4FLLA

Human metap1 with bengamide analog yz6, in mn form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fllA00
3FM3A 1MATA 2BHCA 2GTXA 2Q93A 1YW7A 4U6ZA 2P99A 2OAZA 1YW8A 3PKBA 5CIKA 4FLKA 4ZWPA 2GU6A 2Q95A 3MATA 1WL6A 4ZWOA 2DFIA 1XNZA 2GG0A 2BWYA 4IKSA 2BHBA 2GG5A 2IW2A 3PKEA 4U6WA 4A6VA 4U69A 4U6EA 2BH3A 1QXYA 1WLRA 5JHUA 4QR8A 2BWSA 4S2TP 4U6CA 1XGMA 5CLSA 5CDEA 4FO8A 3IG4A 3IU7A 1QXZA 1Y1NA 2P9AA 4KM3A 4B28A 1C24A 4IKTA 1W2MA 1KQ0A 2GGBA 3L7GA 3PKAA 4FLJA 4RZZA 5D6FA 4OOKA 4S00A 3RORA 4IECA 1QXWA 3TAVA 2EVOA 2V3YA 2V3ZA 2P98A 2G6PA 3CTZA 2BWUA 5CDLA 2NQ7A 1B59A 4U1BA 1XGOA 2BWWA 2GG8A 4U6JA 2B3LA 2BHDA 4R60A 2OKNA 5JFRA 1JAWA 4U75A 2GU5A 1R5HA 1C23A 2BWTA 3CB6A 3D27A 1R58A 4Z7MA 2EA4A 5D6EA 5CNXA 1WKMA 2EVCA 3FMQA 3BIPA 5CE6A 4PV4A 2HOWA 3FMRA 4JUQA 1B6AA 1C22A 1YJ3A 3CB5A 3MR1A 2B3KA 1W7VA 2B3HA 2ADUA 1A16A 2Q96A 1XGNA 4PNCA 2Q94A 4IPAA 1N51A 3L24A 4U73A 3IU8A 2GU4A 3PKCA 2BB7A 2BWVA 3IU9A 1O0XA 1WY2A 3RVAA 2GG9A 3MX6A 1KP0A 3PKDA 1YW9A 1KQ9A 4IDYA 1CHMA 1XGSA 4U70A 5FCHA 1WL9A 4U76A 4HXXA 1BN5A 1YVMA 2GU7A 2GZ5A 2ZSGA 2V3XA 2EA2A 4FO7A 4IU6A 3TB5A 2BWXA 3BIQA 4MATA 1M35A 4FLLA 5E5BA 2NQ6A 5FCFA 4U71A 4FUKA 4RZYA 4IF7A 2GG3A 4ZWUA 4S01A 3S6BA 4FKCA 1QZYA 2GG7A 1C21A 4IKRA 4RGZ1 1WBQA 1C27A 2GA2A 2GGCA 4ZNGA 4EGEA 3Q6DA 4IKUA 4FLIA 5CDVA 2BN7A 2Q92A 2GG2A 5JI6A 4S2RP 2Q8KA 1R5GA 1BOAA 1PV9A 3BITA 4A6WA 2V6CA 1WN1A 2BHAA 2MATA 2EVMA
chains in the Genus database with same CATH superfamily
3FM3A 1MATA 2BHCA 2GTXA 2Q93A 1YW7A 4U6ZA 2P99A 2OAZA 1YW8A 3PKBA 5CIKA 4FLKA 4ZWPA 2GU6A 2Q95A 3MATA 1WL6A 4ZWOA 2DFIA 1XNZA 2GG0A 2BWYA 4IKSA 2BHBA 2GG5A 2IW2A 3PKEA 4U6WA 4A6VA 4U69A 4U6EA 2BH3A 1QXYA 1WLRA 5JHUA 4QR8A 2BWSA 4S2TP 4U6CA 1XGMA 5CLSA 5CDEA 4FO8A 3IG4A 3IU7A 1QXZA 1Y1NA 2P9AA 4KM3A 4B28A 1C24A 4IKTA 1W2MA 1KQ0A 2GGBA 3L7GA 3PKAA 4FLJA 4RZZA 5D6FA 4OOKA 4S00A 3RORA 4IECA 1QXWA 3TAVA 2EVOA 2V3YA 2V3ZA 2P98A 2G6PA 3CTZA 2BWUA 5CDLA 2NQ7A 1B59A 4U1BA 1XGOA 2BWWA 2GG8A 4U6JA 2B3LA 2BHDA 4R60A 2OKNA 5JFRA 1JAWA 4U75A 2GU5A 