4IU6A

Human methionine aminopeptidase in complex with fz1: pyridinylquinazolines selectively inhibit human methionine aminopeptidase-1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Pyridinylquinazolines selectively inhibit human methionine aminopeptidase-1 in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF15801 zf-C6H2 zf-MYND-like zinc finger, mRNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iu6A00
3CB6A 3L7GA 2OAZA 4U6CA 1YW9A 3TB5A 4U6ZA 4IPAA 1JAWA 1WL6A 4FLLA 5D6EA 1YJ3A 2EVCA 2GGBA 4EGEA 4IKSA 2V3ZA 5CIKA 2P9AA 1B6AA 1C21A 3IU7A 5CNXA 4PNCA 2Q8KA 2HOWA 2Q96A 3S6BA 1WY2A 2BHBA 4KM3A 1B59A 2BN7A 2EVOA 4MATA 2BWXA 1YW8A 4IDYA 4A6VA 2BWWA 4U75A 2GG9A 3MX6A 2GG7A 5CDEA 4U76A 1XGOA 4ZWUA 2V3XA 2ADUA 2BWTA 2G6PA 2P98A 1WL9A 4ZWPA 3PKBA 1MATA 2Q95A 5CDLA 2GU7A 1N51A 3MATA 2BHDA 4S01A 1WKMA 3PKCA 2GGCA 4S2RP 2GA2A 3BIPA 2ZSGA 2GG8A 4Z7MA 1CHMA 1C22A 1WBQA 3BIQA 4R60A 4FLKA 4U69A 3CB5A 1YVMA 4U6EA 2P99A 4S00A 5E5BA 2BWYA 3PKEA 2GU4A 2GU5A 1W7VA 1BN5A 3MR1A 1C23A 1KQ9A 4FLIA 3RVAA 1YW7A 2V3YA 4IKTA 4U71A 5CDVA 3Q6DA 4JUQA 2BHAA 2GG2A 1BOAA 4B28A 2OKNA 4HXXA 4ZWOA 2B3KA 2BH3A 2GTXA 3FM3A 3IU8A 1W2MA 2EA4A 4FO7A 2BWVA 2V6CA 4RZYA 4PV4A 5CLSA 1QXZA 2EA2A 2NQ6A 3IG4A 3PKDA 4QR8A 2BHCA 1WLRA 4RGZ1 5JFRA 1C27A 2GU6A 2IW2A 1XGMA 3CTZA 1A16A 5FCHA 1M35A 4ZNGA 4RZZA 2GG0A 5D6FA 1O0XA 3FMQA 4IKUA 1PV9A 4IKRA 2MATA 1Y1NA 3D27A 4A6WA 2BWSA 4IF7A 2B3LA 2BWUA 1XGSA 2Q93A 4U73A 2DFIA 1XNZA 2GG5A 2GZ5A 4FKCA 1QZYA 1R58A 1KP0A 1R5HA 1XGNA 2NQ7A 3IU9A 5CE6A 4U6JA 3PKAA 3RORA 4U1BA 3L24A 3BITA 4S2TP 2EVMA 4IECA 2GG3A 2Q92A 4U6WA 3TAVA 1R5GA 1QXYA 1C24A 4FUKA 5JI6A 2BB7A 5JHUA 2B3HA 4U70A 4OOKA 1KQ0A 3FMRA 1QXWA 2Q94A 1WN1A 4FLJA 4FO8A 5FCFA 4IU6A
chains in the Genus database with same CATH superfamily
