4FLLA

Human metap1 with bengamide analog yz6, in mn form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fllA00
4HXXA 2GZ5A 4FLJA 2NQ6A 2P98A 3IU8A 4S00A 2BWWA 1WBQA 4IKSA 4RZYA 4U6JA 1W2MA 1QZYA 4IU6A 2GG0A 1YVMA 2B3LA 1R58A 3BIPA 4FLLA 3PKEA 2EVCA 5CDLA 4U71A 4QR8A 1MATA 4JUQA 4PNCA 5FCFA 2BWYA 4KM3A 5CNXA 4FKCA 1N51A 4A6VA 1C23A 4IECA 2B3HA 3CB6A 2NQ7A 3L24A 2B3KA 4ZWOA 4ZWUA 2Q94A 5JFRA 2GG8A 2BN7A 4ZWPA 2BWVA 2MATA 3IG4A 4IKTA 2GU5A 3TAVA 1XGSA 3MX6A 1QXZA 1XGMA 2GG5A 2BHBA 2GU7A 1R5GA 3S6BA 5CDEA 1WLRA 4FO7A 4IKUA 1WY2A 1M35A 3D27A 1Y1NA 3CTZA 5FCHA 1YW8A 1C24A 1WN1A 2Q92A 4OOKA 1YJ3A 3PKBA 4EGEA 2GG9A 1C27A 2GU4A 1WL6A 3FMQA 4S2TP 2GGCA 1BN5A 2G6PA 4IPAA 4PV4A 3BITA 2GG3A 1XGNA 2BHAA 4U75A 5CDVA 3IU7A 5CE6A 4FLIA 4R60A 3IU9A 2Q95A 3FMRA 4Z7MA 3Q6DA 1O0XA 5D6EA 2GG2A 2GG7A 1C22A 2EVMA 1BOAA 1PV9A 3FM3A 3MR1A 3PKAA 2IW2A 2EVOA 1WKMA 2OKNA 2Q8KA 1QXWA 4FO8A 1A16A 2DFIA 4IDYA 4MATA 1YW7A 1R5HA 3RORA 4S01A 4S2RP 1JAWA 2ADUA 2BHCA 2EA4A 2Q93A 2V3XA 3BIQA 4IKRA 5JI6A 2BWSA 1KQ0A 4U70A 4FLKA 5E5BA 2BWTA 1KQ9A 1QXYA 4B28A 1C21A 3L7GA 1B59A 2Q96A 2V3ZA 3MATA 1B6AA 3RVAA 5CLSA 1KP0A 1XGOA 2GTXA 3TB5A 4U1BA 4RZZA 4U6CA 4U6ZA 1YW9A 2GGBA 1CHMA 1WL9A 2EA2A 2OAZA 3CB5A 2V3YA 2P99A 2GA2A 5CIKA 4A6WA 4U73A 2HOWA 2BWUA 4IF7A 4U76A 2BWXA 5D6FA 2BH3A 4ZNGA 2GU6A 4RGZ1 4U6EA 4U6WA 4FUKA 1W7VA 1XNZA 3PKCA 5JHUA 4U69A 2BHDA 3PKDA 2ZSGA 2BB7A 2P9AA 2V6CA
chains in the Genus database with same CATH superfamily
4HXXA 2GZ5A 4FLJA 2NQ6A 2P98A 3IU8A 4S00A 2BWWA 1WBQA 4IKSA 4RZYA 4U6JA 1W2MA 1QZYA 4IU6A 2GG0A 1YVMA 2B3LA 1R58A 3BIPA 4FLLA 3PKEA 2EVCA 5CDLA 4U71A 4QR8A 1MATA 4JUQA 4PNCA 5FCFA 2BWYA 4KM3A 5CNXA 4FKCA 1N51A 4A6VA 1C23A 4IECA 2B3HA 3CB6A 2NQ7A 3L24A 2B3KA 4ZWOA 4ZWUA 2Q94A 5JFRA 2GG8A 2BN7A 4ZWPA 2BWVA 2MATA 3IG4A 4IKTA 2GU5A 3TAVA 1XGSA 3MX6A 1QXZA 1XGMA 2GG5A 2BHBA 2GU7A 1R5GA 3S6BA 5CDEA 1WLRA 4FO7A 4IKUA 1WY2A 1M35A 3D27A 1Y1NA 3CTZA 5FCHA 1YW8A 1C24A 1WN1A 2Q92A 4OOKA 1YJ3A 3PKBA 4EGEA 2GG9A 1C27A 2GU4A 1WL6A 3FMQA 4S2TP 2GGCA 