1R5HA 1C23A 2BWTA 3CB6A 3D27A 1R58A 4Z7MA 2EA4A 5D6EA 5CNXA 1WKMA 2EVCA 3FMQA 3BIPA 5CE6A 4PV4A 2HOWA 3FMRA 4JUQA 1B6AA 1C22A 1YJ3A 3CB5A 3MR1A 2B3KA 1W7VA 2B3HA 2ADUA 1A16A 2Q96A 1XGNA 4PNCA 2Q94A 4IPAA 1N51A 3L24A 4U73A 3IU8A 2GU4A 3PKCA 2BB7A 2BWVA 3IU9A 1O0XA 1WY2A 3RVAA 2GG9A 3MX6A 1KP0A 3PKDA 1YW9A 1KQ9A 4IDYA 1CHMA 1XGSA 4U70A 5FCHA 1WL9A 4U76A 4HXXA 1BN5A 1YVMA 2GU7A 2GZ5A 2ZSGA 2V3XA 2EA2A 4FO7A 4IU6A 3TB5A 2BWXA 3BIQA 4MATA 1M35A 4FLLA 5E5BA 2NQ6A 5FCFA 4U71A 4FUKA 4RZYA 4IF7A 2GG3A 4ZWUA 4S01A 3S6BA 4FKCA 1QZYA 2GG7A 1C21A 4IKRA 4RGZ1 1WBQA 1C27A 2GA2A 2GGCA 4ZNGA 4EGEA 3Q6DA 4IKUA 4FLIA 5CDVA 2BN7A 2Q92A 2GG2A 5JI6A 4S2RP 2Q8KA 1R5GA 1BOAA 1PV9A 3BITA 4A6WA 2V6CA 1WN1A 2BHAA 2MATA 2EVMA
chains in the Genus database with same CATH topology
3FM3A 1MATA 2BHCA 2GTXA 2Q93A 1YW7A 4U6ZA 2P99A 2OAZA 1YW8A 3PKBA 5CIKA 4FLKA 4ZWPA 2GU6A 2Q95A 3MATA 1WL6A 4ZWOA 2DFIA 1XNZA 2GG0A 2BWYA 4IKSA 2BHBA 2GG5A 2IW2A 3PKEA 4U6WA 4A6VA 4U69A 4U6EA 2BH3A 1QXYA 1WLRA 5JHUA 4QR8A 2BWSA 4S2TP 4U6CA 1XGMA 5CLSA 5CDEA 4FO8A 3IG4A 3IU7A 1QXZA 1Y1NA 2P9AA 4KM3A 4B28A 1C24A 4IKTA 1W2MA 1KQ0A 2GGBA 3L7GA 3PKAA 4FLJA 4RZZA 5D6FA 4OOKA 4S00A 3RORA 4IECA 1QXWA 3TAVA 2EVOA 2V3YA 2V3ZA 2P98A 2G6PA 3CTZA 2BWUA 5CDLA 2NQ7A 1B59A 4U1BA 1XGOA 2BWWA 2GG8A 4U6JA 2B3LA 2BHDA 4R60A 2OKNA 5JFRA 1JAWA 4U75A 2GU5A 1R5HA 1C23A 2BWTA 3CB6A 3D27A 1R58A 4Z7MA 2EA4A 5D6EA 5CNXA 1WKMA 2EVCA 3FMQA 3BIPA 5CE6A 4PV4A 2HOWA 3FMRA 4JUQA 1B6AA 1C22A 1YJ3A 3CB5A 3MR1A 2B3KA 1W7VA 2B3HA 2ADUA 1A16A 2Q96A 1XGNA 4PNCA 2Q94A 4IPAA 1N51A 3L24A 4U73A 3IU8A 2GU4A 3PKCA 2BB7A 2BWVA 3IU9A 1O0XA 1WY2A 3RVAA 2GG9A 3MX6A 1KP0A 3PKDA 1YW9A 1KQ9A 4IDYA 1CHMA 1XGSA 4U70A 5FCHA 1WL9A 4U76A 4HXXA 1BN5A 1YVMA 2GU7A 2GZ5A 2ZSGA 2V3XA 2EA2A 4FO7A 4IU6A 3TB5A 2BWXA 3BIQA 4MATA 1M35A 4FLLA 5E5BA 2NQ6A 5FCFA 4U71A 4FUKA 4RZYA 4IF7A 2GG3A 4ZWUA 4S01A 3S6BA 4FKCA 1QZYA 2GG7A 1C21A 4IKRA 4RGZ1 1WBQA 1C27A 2GA2A 2GGCA 4ZNGA 4EGEA 3Q6DA 4IKUA 4FLIA 5CDVA 2BN7A 2Q92A 2GG2A 5JI6A 4S2RP 2Q8KA 1R5GA 