3CB6A 3L7GA 2OAZA 4U6CA 1YW9A 3TB5A 4U6ZA 4IPAA 1JAWA 1WL6A 4FLLA 5D6EA 1YJ3A 2EVCA 2GGBA 4EGEA 4IKSA 2V3ZA 5CIKA 2P9AA 1B6AA 1C21A 3IU7A 5CNXA 4PNCA 2Q8KA 2HOWA 2Q96A 3S6BA 1WY2A 2BHBA 4KM3A 1B59A 2BN7A 2EVOA 4MATA 2BWXA 1YW8A 4IDYA 4A6VA 2BWWA 4U75A 2GG9A 3MX6A 2GG7A 5CDEA 4U76A 1XGOA 4ZWUA 2V3XA 2ADUA 2BWTA 2G6PA 2P98A 1WL9A 4ZWPA 3PKBA 1MATA 2Q95A 5CDLA 2GU7A 1N51A 3MATA 2BHDA 4S01A 1WKMA 3PKCA 2GGCA 4S2RP 2GA2A 3BIPA 2ZSGA 2GG8A 4Z7MA 1CHMA 1C22A 1WBQA 3BIQA 4R60A 4FLKA 4U69A 3CB5A 1YVMA 4U6EA 2P99A 4S00A 5E5BA 2BWYA 3PKEA 2GU4A 2GU5A 1W7VA 1BN5A 3MR1A 1C23A 1KQ9A 4FLIA 3RVAA 1YW7A 2V3YA 4IKTA 4U71A 5CDVA 3Q6DA 4JUQA 2BHAA 2GG2A 1BOAA 4B28A 2OKNA 4HXXA 4ZWOA 2B3KA 2BH3A 2GTXA 3FM3A 3IU8A 1W2MA 2EA4A 4FO7A 2BWVA 2V6CA 4RZYA 4PV4A 5CLSA 1QXZA 2EA2A 2NQ6A 3IG4A 3PKDA 4QR8A 2BHCA 1WLRA 4RGZ1 5JFRA 1C27A 2GU6A 2IW2A 1XGMA 3CTZA 1A16A 5FCHA 1M35A 4ZNGA 4RZZA 2GG0A 5D6FA 1O0XA 3FMQA 4IKUA 1PV9A 4IKRA 2MATA 1Y1NA 3D27A 4A6WA 2BWSA 4IF7A 2B3LA 2BWUA 1XGSA 2Q93A 4U73A 2DFIA 1XNZA 2GG5A 2GZ5A 4FKCA 1QZYA 1R58A 1KP0A 1R5HA 1XGNA 2NQ7A 3IU9A 5CE6A 4U6JA 3PKAA 3RORA 4U1BA 3L24A 3BITA 4S2TP 2EVMA 4IECA 2GG3A 2Q92A 4U6WA 3TAVA 1R5GA 1QXYA 1C24A 4FUKA 5JI6A 2BB7A 5JHUA 2B3HA 4U70A 4OOKA 1KQ0A 3FMRA 1QXWA 2Q94A 1WN1A 4FLJA 4FO8A 5FCFA 4IU6A
chains in the Genus database with same CATH topology
3CB6A 3L7GA 2OAZA 4U6CA 1YW9A 3TB5A 4U6ZA 4IPAA 1JAWA 1WL6A 4FLLA 5D6EA 1YJ3A 2EVCA 2GGBA 4EGEA 4IKSA 2V3ZA 5CIKA 2P9AA 1B6AA 1C21A 3IU7A 5CNXA 4PNCA 2Q8KA 2HOWA 2Q96A 3S6BA 1WY2A 2BHBA 4KM3A 1B59A 2BN7A 2EVOA 4MATA 2BWXA 1YW8A 4IDYA 4A6VA 2BWWA 4U75A 2GG9A 3MX6A 2GG7A 5CDEA 4U76A 1XGOA 4ZWUA 2V3XA 2ADUA 2BWTA 2G6PA 2P98A 1WL9A 4ZWPA 3PKBA 1MATA 2Q95A 5CDLA 2GU7A 1N51A 3MATA 2BHDA 4S01A 1WKMA 3PKCA 2GGCA 4S2RP 2GA2A 3BIPA 2ZSGA 2GG8A 4Z7MA 1CHMA 1C22A 1WBQA 3BIQA 4R60A 4FLKA 4U69A 3CB5A 1YVMA 4U6EA 2P99A 4S00A 5E5BA 2BWYA 3PKEA 2GU4A 2GU5A 1W7VA 1BN5A 3MR1A 1C23A 1KQ9A 4FLIA 3RVAA 1YW7A 2V3YA 4IKTA 4U71A 5CDVA 3Q6DA 4JUQA 2BHAA 2GG2A 1BOAA 4B28A 2OKNA 4HXXA 4ZWOA 2B3KA 2BH3A 2GTXA 3FM3A 3IU8A 1W2MA 2EA4A 4FO7A 2BWVA 2V6CA 4RZYA 4PV4A 5CLSA 1QXZA 2EA2A 2NQ6A 3IG4A 3PKDA 4QR8A 2BHCA 1WLRA 4RGZ1 5JFRA 1C27A 2GU6A 2IW2A 1XGMA 3CTZA 1A16A 5FCHA 1M35A 4ZNGA 4RZZA 2GG0A 5D6FA 1O0XA 3FMQA 4IKUA 1PV9A 4IKRA 2MATA 1Y1NA 3D27A 4A6WA 2BWSA 4IF7A 2B3LA 2BWUA 1XGSA 2Q93A 4U73A 2DFIA 1XNZA 2GG5A 2GZ5A 4FKCA 1QZYA 