1BN5A 2G6PA 4IPAA 4PV4A 3BITA 2GG3A 1XGNA 2BHAA 4U75A 5CDVA 3IU7A 5CE6A 4FLIA 4R60A 3IU9A 2Q95A 3FMRA 4Z7MA 3Q6DA 1O0XA 5D6EA 2GG2A 2GG7A 1C22A 2EVMA 1BOAA 1PV9A 3FM3A 3MR1A 3PKAA 2IW2A 2EVOA 1WKMA 2OKNA 2Q8KA 1QXWA 4FO8A 1A16A 2DFIA 4IDYA 4MATA 1YW7A 1R5HA 3RORA 4S01A 4S2RP 1JAWA 2ADUA 2BHCA 2EA4A 2Q93A 2V3XA 3BIQA 4IKRA 5JI6A 2BWSA 1KQ0A 4U70A 4FLKA 5E5BA 2BWTA 1KQ9A 1QXYA 4B28A 1C21A 3L7GA 1B59A 2Q96A 2V3ZA 3MATA 1B6AA 3RVAA 5CLSA 1KP0A 1XGOA 2GTXA 3TB5A 4U1BA 4RZZA 4U6CA 4U6ZA 1YW9A 2GGBA 1CHMA 1WL9A 2EA2A 2OAZA 3CB5A 2V3YA 2P99A 2GA2A 5CIKA 4A6WA 4U73A 2HOWA 2BWUA 4IF7A 4U76A 2BWXA 5D6FA 2BH3A 4ZNGA 2GU6A 4RGZ1 4U6EA 4U6WA 4FUKA 1W7VA 1XNZA 3PKCA 5JHUA 4U69A 2BHDA 3PKDA 2ZSGA 2BB7A 2P9AA 2V6CA
chains in the Genus database with same CATH topology
4HXXA 2GZ5A 4FLJA 2NQ6A 2P98A 3IU8A 4S00A 2BWWA 1WBQA 4IKSA 4RZYA 4U6JA 1W2MA 1QZYA 4IU6A 2GG0A 1YVMA 2B3LA 1R58A 3BIPA 4FLLA 3PKEA 2EVCA 5CDLA 4U71A 4QR8A 1MATA 4JUQA 4PNCA 5FCFA 2BWYA 4KM3A 5CNXA 4FKCA 1N51A 4A6VA 1C23A 4IECA 2B3HA 3CB6A 2NQ7A 3L24A 2B3KA 4ZWOA 4ZWUA 2Q94A 5JFRA 2GG8A 2BN7A 4ZWPA 2BWVA 2MATA 3IG4A 4IKTA 2GU5A 3TAVA 1XGSA 3MX6A 1QXZA 1XGMA 2GG5A 2BHBA 2GU7A 1R5GA 3S6BA 5CDEA 1WLRA 4FO7A 4IKUA 1WY2A 1M35A 3D27A 1Y1NA 3CTZA 5FCHA 1YW8A 1C24A 1WN1A 2Q92A 4OOKA 1YJ3A 3PKBA 4EGEA 2GG9A 1C27A 2GU4A 1WL6A 3FMQA 4S2TP 2GGCA 1BN5A 2G6PA 4IPAA 4PV4A 3BITA 2GG3A 1XGNA 2BHAA 4U75A 5CDVA 3IU7A 5CE6A 4FLIA 4R60A 3IU9A 2Q95A 3FMRA 4Z7MA 3Q6DA 1O0XA 5D6EA 2GG2A 2GG7A 1C22A 2EVMA 1BOAA 1PV9A 3FM3A 3MR1A 3PKAA 2IW2A 2EVOA 1WKMA 2OKNA 2Q8KA 1QXWA 4FO8A 1A16A 2DFIA 4IDYA 4MATA 1YW7A 1R5HA 3RORA 4S01A 4S2RP 1JAWA 2ADUA 2BHCA 2EA4A 2Q93A 2V3XA 3BIQA 4IKRA 5JI6A 2BWSA 1KQ0A 4U70A 4FLKA 5E5BA 2BWTA 1KQ9A 1QXYA 4B28A 1C21A 3L7GA 1B59A 2Q96A 2V3ZA 3MATA 1B6AA 3RVAA 5CLSA 1KP0A 1XGOA 2GTXA 3TB5A 4U1BA 4RZZA 4U6CA 4U6ZA 1YW9A 2GGBA 1CHMA 1WL9A 2EA2A 2OAZA 3CB5A 2V3YA 2P99A 2GA2A 5CIKA 4A6WA 4U73A 2HOWA 2BWUA 4IF7A 4U76A 2BWXA 5D6FA 2BH3A 4ZNGA 2GU6A 4RGZ1 4U6EA 4U6WA 4FUKA 1W7VA 1XNZA 