4FLLA

Human metap1 with bengamide analog yz6, in mn form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fllA00
1YW9A 1BOAA 2GZ5A 4QR8A 1PV9A 3MR1A 2GGCA 1YVMA 2B3LA 5D6EA 4A6VA 1W7VA 2GG9A 1WBQA 3IU7A 4S2TP 1N51A 4B28A 1QXYA 2BWXA 4FLIA 2B3KA 1M35A 2NQ7A 3MATA 4FLKA 1QXWA 3CTZA 4KM3A 5E5BA 1YW8A 3FMQA 2GA2A 3Q6DA 1WL6A 2BWWA 3IU8A 3L7GA 2HOWA 2Q93A 2ADUA 3BIQA 3L24A 4A6WA 4U75A 2GU4A 1MATA 3PKBA 4U73A 1YJ3A 5CNXA 2BWVA 2Q8KA 5CDLA 4IKTA 1R5HA 1Y1NA 1W2MA 5FCHA 2NQ6A 1KQ0A 1A16A 4Z7MA 2BHCA 4IECA 2MATA 4U6JA 4ZWOA 5CE6A 2V3ZA 3CB5A 4RZYA 2EA4A 4IKRA 3PKEA 2BN7A 4FUKA 2P9AA 4U69A 3RVAA 3BITA 1B59A 5D6FA 1XGNA 4U6CA 1XGOA 2Q96A 4IU6A 4U6WA 2EA2A 3CB6A 2ZSGA 2GU6A 4RGZ1 2IW2A 1KQ9A 2V3XA 5JHUA 4JUQA 5JI6A 2GU5A 2V3YA 5CIKA 1O0XA 4OOKA 2G6PA 2GG2A 2OAZA 3TAVA 1WLRA 4IKUA 5FCFA 1C24A 1CHMA 4S2RP 4IPAA 1XGMA 5CLSA 2P99A 4IF7A 2GG0A 3IU9A 2P98A 4FO8A 1KP0A 2GTXA 1B6AA 1C21A 1WL9A 4U70A 4EGEA 4MATA 5JFRA 3BIPA 4ZWUA 3MX6A 2BWTA 2GG3A 2GG8A 4FKCA 4U1BA 4S01A 1R58A 4U71A 3D27A 4PV4A 4R60A 1WN1A 1QZYA 2GG5A 4FO7A 3RORA 4S00A 2EVOA 2BB7A 1C22A 2BHBA 2V6CA 4U6EA 1YW7A 2Q92A 1R5GA 1JAWA 2BHDA 1XNZA 2GGBA 4IKSA 3TB5A 4HXXA 3PKAA 2EVCA 3FMRA 4U76A 4U6ZA 1XGSA 2GG7A 2BH3A 1QXZA 3S6BA 4IDYA 5CDVA 3PKDA 4FLJA 3FM3A 1WKMA 2BWSA 2EVMA 1C23A 2BWUA 3PKCA 2BWYA 4ZNGA 1WY2A 2B3HA 2OKNA 4ZWPA 2DFIA 5CDEA 2BHAA 2GU7A 2Q94A 1BN5A 3IG4A 4FLLA 4RZZA 4PNCA 1C27A 2Q95A
chains in the Genus database with same CATH superfamily
1YW9A 1BOAA 2GZ5A 4QR8A 1PV9A 3MR1A 2GGCA 1YVMA 2B3LA 5D6EA 4A6VA 1W7VA 2GG9A 1WBQA 3IU7A 4S2TP 1N51A 4B28A 1QXYA 2BWXA 4FLIA 2B3KA 1M35A 2NQ7A 3MATA 4FLKA 1QXWA 3CTZA 4KM3A 5E5BA 1YW8A 3FMQA 2GA2A 3Q6DA 1WL6A 2BWWA 3IU8A 3L7GA 2HOWA 2Q93A 2ADUA 3BIQA 3L24A 4A6WA 4U75A 2GU4A 1MATA 3PKBA 4U73A 1YJ3A 5CNXA 2BWVA 2Q8KA 5CDLA 4IKTA 1R5HA 1Y1NA 1W2MA 5FCHA 2NQ6A 1KQ0A 1A16A 4Z7MA 2BHCA 4IECA 2MATA 4U6JA 4ZWOA 5CE6A 2V3ZA 3CB5A 4RZYA 2EA4A 4IKRA 3PKEA 2BN7A 4FUKA 2P9AA 4U69A 3RVAA 3BITA 1B59A 5D6FA 1XGNA 4U6CA 1XGOA 2Q96A 4IU6A 4U6WA 2EA2A 