1R58A 1KP0A 1R5HA 1XGNA 2NQ7A 3IU9A 5CE6A 4U6JA 3PKAA 3RORA 4U1BA 3L24A 3BITA 4S2TP 2EVMA 4IECA 2GG3A 2Q92A 4U6WA 3TAVA 1R5GA 1QXYA 1C24A 4FUKA 5JI6A 2BB7A 5JHUA 2B3HA 4U70A 4OOKA 1KQ0A 3FMRA 1QXWA 2Q94A 1WN1A 4FLJA 4FO8A 5FCFA 4IU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CB6 A;  3L7G A;  2OAZ A;  4U6C A;  1YW9 A;  3TB5 A;  4U6Z A;  4IPA A;  1JAW A;  1WL6 A;  4FLL A;  5D6E A;  1YJ3 A;  2EVC A;  2GGB A;  4EGE A;  4IKS A;  2V3Z A;  5CIK A;  2P9A A;  1B6A A;  1C21 A;  3IU7 A;  5CNX A;  4PNC A;  2Q8K A;  2HOW A;  2Q96 A;  3S6B A;  1WY2 A;  2BHB A;  4KM3 A;  1B59 A;  2BN7 A;  2EVO A;  4MAT A;  2BWX A;  1YW8 A;  4IDY A;  4A6V A;  2BWW A;  4U75 A;  2GG9 A;  3MX6 A;  2GG7 A;  5CDE A;  4U76 A;  1XGO A;  4ZWU A;  2V3X A;  2ADU A;  2BWT A;  2G6P A;  2P98 A;  1WL9 A;  4ZWP A;  3PKB A;  1MAT A;  2Q95 A;  5CDL A;  2GU7 A;  1N51 A;  3MAT A;  2BHD A;  4S01 A;  1WKM A;  3PKC A;  2GGC A;  4S2R P;  2GA2 A;  3BIP A;  2ZSG A;  2GG8 A;  4Z7M A;  1CHM A;  1C22 A;  1WBQ A;  3BIQ A;  4R60 A;  4FLK A;  4U69 A;  3CB5 A;  1YVM A;  4U6E A;  2P99 A;  4S00 A;  5E5B A;  2BWY A;  3PKE A;  2GU4 A;  2GU5 A;  1W7V A;  1BN5 A;  3MR1 A;  1C23 A;  1KQ9 A;  4FLI A;  3RVA A;  1YW7 A;  2V3Y A;  4IKT A;  4U71 A;  5CDV A;  3Q6D A;  4JUQ A;  2BHA A;  2GG2 A;  1BOA A;  4B28 A;  2OKN A;  4HXX A;  4ZWO A;  2B3K A;  2BH3 A;  2GTX A;  3FM3 A;  3IU8 A;  1W2M A;  2EA4 A;  4FO7 A;  2BWV A;  2V6C A;  4RZY A;  4PV4 A;  5CLS A;  1QXZ A;  2EA2 A;  2NQ6 A;  3IG4 A;  3PKD A;  4QR8 A;  2BHC A;  1WLR A;  4RGZ 1;  5JFR A;  1C27 A;  2GU6 A;  2IW2 A;  1XGM A;  3CTZ A;  1A16 A;  5FCH A;  1M35 A;  4ZNG A;  4RZZ A;  2GG0 A;  5D6F A;  1O0X A;  3FMQ A;  4IKU A;  1PV9 A;  4IKR A;  2MAT A;  1Y1N A;  3D27 A;  4A6W A;  2BWS A;  4IF7 A;  2B3L A;  2BWU A;  1XGS A;  2Q93 A;  4U73 A;  2DFI A;  1XNZ A;  2GG5 A;  2GZ5 A;  4FKC A;  1QZY A;  1R58 A;  1KP0 A;  1R5H A;  1XGN A;  2NQ7 A;  3IU9 A;  5CE6 A;  4U6J A;  3PKA A;  3ROR A;  4U1B A;  3L24 A;  3BIT A;  4S2T P;  2EVM A;  4IEC A;  2GG3 A;  2Q92 A;  4U6W A;  3TAV A;  1R5G A;  1QXY A;  1C24 A;  4FUK A;  5JI6 A;  2BB7 A;  5JHU A;  2B3H A;  4U70 A;  4OOK A;  1KQ0 A;  3FMR A;  1QXW A;  2Q94 A;  1WN1 A;  4FLJ A;  4FO8 A;  5FCF A;  4IU6 A; 