3PKCA 5JHUA 4U69A 2BHDA 3PKDA 2ZSGA 2BB7A 2P9AA 2V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXX A;  2GZ5 A;  4FLJ A;  2NQ6 A;  2P98 A;  3IU8 A;  4S00 A;  2BWW A;  1WBQ A;  4IKS A;  4RZY A;  4U6J A;  1W2M A;  1QZY A;  4IU6 A;  2GG0 A;  1YVM A;  2B3L A;  1R58 A;  3BIP A;  4FLL A;  3PKE A;  2EVC A;  5CDL A;  4U71 A;  4QR8 A;  1MAT A;  4JUQ A;  4PNC A;  5FCF A;  2BWY A;  4KM3 A;  5CNX A;  4FKC A;  1N51 A;  4A6V A;  1C23 A;  4IEC A;  2B3H A;  3CB6 A;  2NQ7 A;  3L24 A;  2B3K A;  4ZWO A;  4ZWU A;  2Q94 A;  5JFR A;  2GG8 A;  2BN7 A;  4ZWP A;  2BWV A;  2MAT A;  3IG4 A;  4IKT A;  2GU5 A;  3TAV A;  1XGS A;  3MX6 A;  1QXZ A;  1XGM A;  2GG5 A;  2BHB A;  2GU7 A;  1R5G A;  3S6B A;  5CDE A;  1WLR A;  4FO7 A;  4IKU A;  1WY2 A;  1M35 A;  3D27 A;  1Y1N A;  3CTZ A;  5FCH A;  1YW8 A;  1C24 A;  1WN1 A;  2Q92 A;  4OOK A;  1YJ3 A;  3PKB A;  4EGE A;  2GG9 A;  1C27 A;  2GU4 A;  1WL6 A;  3FMQ A;  4S2T P;  2GGC A;  1BN5 A;  2G6P A;  4IPA A;  4PV4 A;  3BIT A;  2GG3 A;  1XGN A;  2BHA A;  4U75 A;  5CDV A;  3IU7 A;  5CE6 A;  4FLI A;  4R60 A;  3IU9 A;  2Q95 A;  3FMR A;  4Z7M A;  3Q6D A;  1O0X A;  5D6E A;  2GG2 A;  2GG7 A;  1C22 A;  2EVM A;  1BOA A;  1PV9 A;  3FM3 A;  3MR1 A;  3PKA A;  2IW2 A;  2EVO A;  1WKM A;  2OKN A;  2Q8K A;  1QXW A;  4FO8 A;  1A16 A;  2DFI A;  4IDY A;  4MAT A;  1YW7 A;  1R5H A;  3ROR A;  4S01 A;  4S2R P;  1JAW A;  2ADU A;  2BHC A;  2EA4 A;  2Q93 A;  2V3X A;  3BIQ A;  4IKR A;  5JI6 A;  2BWS A;  1KQ0 A;  4U70 A;  4FLK A;  5E5B A;  2BWT A;  1KQ9 A;  1QXY A;  4B28 A;  1C21 A;  3L7G A;  1B59 A;  2Q96 A;  2V3Z A;  3MAT A;  1B6A A;  3RVA A;  5CLS A;  1KP0 A;  1XGO A;  2GTX A;  3TB5 A;  4U1B A;  4RZZ A;  4U6C A;  4U6Z A;  1YW9 A;  2GGB A;  1CHM A;  1WL9 A;  2EA2 A;  2OAZ A;  3CB5 A;  2V3Y A;  2P99 A;  2GA2 A;  5CIK A;  4A6W A;  4U73 A;  2HOW A;  2BWU A;  4IF7 A;  4U76 A;  2BWX A;  5D6F A;  2BH3 A;  4ZNG A;  2GU6 A;  4RGZ 1;  4U6E A;  4U6W A;  4FUK A;  1W7V A;  1XNZ A;  3PKC A;  5JHU A;  4U69 A;  2BHD A;  3PKD A;  2ZSG A;  2BB7 A;  2P9A A;  2V6C A; 