3CB6A 2ZSGA 2GU6A 4RGZ1 2IW2A 1KQ9A 2V3XA 5JHUA 4JUQA 5JI6A 2GU5A 2V3YA 5CIKA 1O0XA 4OOKA 2G6PA 2GG2A 2OAZA 3TAVA 1WLRA 4IKUA 5FCFA 1C24A 1CHMA 4S2RP 4IPAA 1XGMA 5CLSA 2P99A 4IF7A 2GG0A 3IU9A 2P98A 4FO8A 1KP0A 2GTXA 1B6AA 1C21A 1WL9A 4U70A 4EGEA 4MATA 5JFRA 3BIPA 4ZWUA 3MX6A 2BWTA 2GG3A 2GG8A 4FKCA 4U1BA 4S01A 1R58A 4U71A 3D27A 4PV4A 4R60A 1WN1A 1QZYA 2GG5A 4FO7A 3RORA 4S00A 2EVOA 2BB7A 1C22A 2BHBA 2V6CA 4U6EA 1YW7A 2Q92A 1R5GA 1JAWA 2BHDA 1XNZA 2GGBA 4IKSA 3TB5A 4HXXA 3PKAA 2EVCA 3FMRA 4U76A 4U6ZA 1XGSA 2GG7A 2BH3A 1QXZA 3S6BA 4IDYA 5CDVA 3PKDA 4FLJA 3FM3A 1WKMA 2BWSA 2EVMA 1C23A 2BWUA 3PKCA 2BWYA 4ZNGA 1WY2A 2B3HA 2OKNA 4ZWPA 2DFIA 5CDEA 2BHAA 2GU7A 2Q94A 1BN5A 3IG4A 4FLLA 4RZZA 4PNCA 1C27A 2Q95A
chains in the Genus database with same CATH topology
1YW9A 1BOAA 2GZ5A 4QR8A 1PV9A 3MR1A 2GGCA 1YVMA 2B3LA 5D6EA 4A6VA 1W7VA 2GG9A 1WBQA 3IU7A 4S2TP 1N51A 4B28A 1QXYA 2BWXA 4FLIA 2B3KA 1M35A 2NQ7A 3MATA 4FLKA 1QXWA 3CTZA 4KM3A 5E5BA 1YW8A 3FMQA 2GA2A 3Q6DA 1WL6A 2BWWA 3IU8A 3L7GA 2HOWA 2Q93A 2ADUA 3BIQA 3L24A 4A6WA 4U75A 2GU4A 1MATA 3PKBA 4U73A 1YJ3A 5CNXA 2BWVA 2Q8KA 5CDLA 4IKTA 1R5HA 1Y1NA 1W2MA 5FCHA 2NQ6A 1KQ0A 1A16A 4Z7MA 2BHCA 4IECA 2MATA 4U6JA 4ZWOA 5CE6A 2V3ZA 3CB5A 4RZYA 2EA4A 4IKRA 3PKEA 2BN7A 4FUKA 2P9AA 4U69A 3RVAA 3BITA 1B59A 5D6FA 1XGNA 4U6CA 1XGOA 2Q96A 4IU6A 4U6WA 2EA2A 3CB6A 2ZSGA 2GU6A 4RGZ1 2IW2A 1KQ9A 2V3XA 5JHUA 4JUQA 5JI6A 2GU5A 2V3YA 5CIKA 1O0XA 4OOKA 2G6PA 2GG2A 2OAZA 3TAVA 1WLRA 4IKUA 5FCFA 1C24A 1CHMA 4S2RP 4IPAA 1XGMA 5CLSA 2P99A 4IF7A 2GG0A 3IU9A 2P98A 4FO8A 1KP0A 2GTXA 1B6AA 1C21A 1WL9A 4U70A 4EGEA 4MATA 5JFRA 3BIPA 4ZWUA 3MX6A 2BWTA 2GG3A 2GG8A 4FKCA 4U1BA 4S01A 1R58A 4U71A 3D27A 4PV4A 4R60A 1WN1A 1QZYA 2GG5A 4FO7A 3RORA 4S00A 2EVOA 2BB7A 1C22A 2BHBA 2V6CA 4U6EA 1YW7A 2Q92A 1R5GA 1JAWA 2BHDA 1XNZA 2GGBA 4IKSA 3TB5A 4HXXA 3PKAA 2EVCA 3FMRA 4U76A 4U6ZA 1XGSA 2GG7A 2BH3A 1QXZA 3S6BA 4IDYA 5CDVA 3PKDA 4FLJA 3FM3A 1WKMA 2BWSA 2EVMA 1C23A 2BWUA 3PKCA 2BWYA 4ZNGA 1WY2A 2B3HA 2OKNA 4ZWPA 2DFIA 5CDEA 2BHAA 