4IU6A

Human methionine aminopeptidase in complex with fz1: pyridinylquinazolines selectively inhibit human methionine aminopeptidase-1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
publication title Pyridinylquinazolines selectively inhibit human methionine aminopeptidase-1 in cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF15801 zf-C6H2 zf-MYND-like zinc finger, mRNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iu6A00
4IF7A 1KQ9A 2NQ6A 4FLLA 3CB5A 4PNCA 2GU6A 2GA2A 2P98A 1WKMA 1C24A 4FO8A 4IECA 5JFRA 3FMQA 2V3XA 1YJ3A 5CDEA 4RGZ1 1BOAA 3PKDA 2GG8A 5D6FA 4HXXA 4A6WA 4U6EA 4IKSA 3MATA 4FLKA 1MATA 2V3YA 3TAVA 1PV9A 1QXWA 2P9AA 2EA4A 4IKTA 4EGEA 4Z7MA 4A6VA 1YW8A 2IW2A 4U1BA 1W2MA 4IKRA 2HOWA 2B3LA 3BIQA 3D27A 2BH3A 2OAZA 4FKCA 1WLRA 5JI6A 3IU7A 1XGNA 3IG4A 2EA2A 4R60A 2BHBA 1XNZA 3PKBA 4S2TP 1C22A 2Q94A 1XGMA 2BWVA 2BWXA 2DFIA 2GG2A 4PV4A 2Q93A 5CDVA 1R5GA 2Q8KA 2OKNA 1YVMA 1KQ0A 1BN5A 1C27A 3PKCA 3Q6DA 4IKUA 1B59A 5CDLA 1YW7A 2V3ZA 5CE6A 2BB7A 5D6EA 1R58A 2Q95A 4U6CA 3PKAA 2BHDA 1M35A 2MATA 2BWYA 2BWWA 2EVOA 4S01A 2GG5A 5FCHA 1WL9A 4B28A 4ZNGA 1A16A 1C21A 2Q96A 2P99A 3TB5A 2ZSGA 1WL6A 1XGOA 2GG7A 3CTZA 2GU4A 2B3KA 4U70A 1C23A 2GGCA 3S6BA 4U75A 1QXZA 4U6JA 2NQ7A 2GG3A 3BIPA 3IU8A 1WN1A 2G6PA 1W7VA 3MR1A 3L24A 1CHMA 4U6ZA 2BWTA 1WY2A 4KM3A 4OOKA 4U69A 5E5BA 5FCFA 4U73A 2BHCA 4IU6A 3CB6A 3BITA 1JAWA 4IDYA 3MX6A 2EVMA 4S00A 4ZWUA 2GU7A 2GZ5A 3PKEA 5CNXA 1WBQA 2GU5A 2BHAA 2GG0A 2V6CA 3IU9A 2BN7A 4U71A 2GGBA 1B6AA 4FUKA 1O0XA 4ZWOA 4U76A 5JHUA 1QXYA 2EVCA 1QZYA 2Q92A 5CLSA 4RZZA 4RZYA 2B3HA 2GTXA 2BWUA 4U6WA 1R5HA 3FM3A 3RVAA 5CIKA 2GG9A 4FLIA 2BWSA 3L7GA 4MATA 4FLJA 1N51A 1XGSA 1Y1NA 4ZWPA 1YW9A 2ADUA 3FMRA 4JUQA 4S2RP 4QR8A 1KP0A 3RORA 4FO7A 4IPAA
chains in the Genus database with same CATH superfamily
