 2GG3A 3MATA 1XGSA 2Q8KA 1C24A 1W7VA 2G6PA 2OAZA 4IKRA 3FM3A 4RZZA 1YW7A 2B3HA 1C27A 5CDVA 2BWUA 1C21A 2GTXA 3PKBA 2GG7A 5CDLA 4IU6A 1A16A 4PNCA 2GU5A 5JHUA 4JUQA 2GU7A 3FMRA 2BWVA 4QR8A 2BWWA 4A6VA 2P9AA 4U1BA 4A6WA 2BHDA 4RZYA 1C22A 4OOKA 5CE6A 1WL6A 4KM3A 5JI6A 2BHCA 4S2TP 1O0XA 2GU4A 4Z7MA 2B3KA 2BWXA 3MR1A 2EA2A 2GG0A 1M35A 2V3XA 4FKCA 1PV9A 4FO8A 4R60A 3TAVA 4ZNGA 1YVMA 2Q96A 1WL9A 4S01A 2IW2A 3L24A 2DFIA 1R5GA 4U6EA 3RORA 4U71A 1R5HA 2BN7A 2P98A 3CB5A 3TB5A 1XGMA 4U73A 4ZWOA 4EGEA 2ZSGA 1R58A 3PKDA 2HOWA 4U6WA 1Y1NA 2BWYA 4U6ZA 2B3LA 3PKCA 4FUKA 1QXWA 4S00A 4IKUA 3RVAA 2BWSA 3S6BA 3BIQA 4ZWPA 1N51A 3IU8A 4U6JA 1B59A 2Q95A 1C23A 1MATA 1BN5A 1W2MA 2NQ7A 3FMQA 4IECA 5CIKA 4RGZ1 4FO7A 2OKNA 4FLJA 3IG4A 1WY2A 2BH3A 3BIPA 4MATA 2EA4A 1KQ9A 1B6AA 5CLSA 1QXZA 3L7GA
chains in the Genus database with same CATH topology
4IKSA 2GGCA 3CTZA 4IDYA 1WLRA 2BHBA 2V6CA 4PV4A 2Q92A 2V3YA 4U69A 5FCFA 4ZWUA 2EVMA 2BWTA 2V3ZA 1KQ0A 2GZ5A 5JFRA 1JAWA 1WN1A 3MX6A 4U75A 3D27A 2EVOA 2GG8A 4FLLA 1BOAA 1QZYA 4HXXA 4IF7A 1YW8A 2Q93A 2ADUA 2BB7A 4FLKA 1YJ3A 4U6CA 1XNZA 4B28A 3PKAA 4IKTA 2GA2A 5CDEA 2GU6A 2P99A 4U76A 2BHAA 5CNXA 3BITA 4IPAA 5FCHA 5D6EA 4U70A 1CHMA 1YW9A 1WKMA 1WBQA 2GGBA 1QXYA 1KP0A 2Q94A 5D6FA 3IU7A 2NQ6A 1XGOA 3PKEA 4S2RP 3IU9A 5E5BA 2EVCA 3Q6DA 2GG2A 2GG9A 1XGNA 2GG5A 2MATA 3CB6A 4FLIA 2GG3A 3MATA 1XGSA 2Q8KA 1C24A 1W7VA 2G6PA 2OAZA 4IKRA 3FM3A 4RZZA 1YW7A 2B3HA 1C27A 5CDVA 2BWUA 1C21A 2GTXA 3PKBA 2GG7A 5CDLA 4IU6A 1A16A 4PNCA 2GU5A 5JHUA 4JUQA 2GU7A 3FMRA 2BWVA 4QR8A 2BWWA 4A6VA 2P9AA 4U1BA 4A6WA 2BHDA 4RZYA 1C22A 4OOKA 5CE6A 1WL6A 4KM3A 5JI6A 2BHCA 4S2TP 1O0XA 2GU4A 4Z7MA 2B3KA 2BWXA 3MR1A 2EA2A 2GG0A 1M35A 2V3XA 4FKCA 1PV9A 4FO8A 4R60A 3TAVA 4ZNGA 1YVMA 2Q96A 1WL9A 4S01A 2IW2A 3L24A 2DFIA 1R5GA 4U6EA 3RORA 4U71A 1R5HA 2BN7A 2P98A 3CB5A 3TB5A 1XGMA 4U73A 4ZWOA 4EGEA 2ZSGA 1R58A 3PKDA 2HOWA 4U6WA 1Y1NA 2BWYA 4U6ZA 2B3LA 3PKCA 4FUKA 1QXWA 4S00A 4IKUA 3RVAA 2BWSA 3S6BA 3BIQA 4ZWPA 1N51A 3IU8A 4U6JA 1B59A 2Q95A 1C23A 1MATA 1BN5A 1W2MA 2NQ7A 3FMQA 