2GU7A 2Q94A 1BN5A 3IG4A 4FLLA 4RZZA 4PNCA 1C27A 2Q95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW9 A;  1BOA A;  2GZ5 A;  4QR8 A;  1PV9 A;  3MR1 A;  2GGC A;  1YVM A;  2B3L A;  5D6E A;  4A6V A;  1W7V A;  2GG9 A;  1WBQ A;  3IU7 A;  4S2T P;  1N51 A;  4B28 A;  1QXY A;  2BWX A;  4FLI A;  2B3K A;  1M35 A;  2NQ7 A;  3MAT A;  4FLK A;  1QXW A;  3CTZ A;  4KM3 A;  5E5B A;  1YW8 A;  3FMQ A;  2GA2 A;  3Q6D A;  1WL6 A;  2BWW A;  3IU8 A;  3L7G A;  2HOW A;  2Q93 A;  2ADU A;  3BIQ A;  3L24 A;  4A6W A;  4U75 A;  2GU4 A;  1MAT A;  3PKB A;  4U73 A;  1YJ3 A;  5CNX A;  2BWV A;  2Q8K A;  5CDL A;  4IKT A;  1R5H A;  1Y1N A;  1W2M A;  5FCH A;  2NQ6 A;  1KQ0 A;  1A16 A;  4Z7M A;  2BHC A;  4IEC A;  2MAT A;  4U6J A;  4ZWO A;  5CE6 A;  2V3Z A;  3CB5 A;  4RZY A;  2EA4 A;  4IKR A;  3PKE A;  2BN7 A;  4FUK A;  2P9A A;  4U69 A;  3RVA A;  3BIT A;  1B59 A;  5D6F A;  1XGN A;  4U6C A;  1XGO A;  2Q96 A;  4IU6 A;  4U6W A;  2EA2 A;  3CB6 A;  2ZSG A;  2GU6 A;  4RGZ 1;  2IW2 A;  1KQ9 A;  2V3X A;  5JHU A;  4JUQ A;  5JI6 A;  2GU5 A;  2V3Y A;  5CIK A;  1O0X A;  4OOK A;  2G6P A;  2GG2 A;  2OAZ A;  3TAV A;  1WLR A;  4IKU A;  5FCF A;  1C24 A;  1CHM A;  4S2R P;  4IPA A;  1XGM A;  5CLS A;  2P99 A;  4IF7 A;  2GG0 A;  3IU9 A;  2P98 A;  4FO8 A;  1KP0 A;  2GTX A;  1B6A A;  1C21 A;  1WL9 A;  4U70 A;  4EGE A;  4MAT A;  5JFR A;  3BIP A;  4ZWU A;  3MX6 A;  2BWT A;  2GG3 A;  2GG8 A;  4FKC A;  4U1B A;  4S01 A;  1R58 A;  4U71 A;  3D27 A;  4PV4 A;  4R60 A;  1WN1 A;  1QZY A;  2GG5 A;  4FO7 A;  3ROR A;  4S00 A;  2EVO A;  2BB7 A;  1C22 A;  2BHB A;  2V6C A;  4U6E A;  1YW7 A;  2Q92 A;  1R5G A;  1JAW A;  2BHD A;  1XNZ A;  2GGB A;  4IKS A;  3TB5 A;  4HXX A;  3PKA A;  2EVC A;  3FMR A;  4U76 A;  4U6Z A;  1XGS A;  2GG7 A;  2BH3 A;  1QXZ A;  3S6B A;  4IDY A;  5CDV A;  3PKD A;  4FLJ A;  3FM3 A;  1WKM A;  2BWS A;  2EVM A;  1C23 A;  2BWU A;  3PKC A;  2BWY A;  4ZNG A;  1WY2 A;  2B3H A;  2OKN A;  4ZWP A;  2DFI A;  5CDE A;  2BHA A;  2GU7 A;  2Q94 A;  1BN5 A;  3IG4 A;  4FLL A;  4RZZ A;  4PNC A;  1C27 A;  2Q95 A; 