#chains in the Genus database with same CATH topology
 3CB6 A;  3L7G A;  2OAZ A;  4U6C A;  1YW9 A;  3TB5 A;  4U6Z A;  4IPA A;  1JAW A;  1WL6 A;  4FLL A;  5D6E A;  1YJ3 A;  2EVC A;  2GGB A;  4EGE A;  4IKS A;  2V3Z A;  5CIK A;  2P9A A;  1B6A A;  1C21 A;  3IU7 A;  5CNX A;  4PNC A;  2Q8K A;  2HOW A;  2Q96 A;  3S6B A;  1WY2 A;  2BHB A;  4KM3 A;  1B59 A;  2BN7 A;  2EVO A;  4MAT A;  2BWX A;  1YW8 A;  4IDY A;  4A6V A;  2BWW A;  4U75 A;  2GG9 A;  3MX6 A;  2GG7 A;  5CDE A;  4U76 A;  1XGO A;  4ZWU A;  2V3X A;  2ADU A;  2BWT A;  2G6P A;  2P98 A;  1WL9 A;  4ZWP A;  3PKB A;  1MAT A;  2Q95 A;  5CDL A;  2GU7 A;  1N51 A;  3MAT A;  2BHD A;  4S01 A;  1WKM A;  3PKC A;  2GGC A;  4S2R P;  2GA2 A;  3BIP A;  2ZSG A;  2GG8 A;  4Z7M A;  1CHM A;  1C22 A;  1WBQ A;  3BIQ A;  4R60 A;  4FLK A;  4U69 A;  3CB5 A;  1YVM A;  4U6E A;  2P99 A;  4S00 A;  5E5B A;  2BWY A;  3PKE A;  2GU4 A;  2GU5 A;  1W7V A;  1BN5 A;  3MR1 A;  1C23 A;  1KQ9 A;  4FLI A;  3RVA A;  1YW7 A;  2V3Y A;  4IKT A;  4U71 A;  5CDV A;  3Q6D A;  4JUQ A;  2BHA A;  2GG2 A;  1BOA A;  4B28 A;  2OKN A;  4HXX A;  4ZWO A;  2B3K A;  2BH3 A;  2GTX A;  3FM3 A;  3IU8 A;  1W2M A;  2EA4 A;  4FO7 A;  2BWV A;  2V6C A;  4RZY A;  4PV4 A;  5CLS A;  1QXZ A;  2EA2 A;  2NQ6 A;  3IG4 A;  3PKD A;  4QR8 A;  2BHC A;  1WLR A;  4RGZ 1;  5JFR A;  1C27 A;  2GU6 A;  2IW2 A;  1XGM A;  3CTZ A;  1A16 A;  5FCH A;  1M35 A;  4ZNG A;  4RZZ A;  2GG0 A;  5D6F A;  1O0X A;  3FMQ A;  4IKU A;  1PV9 A;  4IKR A;  2MAT A;  1Y1N A;  3D27 A;  4A6W A;  2BWS A;  4IF7 A;  2B3L A;  2BWU A;  1XGS A;  2Q93 A;  4U73 A;  2DFI A;  1XNZ A;  2GG5 A;  2GZ5 A;  4FKC A;  1QZY A;  1R58 A;  1KP0 A;  1R5H A;  1XGN A;  2NQ7 A;  3IU9 A;  5CE6 A;  4U6J A;  3PKA A;  3ROR A;  4U1B A;  3L24 A;  3BIT A;  4S2T P;  2EVM A;  4IEC A;  2GG3 A;  2Q92 A;  4U6W A;  3TAV A;  1R5G A;  1QXY A;  1C24 A;  4FUK A;  5JI6 A;  2BB7 A;  5JHU A;  2B3H A;  4U70 A;  4OOK A;  1KQ0 A;  3FMR A;  1QXW A;  2Q94 A;  1WN1 A;  4FLJ A;  4FO8 A;  5FCF A;  4IU6 A; 