4IF7A 1KQ9A 2NQ6A 4FLLA 3CB5A 4PNCA 2GU6A 2GA2A 2P98A 1WKMA 1C24A 4FO8A 4IECA 5JFRA 3FMQA 2V3XA 1YJ3A 5CDEA 4RGZ1 1BOAA 3PKDA 2GG8A 5D6FA 4HXXA 4A6WA 4U6EA 4IKSA 3MATA 4FLKA 1MATA 2V3YA 3TAVA 1PV9A 1QXWA 2P9AA 2EA4A 4IKTA 4EGEA 4Z7MA 4A6VA 1YW8A 2IW2A 4U1BA 1W2MA 4IKRA 2HOWA 2B3LA 3BIQA 3D27A 2BH3A 2OAZA 4FKCA 1WLRA 5JI6A 3IU7A 1XGNA 3IG4A 2EA2A 4R60A 2BHBA 1XNZA 3PKBA 4S2TP 1C22A 2Q94A 1XGMA 2BWVA 2BWXA 2DFIA 2GG2A 4PV4A 2Q93A 5CDVA 1R5GA 2Q8KA 2OKNA 1YVMA 1KQ0A 1BN5A 1C27A 3PKCA 3Q6DA 4IKUA 1B59A 5CDLA 1YW7A 2V3ZA 5CE6A 2BB7A 5D6EA 1R58A 2Q95A 4U6CA 3PKAA 2BHDA 1M35A 2MATA 2BWYA 2BWWA 2EVOA 4S01A 2GG5A 5FCHA 1WL9A 4B28A 4ZNGA 1A16A 1C21A 2Q96A 2P99A 3TB5A 2ZSGA 1WL6A 1XGOA 2GG7A 3CTZA 2GU4A 2B3KA 4U70A 1C23A 2GGCA 3S6BA 4U75A 1QXZA 4U6JA 2NQ7A 2GG3A 3BIPA 3IU8A 1WN1A 2G6PA 1W7VA 3MR1A 3L24A 1CHMA 4U6ZA 2BWTA 1WY2A 4KM3A 4OOKA 4U69A 5E5BA 5FCFA 4U73A 2BHCA 4IU6A 3CB6A 3BITA 1JAWA 4IDYA 3MX6A 2EVMA 4S00A 4ZWUA 2GU7A 2GZ5A 3PKEA 5CNXA 1WBQA 2GU5A 2BHAA 2GG0A 2V6CA 3IU9A 2BN7A 4U71A 2GGBA 1B6AA 4FUKA 1O0XA 4ZWOA 4U76A 5JHUA 1QXYA 2EVCA 1QZYA 2Q92A 5CLSA 4RZZA 4RZYA 2B3HA 2GTXA 2BWUA 4U6WA 1R5HA 3FM3A 3RVAA 5CIKA 2GG9A 4FLIA 2BWSA 3L7GA 4MATA 4FLJA 1N51A 1XGSA 1Y1NA 4ZWPA 1YW9A 2ADUA 3FMRA 4JUQA 4S2RP 4QR8A 1KP0A 3RORA 4FO7A 4IPAA
chains in the Genus database with same CATH topology
4IF7A 1KQ9A 2NQ6A 4FLLA 3CB5A 4PNCA 2GU6A 2GA2A 2P98A 1WKMA 1C24A 4FO8A 4IECA 5JFRA 3FMQA 2V3XA 1YJ3A 5CDEA 4RGZ1 1BOAA 3PKDA 2GG8A 5D6FA 4HXXA 4A6WA 4U6EA 4IKSA 3MATA 4FLKA 1MATA 2V3YA 3TAVA 1PV9A 1QXWA 2P9AA 2EA4A 4IKTA 4EGEA 4Z7MA 4A6VA 1YW8A 2IW2A 4U1BA 1W2MA 4IKRA 2HOWA 2B3LA 3BIQA 3D27A 2BH3A 2OAZA 4FKCA 1WLRA 5JI6A 3IU7A 1XGNA 3IG4A 2EA2A 4R60A 2BHBA 1XNZA 3PKBA 4S2TP 1C22A 2Q94A 1XGMA 2BWVA 2BWXA 2DFIA 2GG2A 4PV4A 2Q93A 5CDVA 1R5GA 2Q8KA 2OKNA 1YVMA 1KQ0A 1BN5A 1C27A 3PKCA 3Q6DA 4IKUA 1B59A 5CDLA 1YW7A 2V3ZA 5CE6A 2BB7A 5D6EA 1R58A 2Q95A 4U6CA 3PKAA 2BHDA 1M35A 2MATA 2BWYA 2BWWA 2EVOA 4S01A 2GG5A 5FCHA 1WL9A 4B28A 4ZNGA 1A16A 1C21A 2Q96A 2P99A 3TB5A 2ZSGA 1WL6A 1XGOA 2GG7A 3CTZA 2GU4A 2B3KA 4U70A 1C23A 2GGCA 3S6BA 4U75A 1QXZA 4U6JA 2NQ7A 2GG3A 3BIPA 3IU8A 1WN1A 2G6PA 1W7VA 3MR1A 3L24A 1CHMA 4U6ZA 2BWTA 1WY2A 4KM3A 4OOKA 4U69A 5E5BA 5FCFA 4U73A 2BHCA 4IU6A 3CB6A 3BITA 1JAWA 4IDYA 3MX6A 2EVMA 4S00A 4ZWUA 2GU7A 2GZ5A 3PKEA 5CNXA 1WBQA 2GU5A 2BHAA 2GG0A 2V6CA 3IU9A 2BN7A 4U71A 