#chains in the Genus database with same CATH topology
 1YW9 A;  1BOA A;  2GZ5 A;  4QR8 A;  1PV9 A;  3MR1 A;  2GGC A;  1YVM A;  2B3L A;  5D6E A;  4A6V A;  1W7V A;  2GG9 A;  1WBQ A;  3IU7 A;  4S2T P;  1N51 A;  4B28 A;  1QXY A;  2BWX A;  4FLI A;  2B3K A;  1M35 A;  2NQ7 A;  3MAT A;  4FLK A;  1QXW A;  3CTZ A;  4KM3 A;  5E5B A;  1YW8 A;  3FMQ A;  2GA2 A;  3Q6D A;  1WL6 A;  2BWW A;  3IU8 A;  3L7G A;  2HOW A;  2Q93 A;  2ADU A;  3BIQ A;  3L24 A;  4A6W A;  4U75 A;  2GU4 A;  1MAT A;  3PKB A;  4U73 A;  1YJ3 A;  5CNX A;  2BWV A;  2Q8K A;  5CDL A;  4IKT A;  1R5H A;  1Y1N A;  1W2M A;  5FCH A;  2NQ6 A;  1KQ0 A;  1A16 A;  4Z7M A;  2BHC A;  4IEC A;  2MAT A;  4U6J A;  4ZWO A;  5CE6 A;  2V3Z A;  3CB5 A;  4RZY A;  2EA4 A;  4IKR A;  3PKE A;  2BN7 A;  4FUK A;  2P9A A;  4U69 A;  3RVA A;  3BIT A;  1B59 A;  5D6F A;  1XGN A;  4U6C A;  1XGO A;  2Q96 A;  4IU6 A;  4U6W A;  2EA2 A;  3CB6 A;  2ZSG A;  2GU6 A;  4RGZ 1;  2IW2 A;  1KQ9 A;  2V3X A;  5JHU A;  4JUQ A;  5JI6 A;  2GU5 A;  2V3Y A;  5CIK A;  1O0X A;  4OOK A;  2G6P A;  2GG2 A;  2OAZ A;  3TAV A;  1WLR A;  4IKU A;  5FCF A;  1C24 A;  1CHM A;  4S2R P;  4IPA A;  1XGM A;  5CLS A;  2P99 A;  4IF7 A;  2GG0 A;  3IU9 A;  2P98 A;  4FO8 A;  1KP0 A;  2GTX A;  1B6A A;  1C21 A;  1WL9 A;  4U70 A;  4EGE A;  4MAT A;  5JFR A;  3BIP A;  4ZWU A;  3MX6 A;  2BWT A;  2GG3 A;  2GG8 A;  4FKC A;  4U1B A;  4S01 A;  1R58 A;  4U71 A;  3D27 A;  4PV4 A;  4R60 A;  1WN1 A;  1QZY A;  2GG5 A;  4FO7 A;  3ROR A;  4S00 A;  2EVO A;  2BB7 A;  1C22 A;  2BHB A;  2V6C A;  4U6E A;  1YW7 A;  2Q92 A;  1R5G A;  1JAW A;  2BHD A;  1XNZ A;  2GGB A;  4IKS A;  3TB5 A;  4HXX A;  3PKA A;  2EVC A;  3FMR A;  4U76 A;  4U6Z A;  1XGS A;  2GG7 A;  2BH3 A;  1QXZ A;  3S6B A;  4IDY A;  5CDV A;  3PKD A;  4FLJ A;  3FM3 A;  1WKM A;  2BWS A;  2EVM A;  1C23 A;  2BWU A;  3PKC A;  2BWY A;  4ZNG A;  1WY2 A;  2B3H A;  2OKN A;  4ZWP A;  2DFI A;  5CDE A;  2BHA A;  2GU7 A;  2Q94 A;  1BN5 A;  3IG4 A;  4FLL A;  4RZZ A;  4PNC A;  1C27 A;  2Q95 A; 