#chains in the Genus database with same CATH topology
 4HXX A;  2GZ5 A;  4FLJ A;  2NQ6 A;  2P98 A;  3IU8 A;  4S00 A;  2BWW A;  1WBQ A;  4IKS A;  4RZY A;  4U6J A;  1W2M A;  1QZY A;  4IU6 A;  2GG0 A;  1YVM A;  2B3L A;  1R58 A;  3BIP A;  4FLL A;  3PKE A;  2EVC A;  5CDL A;  4U71 A;  4QR8 A;  1MAT A;  4JUQ A;  4PNC A;  5FCF A;  2BWY A;  4KM3 A;  5CNX A;  4FKC A;  1N51 A;  4A6V A;  1C23 A;  4IEC A;  2B3H A;  3CB6 A;  2NQ7 A;  3L24 A;  2B3K A;  4ZWO A;  4ZWU A;  2Q94 A;  5JFR A;  2GG8 A;  2BN7 A;  4ZWP A;  2BWV A;  2MAT A;  3IG4 A;  4IKT A;  2GU5 A;  3TAV A;  1XGS A;  3MX6 A;  1QXZ A;  1XGM A;  2GG5 A;  2BHB A;  2GU7 A;  1R5G A;  3S6B A;  5CDE A;  1WLR A;  4FO7 A;  4IKU A;  1WY2 A;  1M35 A;  3D27 A;  1Y1N A;  3CTZ A;  5FCH A;  1YW8 A;  1C24 A;  1WN1 A;  2Q92 A;  4OOK A;  1YJ3 A;  3PKB A;  4EGE A;  2GG9 A;  1C27 A;  2GU4 A;  1WL6 A;  3FMQ A;  4S2T P;  2GGC A;  1BN5 A;  2G6P A;  4IPA A;  4PV4 A;  3BIT A;  2GG3 A;  1XGN A;  2BHA A;  4U75 A;  5CDV A;  3IU7 A;  5CE6 A;  4FLI A;  4R60 A;  3IU9 A;  2Q95 A;  3FMR A;  4Z7M A;  3Q6D A;  1O0X A;  5D6E A;  2GG2 A;  2GG7 A;  1C22 A;  2EVM A;  1BOA A;  1PV9 A;  3FM3 A;  3MR1 A;  3PKA A;  2IW2 A;  2EVO A;  1WKM A;  2OKN A;  2Q8K A;  1QXW A;  4FO8 A;  1A16 A;  2DFI A;  4IDY A;  4MAT A;  1YW7 A;  1R5H A;  3ROR A;  4S01 A;  4S2R P;  1JAW A;  2ADU A;  2BHC A;  2EA4 A;  2Q93 A;  2V3X A;  3BIQ A;  4IKR A;  5JI6 A;  2BWS A;  1KQ0 A;  4U70 A;  4FLK A;  5E5B A;  2BWT A;  1KQ9 A;  1QXY A;  4B28 A;  1C21 A;  3L7G A;  1B59 A;  2Q96 A;  2V3Z A;  3MAT A;  1B6A A;  3RVA A;  5CLS A;  1KP0 A;  1XGO A;  2GTX A;  3TB5 A;  4U1B A;  4RZZ A;  4U6C A;  4U6Z A;  1YW9 A;  2GGB A;  1CHM A;  1WL9 A;  2EA2 A;  2OAZ A;  3CB5 A;  2V3Y A;  2P99 A;  2GA2 A;  5CIK A;  4A6W A;  4U73 A;  2HOW A;  2BWU A;  4IF7 A;  4U76 A;  2BWX A;  5D6F A;  2BH3 A;  4ZNG A;  2GU6 A;  4RGZ 1;  4U6E A;  4U6W A;  4FUK A;  1W7V A;  1XNZ A;  3PKC A;  5JHU A;  4U69 A;  2BHD A;  3PKD A;  2ZSG A;  2BB7 A;  2P9A A;  2V6C A; 