2GGBA 1B6AA 4FUKA 1O0XA 4ZWOA 4U76A 5JHUA 1QXYA 2EVCA 1QZYA 2Q92A 5CLSA 4RZZA 4RZYA 2B3HA 2GTXA 2BWUA 4U6WA 1R5HA 3FM3A 3RVAA 5CIKA 2GG9A 4FLIA 2BWSA 3L7GA 4MATA 4FLJA 1N51A 1XGSA 1Y1NA 4ZWPA 1YW9A 2ADUA 3FMRA 4JUQA 4S2RP 4QR8A 1KP0A 3RORA 4FO7A 4IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF7 A;  1KQ9 A;  2NQ6 A;  4FLL A;  3CB5 A;  4PNC A;  2GU6 A;  2GA2 A;  2P98 A;  1WKM A;  1C24 A;  4FO8 A;  4IEC A;  5JFR A;  3FMQ A;  2V3X A;  1YJ3 A;  5CDE A;  4RGZ 1;  1BOA A;  3PKD A;  2GG8 A;  5D6F A;  4HXX A;  4A6W A;  4U6E A;  4IKS A;  3MAT A;  4FLK A;  1MAT A;  2V3Y A;  3TAV A;  1PV9 A;  1QXW A;  2P9A A;  2EA4 A;  4IKT A;  4EGE A;  4Z7M A;  4A6V A;  1YW8 A;  2IW2 A;  4U1B A;  1W2M A;  4IKR A;  2HOW A;  2B3L A;  3BIQ A;  3D27 A;  2BH3 A;  2OAZ A;  4FKC A;  1WLR A;  5JI6 A;  3IU7 A;  1XGN A;  3IG4 A;  2EA2 A;  4R60 A;  2BHB A;  1XNZ A;  3PKB A;  4S2T P;  1C22 A;  2Q94 A;  1XGM A;  2BWV A;  2BWX A;  2DFI A;  2GG2 A;  4PV4 A;  2Q93 A;  5CDV A;  1R5G A;  2Q8K A;  2OKN A;  1YVM A;  1KQ0 A;  1BN5 A;  1C27 A;  3PKC A;  3Q6D A;  4IKU A;  1B59 A;  5CDL A;  1YW7 A;  2V3Z A;  5CE6 A;  2BB7 A;  5D6E A;  1R58 A;  2Q95 A;  4U6C A;  3PKA A;  2BHD A;  1M35 A;  2MAT A;  2BWY A;  2BWW A;  2EVO A;  4S01 A;  2GG5 A;  5FCH A;  1WL9 A;  4B28 A;  4ZNG A;  1A16 A;  1C21 A;  2Q96 A;  2P99 A;  3TB5 A;  2ZSG A;  1WL6 A;  1XGO A;  2GG7 A;  3CTZ A;  2GU4 A;  2B3K A;  4U70 A;  1C23 A;  2GGC A;  3S6B A;  4U75 A;  1QXZ A;  4U6J A;  2NQ7 A;  2GG3 A;  3BIP A;  3IU8 A;  1WN1 A;  2G6P A;  1W7V A;  3MR1 A;  3L24 A;  1CHM A;  4U6Z A;  2BWT A;  1WY2 A;  4KM3 A;  4OOK A;  4U69 A;  5E5B A;  5FCF A;  4U73 A;  2BHC A;  4IU6 A;  3CB6 A;  3BIT A;  1JAW A;  4IDY A;  3MX6 A;  2EVM A;  4S00 A;  4ZWU A;  2GU7 A;  2GZ5 A;  3PKE A;  5CNX A;  1WBQ A;  2GU5 A;  2BHA A;  2GG0 A;  2V6C A;  3IU9 A;  2BN7 A;  4U71 A;  2GGB A;  1B6A A;  4FUK A;  1O0X A;  4ZWO A;  4U76 A;  5JHU A;  1QXY A;  2EVC A;  1QZY A;  2Q92 A;  5CLS A;  4RZZ A;  4RZY A;  2B3H A;  2GTX A;  2BWU A;  4U6W A;  1R5H A;  3FM3 A;  3RVA A;  5CIK A;  2GG9 A;  4FLI A;  2BWS A;  3L7G A;  4MAT A;  4FLJ A;  1N51 A;  1XGS A;  1Y1N A;  4ZWP A;  1YW9 A;  2ADU A;  3FMR A;  4JUQ A;  4S2R P;  4QR8 A;  1KP0 A;  3ROR A;  4FO7 A;  4IPA A; 