4IECA 5CIKA 4RGZ1 4FO7A 2OKNA 4FLJA 3IG4A 1WY2A 2BH3A 3BIPA 4MATA 2EA4A 1KQ9A 1B6AA 5CLSA 1QXZA 3L7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKS A;  2GGC A;  3CTZ A;  4IDY A;  1WLR A;  2BHB A;  2V6C A;  4PV4 A;  2Q92 A;  2V3Y A;  4U69 A;  5FCF A;  4ZWU A;  2EVM A;  2BWT A;  2V3Z A;  1KQ0 A;  2GZ5 A;  5JFR A;  1JAW A;  1WN1 A;  3MX6 A;  4U75 A;  3D27 A;  2EVO A;  2GG8 A;  4FLL A;  1BOA A;  1QZY A;  4HXX A;  4IF7 A;  1YW8 A;  2Q93 A;  2ADU A;  2BB7 A;  4FLK A;  1YJ3 A;  4U6C A;  1XNZ A;  4B28 A;  3PKA A;  4IKT A;  2GA2 A;  5CDE A;  2GU6 A;  2P99 A;  4U76 A;  2BHA A;  5CNX A;  3BIT A;  4IPA A;  5FCH A;  5D6E A;  4U70 A;  1CHM A;  1YW9 A;  1WKM A;  1WBQ A;  2GGB A;  1QXY A;  1KP0 A;  2Q94 A;  5D6F A;  3IU7 A;  2NQ6 A;  1XGO A;  3PKE A;  4S2R P;  3IU9 A;  5E5B A;  2EVC A;  3Q6D A;  2GG2 A;  2GG9 A;  1XGN A;  2GG5 A;  2MAT A;  3CB6 A;  4FLI A;  2GG3 A;  3MAT A;  1XGS A;  2Q8K A;  1C24 A;  1W7V A;  2G6P A;  2OAZ A;  4IKR A;  3FM3 A;  4RZZ A;  1YW7 A;  2B3H A;  1C27 A;  5CDV A;  2BWU A;  1C21 A;  2GTX A;  3PKB A;  2GG7 A;  5CDL A;  4IU6 A;  1A16 A;  4PNC A;  2GU5 A;  5JHU A;  4JUQ A;  2GU7 A;  3FMR A;  2BWV A;  4QR8 A;  2BWW A;  4A6V A;  2P9A A;  4U1B A;  4A6W A;  2BHD A;  4RZY A;  1C22 A;  4OOK A;  5CE6 A;  1WL6 A;  4KM3 A;  5JI6 A;  2BHC A;  4S2T P;  1O0X A;  2GU4 A;  4Z7M A;  2B3K A;  2BWX A;  3MR1 A;  2EA2 A;  2GG0 A;  1M35 A;  2V3X A;  4FKC A;  1PV9 A;  4FO8 A;  4R60 A;  3TAV A;  4ZNG A;  1YVM A;  2Q96 A;  1WL9 A;  4S01 A;  2IW2 A;  3L24 A;  2DFI A;  1R5G A;  4U6E A;  3ROR A;  4U71 A;  1R5H A;  2BN7 A;  2P98 A;  3CB5 A;  3TB5 A;  1XGM A;  4U73 A;  4ZWO A;  4EGE A;  2ZSG A;  1R58 A;  3PKD A;  2HOW A;  4U6W A;  1Y1N A;  2BWY A;  4U6Z A;  2B3L A;  3PKC A;  4FUK A;  1QXW A;  4S00 A;  4IKU A;  3RVA A;  2BWS A;  3S6B A;  3BIQ A;  4ZWP A;  1N51 A;  3IU8 A;  4U6J A;  1B59 A;  2Q95 A;  1C23 A;  1MAT A;  1BN5 A;  1W2M A;  2NQ7 A;  3FMQ A;  4IEC A;  5CIK A;  4RGZ 1;  4FO7 A;  2OKN A;  4FLJ A;  3IG4 A;  1WY2 A;  2BH3 A;  3BIP A;  4MAT A;  2EA4 A;  1KQ9 A;  1B6A A;  5CLS A;  1QXZ A;  3L7G A; 