1BOAA 1PV9A 3BITA 4A6WA 2V6CA 1WN1A 2BHAA 2MATA 2EVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM3 A;  1MAT A;  2BHC A;  2GTX A;  2Q93 A;  1YW7 A;  4U6Z A;  2P99 A;  2OAZ A;  1YW8 A;  3PKB A;  5CIK A;  4FLK A;  4ZWP A;  2GU6 A;  2Q95 A;  3MAT A;  1WL6 A;  4ZWO A;  2DFI A;  1XNZ A;  2GG0 A;  2BWY A;  4IKS A;  2BHB A;  2GG5 A;  2IW2 A;  3PKE A;  4U6W A;  4A6V A;  4U69 A;  4U6E A;  2BH3 A;  1QXY A;  1WLR A;  5JHU A;  4QR8 A;  2BWS A;  4S2T P;  4U6C A;  1XGM A;  5CLS A;  5CDE A;  4FO8 A;  3IG4 A;  3IU7 A;  1QXZ A;  1Y1N A;  2P9A A;  4KM3 A;  4B28 A;  1C24 A;  4IKT A;  1W2M A;  1KQ0 A;  2GGB A;  3L7G A;  3PKA A;  4FLJ A;  4RZZ A;  5D6F A;  4OOK A;  4S00 A;  3ROR A;  4IEC A;  1QXW A;  3TAV A;  2EVO A;  2V3Y A;  2V3Z A;  2P98 A;  2G6P A;  3CTZ A;  2BWU A;  5CDL A;  2NQ7 A;  1B59 A;  4U1B A;  1XGO A;  2BWW A;  2GG8 A;  4U6J A;  2B3L A;  2BHD A;  4R60 A;  2OKN A;  5JFR A;  1JAW A;  4U75 A;  2GU5 A;  1R5H A;  1C23 A;  2BWT A;  3CB6 A;  3D27 A;  1R58 A;  4Z7M A;  2EA4 A;  5D6E A;  5CNX A;  1WKM A;  2EVC A;  3FMQ A;  3BIP A;  5CE6 A;  4PV4 A;  2HOW A;  3FMR A;  4JUQ A;  1B6A A;  1C22 A;  1YJ3 A;  3CB5 A;  3MR1 A;  2B3K A;  1W7V A;  2B3H A;  2ADU A;  1A16 A;  2Q96 A;  1XGN A;  4PNC A;  2Q94 A;  4IPA A;  1N51 A;  3L24 A;  4U73 A;  3IU8 A;  2GU4 A;  3PKC A;  2BB7 A;  2BWV A;  3IU9 A;  1O0X A;  1WY2 A;  3RVA A;  2GG9 A;  3MX6 A;  1KP0 A;  3PKD A;  1YW9 A;  1KQ9 A;  4IDY A;  1CHM A;  1XGS A;  4U70 A;  5FCH A;  1WL9 A;  4U76 A;  4HXX A;  1BN5 A;  1YVM A;  2GU7 A;  2GZ5 A;  2ZSG A;  2V3X A;  2EA2 A;  4FO7 A;  4IU6 A;  3TB5 A;  2BWX A;  3BIQ A;  4MAT A;  1M35 A;  4FLL A;  5E5B A;  2NQ6 A;  5FCF A;  4U71 A;  4FUK A;  4RZY A;  4IF7 A;  2GG3 A;  4ZWU A;  4S01 A;  3S6B A;  4FKC A;  1QZY A;  2GG7 A;  1C21 A;  4IKR A;  4RGZ 1;  1WBQ A;  1C27 A;  2GA2 A;  2GGC A;  4ZNG A;  4EGE A;  3Q6D A;  4IKU A;  4FLI A;  5CDV A;  2BN7 A;  2Q92 A;  2GG2 A;  5JI6 A;  4S2R P;  2Q8K A;  1R5G A;  1BOA A;  1PV9 A;  3BIT A;  4A6W A;  2V6C A;  1WN1 A;  2BHA A;  2MAT A;  2EVM A; 