#chains in the Genus database with same CATH topology
 4IF7 A;  1KQ9 A;  2NQ6 A;  4FLL A;  3CB5 A;  4PNC A;  2GU6 A;  2GA2 A;  2P98 A;  1WKM A;  1C24 A;  4FO8 A;  4IEC A;  5JFR A;  3FMQ A;  2V3X A;  1YJ3 A;  5CDE A;  4RGZ 1;  1BOA A;  3PKD A;  2GG8 A;  5D6F A;  4HXX A;  4A6W A;  4U6E A;  4IKS A;  3MAT A;  4FLK A;  1MAT A;  2V3Y A;  3TAV A;  1PV9 A;  1QXW A;  2P9A A;  2EA4 A;  4IKT A;  4EGE A;  4Z7M A;  4A6V A;  1YW8 A;  2IW2 A;  4U1B A;  1W2M A;  4IKR A;  2HOW A;  2B3L A;  3BIQ A;  3D27 A;  2BH3 A;  2OAZ A;  4FKC A;  1WLR A;  5JI6 A;  3IU7 A;  1XGN A;  3IG4 A;  2EA2 A;  4R60 A;  2BHB A;  1XNZ A;  3PKB A;  4S2T P;  1C22 A;  2Q94 A;  1XGM A;  2BWV A;  2BWX A;  2DFI A;  2GG2 A;  4PV4 A;  2Q93 A;  5CDV A;  1R5G A;  2Q8K A;  2OKN A;  1YVM A;  1KQ0 A;  1BN5 A;  1C27 A;  3PKC A;  3Q6D A;  4IKU A;  1B59 A;  5CDL A;  1YW7 A;  2V3Z A;  5CE6 A;  2BB7 A;  5D6E A;  1R58 A;  2Q95 A;  4U6C A;  3PKA A;  2BHD A;  1M35 A;  2MAT A;  2BWY A;  2BWW A;  2EVO A;  4S01 A;  2GG5 A;  5FCH A;  1WL9 A;  4B28 A;  4ZNG A;  1A16 A;  1C21 A;  2Q96 A;  2P99 A;  3TB5 A;  2ZSG A;  1WL6 A;  1XGO A;  2GG7 A;  3CTZ A;  2GU4 A;  2B3K A;  4U70 A;  1C23 A;  2GGC A;  3S6B A;  4U75 A;  1QXZ A;  4U6J A;  2NQ7 A;  2GG3 A;  3BIP A;  3IU8 A;  1WN1 A;  2G6P A;  1W7V A;  3MR1 A;  3L24 A;  1CHM A;  4U6Z A;  2BWT A;  1WY2 A;  4KM3 A;  4OOK A;  4U69 A;  5E5B A;  5FCF A;  4U73 A;  2BHC A;  4IU6 A;  3CB6 A;  3BIT A;  1JAW A;  4IDY A;  3MX6 A;  2EVM A;  4S00 A;  4ZWU A;  2GU7 A;  2GZ5 A;  3PKE A;  5CNX A;  1WBQ A;  2GU5 A;  2BHA A;  2GG0 A;  2V6C A;  3IU9 A;  2BN7 A;  4U71 A;  2GGB A;  1B6A A;  4FUK A;  1O0X A;  4ZWO A;  4U76 A;  5JHU A;  1QXY A;  2EVC A;  1QZY A;  2Q92 A;  5CLS A;  4RZZ A;  4RZY A;  2B3H A;  2GTX A;  2BWU A;  4U6W A;  1R5H A;  3FM3 A;  3RVA A;  5CIK A;  2GG9 A;  4FLI A;  2BWS A;  3L7G A;  4MAT A;  4FLJ A;  1N51 A;  1XGS A;  1Y1N A;  4ZWP A;  1YW9 A;  2ADU A;  3FMR A;  4JUQ A;  4S2R P;  4QR8 A;  1KP0 A;  3ROR A;  4FO7 A;  4IPA A; 