#chains in the Genus database with same CATH topology
 4IKS A;  2GGC A;  3CTZ A;  4IDY A;  1WLR A;  2BHB A;  2V6C A;  4PV4 A;  2Q92 A;  2V3Y A;  4U69 A;  5FCF A;  4ZWU A;  2EVM A;  2BWT A;  2V3Z A;  1KQ0 A;  2GZ5 A;  5JFR A;  1JAW A;  1WN1 A;  3MX6 A;  4U75 A;  3D27 A;  2EVO A;  2GG8 A;  4FLL A;  1BOA A;  1QZY A;  4HXX A;  4IF7 A;  1YW8 A;  2Q93 A;  2ADU A;  2BB7 A;  4FLK A;  1YJ3 A;  4U6C A;  1XNZ A;  4B28 A;  3PKA A;  4IKT A;  2GA2 A;  5CDE A;  2GU6 A;  2P99 A;  4U76 A;  2BHA A;  5CNX A;  3BIT A;  4IPA A;  5FCH A;  5D6E A;  4U70 A;  1CHM A;  1YW9 A;  1WKM A;  1WBQ A;  2GGB A;  1QXY A;  1KP0 A;  2Q94 A;  5D6F A;  3IU7 A;  2NQ6 A;  1XGO A;  3PKE A;  4S2R P;  3IU9 A;  5E5B A;  2EVC A;  3Q6D A;  2GG2 A;  2GG9 A;  1XGN A;  2GG5 A;  2MAT A;  3CB6 A;  4FLI A;  2GG3 A;  3MAT A;  1XGS A;  2Q8K A;  1C24 A;  1W7V A;  2G6P A;  2OAZ A;  4IKR A;  3FM3 A;  4RZZ A;  1YW7 A;  2B3H A;  1C27 A;  5CDV A;  2BWU A;  1C21 A;  2GTX A;  3PKB A;  2GG7 A;  5CDL A;  4IU6 A;  1A16 A;  4PNC A;  2GU5 A;  5JHU A;  4JUQ A;  2GU7 A;  3FMR A;  2BWV A;  4QR8 A;  2BWW A;  4A6V A;  2P9A A;  4U1B A;  4A6W A;  2BHD A;  4RZY A;  1C22 A;  4OOK A;  5CE6 A;  1WL6 A;  4KM3 A;  5JI6 A;  2BHC A;  4S2T P;  1O0X A;  2GU4 A;  4Z7M A;  2B3K A;  2BWX A;  3MR1 A;  2EA2 A;  2GG0 A;  1M35 A;  2V3X A;  4FKC A;  1PV9 A;  4FO8 A;  4R60 A;  3TAV A;  4ZNG A;  1YVM A;  2Q96 A;  1WL9 A;  4S01 A;  2IW2 A;  3L24 A;  2DFI A;  1R5G A;  4U6E A;  3ROR A;  4U71 A;  1R5H A;  2BN7 A;  2P98 A;  3CB5 A;  3TB5 A;  1XGM A;  4U73 A;  4ZWO A;  4EGE A;  2ZSG A;  1R58 A;  3PKD A;  2HOW A;  4U6W A;  1Y1N A;  2BWY A;  4U6Z A;  2B3L A;  3PKC A;  4FUK A;  1QXW A;  4S00 A;  4IKU A;  3RVA A;  2BWS A;  3S6B A;  3BIQ A;  4ZWP A;  1N51 A;  3IU8 A;  4U6J A;  1B59 A;  2Q95 A;  1C23 A;  1MAT A;  1BN5 A;  1W2M A;  2NQ7 A;  3FMQ A;  4IEC A;  5CIK A;  4RGZ 1;  4FO7 A;  2OKN A;  4FLJ A;  3IG4 A;  1WY2 A;  2BH3 A;  3BIP A;  4MAT A;  2EA4 A;  1KQ9 A;  1B6A A;  5CLS A;  1QXZ A;  3L7G A; 