#chains in the Genus database with same CATH topology
 3FM3 A;  1MAT A;  2BHC A;  2GTX A;  2Q93 A;  1YW7 A;  4U6Z A;  2P99 A;  2OAZ A;  1YW8 A;  3PKB A;  5CIK A;  4FLK A;  4ZWP A;  2GU6 A;  2Q95 A;  3MAT A;  1WL6 A;  4ZWO A;  2DFI A;  1XNZ A;  2GG0 A;  2BWY A;  4IKS A;  2BHB A;  2GG5 A;  2IW2 A;  3PKE A;  4U6W A;  4A6V A;  4U69 A;  4U6E A;  2BH3 A;  1QXY A;  1WLR A;  5JHU A;  4QR8 A;  2BWS A;  4S2T P;  4U6C A;  1XGM A;  5CLS A;  5CDE A;  4FO8 A;  3IG4 A;  3IU7 A;  1QXZ A;  1Y1N A;  2P9A A;  4KM3 A;  4B28 A;  1C24 A;  4IKT A;  1W2M A;  1KQ0 A;  2GGB A;  3L7G A;  3PKA A;  4FLJ A;  4RZZ A;  5D6F A;  4OOK A;  4S00 A;  3ROR A;  4IEC A;  1QXW A;  3TAV A;  2EVO A;  2V3Y A;  2V3Z A;  2P98 A;  2G6P A;  3CTZ A;  2BWU A;  5CDL A;  2NQ7 A;  1B59 A;  4U1B A;  1XGO A;  2BWW A;  2GG8 A;  4U6J A;  2B3L A;  2BHD A;  4R60 A;  2OKN A;  5JFR A;  1JAW A;  4U75 A;  2GU5 A;  1R5H A;  1C23 A;  2BWT A;  3CB6 A;  3D27 A;  1R58 A;  4Z7M A;  2EA4 A;  5D6E A;  5CNX A;  1WKM A;  2EVC A;  3FMQ A;  3BIP A;  5CE6 A;  4PV4 A;  2HOW A;  3FMR A;  4JUQ A;  1B6A A;  1C22 A;  1YJ3 A;  3CB5 A;  3MR1 A;  2B3K A;  1W7V A;  2B3H A;  2ADU A;  1A16 A;  2Q96 A;  1XGN A;  4PNC A;  2Q94 A;  4IPA A;  1N51 A;  3L24 A;  4U73 A;  3IU8 A;  2GU4 A;  3PKC A;  2BB7 A;  2BWV A;  3IU9 A;  1O0X A;  1WY2 A;  3RVA A;  2GG9 A;  3MX6 A;  1KP0 A;  3PKD A;  1YW9 A;  1KQ9 A;  4IDY A;  1CHM A;  1XGS A;  4U70 A;  5FCH A;  1WL9 A;  4U76 A;  4HXX A;  1BN5 A;  1YVM A;  2GU7 A;  2GZ5 A;  2ZSG A;  2V3X A;  2EA2 A;  4FO7 A;  4IU6 A;  3TB5 A;  2BWX A;  3BIQ A;  4MAT A;  1M35 A;  4FLL A;  5E5B A;  2NQ6 A;  5FCF A;  4U71 A;  4FUK A;  4RZY A;  4IF7 A;  2GG3 A;  4ZWU A;  4S01 A;  3S6B A;  4FKC A;  1QZY A;  2GG7 A;  1C21 A;  4IKR A;  4RGZ 1;  1WBQ A;  1C27 A;  2GA2 A;  2GGC A;  4ZNG A;  4EGE A;  3Q6D A;  4IKU A;  4FLI A;  5CDV A;  2BN7 A;  2Q92 A;  2GG2 A;  5JI6 A;  4S2R P;  2Q8K A;  1R5G A;  1BOA A;  1PV9 A;  3BIT A;  4A6W A;  2V6C A;  1WN1 A;  2BHA A;  2MAT A;  2EVM A; 