#chains in the Genus database with same CATH homology
 4HXX A;  2GZ5 A;  4FLJ A;  2NQ6 A;  2P98 A;  3IU8 A;  4S00 A;  2BWW A;  1WBQ A;  4IKS A;  4RZY A;  4U6J A;  1W2M A;  1QZY A;  4IU6 A;  2GG0 A;  1YVM A;  2B3L A;  1R58 A;  3BIP A;  4FLL A;  3PKE A;  2EVC A;  5CDL A;  4U71 A;  4QR8 A;  1MAT A;  4JUQ A;  4PNC A;  5FCF A;  2BWY A;  4KM3 A;  5CNX A;  4FKC A;  1N51 A;  4A6V A;  1C23 A;  4IEC A;  2B3H A;  3CB6 A;  2NQ7 A;  3L24 A;  2B3K A;  4ZWO A;  4ZWU A;  2Q94 A;  5JFR A;  2GG8 A;  2BN7 A;  4ZWP A;  2BWV A;  2MAT A;  3IG4 A;  4IKT A;  2GU5 A;  3TAV A;  1XGS A;  3MX6 A;  1QXZ A;  1XGM A;  2GG5 A;  2BHB A;  2GU7 A;  1R5G A;  3S6B A;  5CDE A;  1WLR A;  4FO7 A;  4IKU A;  1WY2 A;  1M35 A;  3D27 A;  1Y1N A;  3CTZ A;  5FCH A;  1YW8 A;  1C24 A;  1WN1 A;  2Q92 A;  4OOK A;  1YJ3 A;  3PKB A;  4EGE A;  2GG9 A;  1C27 A;  2GU4 A;  1WL6 A;  3FMQ A;  4S2T P;  2GGC A;  1BN5 A;  2G6P A;  4IPA A;  4PV4 A;  3BIT A;  2GG3 A;  1XGN A;  2BHA A;  4U75 A;  5CDV A;  3IU7 A;  5CE6 A;  4FLI A;  4R60 A;  3IU9 A;  2Q95 A;  3FMR A;  4Z7M A;  3Q6D A;  1O0X A;  5D6E A;  2GG2 A;  2GG7 A;  1C22 A;  2EVM A;  1BOA A;  1PV9 A;  3FM3 A;  3MR1 A;  3PKA A;  2IW2 A;  2EVO A;  1WKM A;  2OKN A;  2Q8K A;  1QXW A;  4FO8 A;  1A16 A;  2DFI A;  4IDY A;  4MAT A;  1YW7 A;  1R5H A;  3ROR A;  4S01 A;  4S2R P;  1JAW A;  2ADU A;  2BHC A;  2EA4 A;  2Q93 A;  2V3X A;  3BIQ A;  4IKR A;  5JI6 A;  2BWS A;  1KQ0 A;  4U70 A;  4FLK A;  5E5B A;  2BWT A;  1KQ9 A;  1QXY A;  4B28 A;  1C21 A;  3L7G A;  1B59 A;  2Q96 A;  2V3Z A;  3MAT A;  1B6A A;  3RVA A;  5CLS A;  1KP0 A;  1XGO A;  2GTX A;  3TB5 A;  4U1B A;  4RZZ A;  4U6C A;  4U6Z A;  1YW9 A;  2GGB A;  1CHM A;  1WL9 A;  2EA2 A;  2OAZ A;  3CB5 A;  2V3Y A;  2P99 A;  2GA2 A;  5CIK A;  4A6W A;  4U73 A;  2HOW A;  2BWU A;  4IF7 A;  4U76 A;  2BWX A;  5D6F A;  2BH3 A;  4ZNG A;  2GU6 A;  4RGZ 1;  4U6E A;  4U6W A;  4FUK A;  1W7V A;  1XNZ A;  3PKC A;  5JHU A;  4U69 A;  2BHD A;  3PKD A;  2ZSG A;  2BB7 A;  2P9A A;  2V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...