#chains in the Genus database with same CATH homology
 4IF7 A;  1KQ9 A;  2NQ6 A;  4FLL A;  3CB5 A;  4PNC A;  2GU6 A;  2GA2 A;  2P98 A;  1WKM A;  1C24 A;  4FO8 A;  4IEC A;  5JFR A;  3FMQ A;  2V3X A;  1YJ3 A;  5CDE A;  4RGZ 1;  1BOA A;  3PKD A;  2GG8 A;  5D6F A;  4HXX A;  4A6W A;  4U6E A;  4IKS A;  3MAT A;  4FLK A;  1MAT A;  2V3Y A;  3TAV A;  1PV9 A;  1QXW A;  2P9A A;  2EA4 A;  4IKT A;  4EGE A;  4Z7M A;  4A6V A;  1YW8 A;  2IW2 A;  4U1B A;  1W2M A;  4IKR A;  2HOW A;  2B3L A;  3BIQ A;  3D27 A;  2BH3 A;  2OAZ A;  4FKC A;  1WLR A;  5JI6 A;  3IU7 A;  1XGN A;  3IG4 A;  2EA2 A;  4R60 A;  2BHB A;  1XNZ A;  3PKB A;  4S2T P;  1C22 A;  2Q94 A;  1XGM A;  2BWV A;  2BWX A;  2DFI A;  2GG2 A;  4PV4 A;  2Q93 A;  5CDV A;  1R5G A;  2Q8K A;  2OKN A;  1YVM A;  1KQ0 A;  1BN5 A;  1C27 A;  3PKC A;  3Q6D A;  4IKU A;  1B59 A;  5CDL A;  1YW7 A;  2V3Z A;  5CE6 A;  2BB7 A;  5D6E A;  1R58 A;  2Q95 A;  4U6C A;  3PKA A;  2BHD A;  1M35 A;  2MAT A;  2BWY A;  2BWW A;  2EVO A;  4S01 A;  2GG5 A;  5FCH A;  1WL9 A;  4B28 A;  4ZNG A;  1A16 A;  1C21 A;  2Q96 A;  2P99 A;  3TB5 A;  2ZSG A;  1WL6 A;  1XGO A;  2GG7 A;  3CTZ A;  2GU4 A;  2B3K A;  4U70 A;  1C23 A;  2GGC A;  3S6B A;  4U75 A;  1QXZ A;  4U6J A;  2NQ7 A;  2GG3 A;  3BIP A;  3IU8 A;  1WN1 A;  2G6P A;  1W7V A;  3MR1 A;  3L24 A;  1CHM A;  4U6Z A;  2BWT A;  1WY2 A;  4KM3 A;  4OOK A;  4U69 A;  5E5B A;  5FCF A;  4U73 A;  2BHC A;  4IU6 A;  3CB6 A;  3BIT A;  1JAW A;  4IDY A;  3MX6 A;  2EVM A;  4S00 A;  4ZWU A;  2GU7 A;  2GZ5 A;  3PKE A;  5CNX A;  1WBQ A;  2GU5 A;  2BHA A;  2GG0 A;  2V6C A;  3IU9 A;  2BN7 A;  4U71 A;  2GGB A;  1B6A A;  4FUK A;  1O0X A;  4ZWO A;  4U76 A;  5JHU A;  1QXY A;  2EVC A;  1QZY A;  2Q92 A;  5CLS A;  4RZZ A;  4RZY A;  2B3H A;  2GTX A;  2BWU A;  4U6W A;  1R5H A;  3FM3 A;  3RVA A;  5CIK A;  2GG9 A;  4FLI A;  2BWS A;  3L7G A;  4MAT A;  4FLJ A;  1N51 A;  1XGS A;  1Y1N A;  4ZWP A;  1YW9 A;  2ADU A;  3FMR A;  4JUQ A;  4S2R P;  4QR8 A;  1KP0 A;  3ROR A;  4FO7 A;  4IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...