#chains in the Genus database with same CATH homology
 1YW9 A;  1BOA A;  2GZ5 A;  4QR8 A;  1PV9 A;  3MR1 A;  2GGC A;  1YVM A;  2B3L A;  5D6E A;  4A6V A;  1W7V A;  2GG9 A;  1WBQ A;  3IU7 A;  4S2T P;  1N51 A;  4B28 A;  1QXY A;  2BWX A;  4FLI A;  2B3K A;  1M35 A;  2NQ7 A;  3MAT A;  4FLK A;  1QXW A;  3CTZ A;  4KM3 A;  5E5B A;  1YW8 A;  3FMQ A;  2GA2 A;  3Q6D A;  1WL6 A;  2BWW A;  3IU8 A;  3L7G A;  2HOW A;  2Q93 A;  2ADU A;  3BIQ A;  3L24 A;  4A6W A;  4U75 A;  2GU4 A;  1MAT A;  3PKB A;  4U73 A;  1YJ3 A;  5CNX A;  2BWV A;  2Q8K A;  5CDL A;  4IKT A;  1R5H A;  1Y1N A;  1W2M A;  5FCH A;  2NQ6 A;  1KQ0 A;  1A16 A;  4Z7M A;  2BHC A;  4IEC A;  2MAT A;  4U6J A;  4ZWO A;  5CE6 A;  2V3Z A;  3CB5 A;  4RZY A;  2EA4 A;  4IKR A;  3PKE A;  2BN7 A;  4FUK A;  2P9A A;  4U69 A;  3RVA A;  3BIT A;  1B59 A;  5D6F A;  1XGN A;  4U6C A;  1XGO A;  2Q96 A;  4IU6 A;  4U6W A;  2EA2 A;  3CB6 A;  2ZSG A;  2GU6 A;  4RGZ 1;  2IW2 A;  1KQ9 A;  2V3X A;  5JHU A;  4JUQ A;  5JI6 A;  2GU5 A;  2V3Y A;  5CIK A;  1O0X A;  4OOK A;  2G6P A;  2GG2 A;  2OAZ A;  3TAV A;  1WLR A;  4IKU A;  5FCF A;  1C24 A;  1CHM A;  4S2R P;  4IPA A;  1XGM A;  5CLS A;  2P99 A;  4IF7 A;  2GG0 A;  3IU9 A;  2P98 A;  4FO8 A;  1KP0 A;  2GTX A;  1B6A A;  1C21 A;  1WL9 A;  4U70 A;  4EGE A;  4MAT A;  5JFR A;  3BIP A;  4ZWU A;  3MX6 A;  2BWT A;  2GG3 A;  2GG8 A;  4FKC A;  4U1B A;  4S01 A;  1R58 A;  4U71 A;  3D27 A;  4PV4 A;  4R60 A;  1WN1 A;  1QZY A;  2GG5 A;  4FO7 A;  3ROR A;  4S00 A;  2EVO A;  2BB7 A;  1C22 A;  2BHB A;  2V6C A;  4U6E A;  1YW7 A;  2Q92 A;  1R5G A;  1JAW A;  2BHD A;  1XNZ A;  2GGB A;  4IKS A;  3TB5 A;  4HXX A;  3PKA A;  2EVC A;  3FMR A;  4U76 A;  4U6Z A;  1XGS A;  2GG7 A;  2BH3 A;  1QXZ A;  3S6B A;  4IDY A;  5CDV A;  3PKD A;  4FLJ A;  3FM3 A;  1WKM A;  2BWS A;  2EVM A;  1C23 A;  2BWU A;  3PKC A;  2BWY A;  4ZNG A;  1WY2 A;  2B3H A;  2OKN A;  4ZWP A;  2DFI A;  5CDE A;  2BHA A;  2GU7 A;  2Q94 A;  1BN5 A;  3IG4 A;  4FLL A;  4RZZ A;  4PNC A;  1C27 A;  2Q95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...