#chains in the Genus database with same CATH homology
 3FM3 A;  1MAT A;  2BHC A;  2GTX A;  2Q93 A;  1YW7 A;  4U6Z A;  2P99 A;  2OAZ A;  1YW8 A;  3PKB A;  5CIK A;  4FLK A;  4ZWP A;  2GU6 A;  2Q95 A;  3MAT A;  1WL6 A;  4ZWO A;  2DFI A;  1XNZ A;  2GG0 A;  2BWY A;  4IKS A;  2BHB A;  2GG5 A;  2IW2 A;  3PKE A;  4U6W A;  4A6V A;  4U69 A;  4U6E A;  2BH3 A;  1QXY A;  1WLR A;  5JHU A;  4QR8 A;  2BWS A;  4S2T P;  4U6C A;  1XGM A;  5CLS A;  5CDE A;  4FO8 A;  3IG4 A;  3IU7 A;  1QXZ A;  1Y1N A;  2P9A A;  4KM3 A;  4B28 A;  1C24 A;  4IKT A;  1W2M A;  1KQ0 A;  2GGB A;  3L7G A;  3PKA A;  4FLJ A;  4RZZ A;  5D6F A;  4OOK A;  4S00 A;  3ROR A;  4IEC A;  1QXW A;  3TAV A;  2EVO A;  2V3Y A;  2V3Z A;  2P98 A;  2G6P A;  3CTZ A;  2BWU A;  5CDL A;  2NQ7 A;  1B59 A;  4U1B A;  1XGO A;  2BWW A;  2GG8 A;  4U6J A;  2B3L A;  2BHD A;  4R60 A;  2OKN A;  5JFR A;  1JAW A;  4U75 A;  2GU5 A;  1R5H A;  1C23 A;  2BWT A;  3CB6 A;  3D27 A;  1R58 A;  4Z7M A;  2EA4 A;  5D6E A;  5CNX A;  1WKM A;  2EVC A;  3FMQ A;  3BIP A;  5CE6 A;  4PV4 A;  2HOW A;  3FMR A;  4JUQ A;  1B6A A;  1C22 A;  1YJ3 A;  3CB5 A;  3MR1 A;  2B3K A;  1W7V A;  2B3H A;  2ADU A;  1A16 A;  2Q96 A;  1XGN A;  4PNC A;  2Q94 A;  4IPA A;  1N51 A;  3L24 A;  4U73 A;  3IU8 A;  2GU4 A;  3PKC A;  2BB7 A;  2BWV A;  3IU9 A;  1O0X A;  1WY2 A;  3RVA A;  2GG9 A;  3MX6 A;  1KP0 A;  3PKD A;  1YW9 A;  1KQ9 A;  4IDY A;  1CHM A;  1XGS A;  4U70 A;  5FCH A;  1WL9 A;  4U76 A;  4HXX A;  1BN5 A;  1YVM A;  2GU7 A;  2GZ5 A;  2ZSG A;  2V3X A;  2EA2 A;  4FO7 A;  4IU6 A;  3TB5 A;  2BWX A;  3BIQ A;  4MAT A;  1M35 A;  4FLL A;  5E5B A;  2NQ6 A;  5FCF A;  4U71 A;  4FUK A;  4RZY A;  4IF7 A;  2GG3 A;  4ZWU A;  4S01 A;  3S6B A;  4FKC A;  1QZY A;  2GG7 A;  1C21 A;  4IKR A;  4RGZ 1;  1WBQ A;  1C27 A;  2GA2 A;  2GGC A;  4ZNG A;  4EGE A;  3Q6D A;  4IKU A;  4FLI A;  5CDV A;  2BN7 A;  2Q92 A;  2GG2 A;  5JI6 A;  4S2R P;  2Q8K A;  1R5G A;  1BOA A;  1PV9 A;  3BIT A;  4A6W A;  2V6C A;  1WN1 A;  2BHA A;  2MAT A;  2EVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...