#chains in the Genus database with same CATH homology
 4IKS A;  2GGC A;  3CTZ A;  4IDY A;  1WLR A;  2BHB A;  2V6C A;  4PV4 A;  2Q92 A;  2V3Y A;  4U69 A;  5FCF A;  4ZWU A;  2EVM A;  2BWT A;  2V3Z A;  1KQ0 A;  2GZ5 A;  5JFR A;  1JAW A;  1WN1 A;  3MX6 A;  4U75 A;  3D27 A;  2EVO A;  2GG8 A;  4FLL A;  1BOA A;  1QZY A;  4HXX A;  4IF7 A;  1YW8 A;  2Q93 A;  2ADU A;  2BB7 A;  4FLK A;  1YJ3 A;  4U6C A;  1XNZ A;  4B28 A;  3PKA A;  4IKT A;  2GA2 A;  5CDE A;  2GU6 A;  2P99 A;  4U76 A;  2BHA A;  5CNX A;  3BIT A;  4IPA A;  5FCH A;  5D6E A;  4U70 A;  1CHM A;  1YW9 A;  1WKM A;  1WBQ A;  2GGB A;  1QXY A;  1KP0 A;  2Q94 A;  5D6F A;  3IU7 A;  2NQ6 A;  1XGO A;  3PKE A;  4S2R P;  3IU9 A;  5E5B A;  2EVC A;  3Q6D A;  2GG2 A;  2GG9 A;  1XGN A;  2GG5 A;  2MAT A;  3CB6 A;  4FLI A;  2GG3 A;  3MAT A;  1XGS A;  2Q8K A;  1C24 A;  1W7V A;  2G6P A;  2OAZ A;  4IKR A;  3FM3 A;  4RZZ A;  1YW7 A;  2B3H A;  1C27 A;  5CDV A;  2BWU A;  1C21 A;  2GTX A;  3PKB A;  2GG7 A;  5CDL A;  4IU6 A;  1A16 A;  4PNC A;  2GU5 A;  5JHU A;  4JUQ A;  2GU7 A;  3FMR A;  2BWV A;  4QR8 A;  2BWW A;  4A6V A;  2P9A A;  4U1B A;  4A6W A;  2BHD A;  4RZY A;  1C22 A;  4OOK A;  5CE6 A;  1WL6 A;  4KM3 A;  5JI6 A;  2BHC A;  4S2T P;  1O0X A;  2GU4 A;  4Z7M A;  2B3K A;  2BWX A;  3MR1 A;  2EA2 A;  2GG0 A;  1M35 A;  2V3X A;  4FKC A;  1PV9 A;  4FO8 A;  4R60 A;  3TAV A;  4ZNG A;  1YVM A;  2Q96 A;  1WL9 A;  4S01 A;  2IW2 A;  3L24 A;  2DFI A;  1R5G A;  4U6E A;  3ROR A;  4U71 A;  1R5H A;  2BN7 A;  2P98 A;  3CB5 A;  3TB5 A;  1XGM A;  4U73 A;  4ZWO A;  4EGE A;  2ZSG A;  1R58 A;  3PKD A;  2HOW A;  4U6W A;  1Y1N A;  2BWY A;  4U6Z A;  2B3L A;  3PKC A;  4FUK A;  1QXW A;  4S00 A;  4IKU A;  3RVA A;  2BWS A;  3S6B A;  3BIQ A;  4ZWP A;  1N51 A;  3IU8 A;  4U6J A;  1B59 A;  2Q95 A;  1C23 A;  1MAT A;  1BN5 A;  1W2M A;  2NQ7 A;  3FMQ A;  4IEC A;  5CIK A;  4RGZ 1;  4FO7 A;  2OKN A;  4FLJ A;  3IG4 A;  1WY2 A;  2BH3 A;  3BIP A;  4MAT A;  2EA4 A;  1KQ9 A;  1B6A A;  5CLS A;  1QXZ A;  3L7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...