#chains in the Genus database with same CATH homology
 3CB6 A;  3L7G A;  2OAZ A;  4U6C A;  1YW9 A;  3TB5 A;  4U6Z A;  4IPA A;  1JAW A;  1WL6 A;  4FLL A;  5D6E A;  1YJ3 A;  2EVC A;  2GGB A;  4EGE A;  4IKS A;  2V3Z A;  5CIK A;  2P9A A;  1B6A A;  1C21 A;  3IU7 A;  5CNX A;  4PNC A;  2Q8K A;  2HOW A;  2Q96 A;  3S6B A;  1WY2 A;  2BHB A;  4KM3 A;  1B59 A;  2BN7 A;  2EVO A;  4MAT A;  2BWX A;  1YW8 A;  4IDY A;  4A6V A;  2BWW A;  4U75 A;  2GG9 A;  3MX6 A;  2GG7 A;  5CDE A;  4U76 A;  1XGO A;  4ZWU A;  2V3X A;  2ADU A;  2BWT A;  2G6P A;  2P98 A;  1WL9 A;  4ZWP A;  3PKB A;  1MAT A;  2Q95 A;  5CDL A;  2GU7 A;  1N51 A;  3MAT A;  2BHD A;  4S01 A;  1WKM A;  3PKC A;  2GGC A;  4S2R P;  2GA2 A;  3BIP A;  2ZSG A;  2GG8 A;  4Z7M A;  1CHM A;  1C22 A;  1WBQ A;  3BIQ A;  4R60 A;  4FLK A;  4U69 A;  3CB5 A;  1YVM A;  4U6E A;  2P99 A;  4S00 A;  5E5B A;  2BWY A;  3PKE A;  2GU4 A;  2GU5 A;  1W7V A;  1BN5 A;  3MR1 A;  1C23 A;  1KQ9 A;  4FLI A;  3RVA A;  1YW7 A;  2V3Y A;  4IKT A;  4U71 A;  5CDV A;  3Q6D A;  4JUQ A;  2BHA A;  2GG2 A;  1BOA A;  4B28 A;  2OKN A;  4HXX A;  4ZWO A;  2B3K A;  2BH3 A;  2GTX A;  3FM3 A;  3IU8 A;  1W2M A;  2EA4 A;  4FO7 A;  2BWV A;  2V6C A;  4RZY A;  4PV4 A;  5CLS A;  1QXZ A;  2EA2 A;  2NQ6 A;  3IG4 A;  3PKD A;  4QR8 A;  2BHC A;  1WLR A;  4RGZ 1;  5JFR A;  1C27 A;  2GU6 A;  2IW2 A;  1XGM A;  3CTZ A;  1A16 A;  5FCH A;  1M35 A;  4ZNG A;  4RZZ A;  2GG0 A;  5D6F A;  1O0X A;  3FMQ A;  4IKU A;  1PV9 A;  4IKR A;  2MAT A;  1Y1N A;  3D27 A;  4A6W A;  2BWS A;  4IF7 A;  2B3L A;  2BWU A;  1XGS A;  2Q93 A;  4U73 A;  2DFI A;  1XNZ A;  2GG5 A;  2GZ5 A;  4FKC A;  1QZY A;  1R58 A;  1KP0 A;  1R5H A;  1XGN A;  2NQ7 A;  3IU9 A;  5CE6 A;  4U6J A;  3PKA A;  3ROR A;  4U1B A;  3L24 A;  3BIT A;  4S2T P;  2EVM A;  4IEC A;  2GG3 A;  2Q92 A;  4U6W A;  3TAV A;  1R5G A;  1QXY A;  1C24 A;  4FUK A;  5JI6 A;  2BB7 A;  5JHU A;  2B3H A;  4U70 A;  4OOK A;  1KQ0 A;  3FMR A;  1QXW A;  2Q94 A;  1WN1 A;  4FLJ A;  4FO8 A;  5FCF A;  4IU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...