4FLLA

Human metap1 with bengamide analog yz6, in mn form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fllA00
2P98A 3IG4A 2P99A 2HOWA 2BH3A 1WN1A 2B3HA 1KQ9A 4U1BA 1QZYA 1YW7A 4IPAA 3PKCA 2BN7A 4RZYA 5CIKA 1B59A 3IU9A 5FCFA 4A6WA 1C24A 2Q94A 4S2RP 4U6WA 4B28A 1KP0A 4QR8A 3MATA 2GGBA 4IF7A 3PKAA 1BOAA 4IU6A 2GG7A 3BIPA 1M35A 4S2TP 4FLJA 4FKCA 2IW2A 3MX6A 1W2MA 2NQ7A 4JUQA 2MATA 4U71A 4OOKA 4FUKA 2BWSA 1C21A 2EVCA 5D6EA 4ZWPA 3TAVA 2OKNA 4ZNGA 4IECA 3IU7A 1R5HA 4MATA 2EVOA 5CDVA 1MATA 1YW8A 3L7GA 4FLKA 2GG2A 1R58A 2OAZA 3CTZA 3FMRA 4ZWUA 1YW9A 1C23A 5E5BA 2GU5A 1XNZA 4U6EA 4ZWOA 4U6CA 1KQ0A 2EA4A 2Q93A 1QXZA 3PKBA 1W7VA 2ADUA 2GG8A 2GTXA 4Z7MA 2EVMA 4U6JA 3TB5A 1O0XA 2GZ5A 2Q95A 3RORA 1C27A 2B3KA 2BHAA 3FMQA 5FCHA 4IKTA 2GA2A 1CHMA 1YVMA 3BIQA 3Q6DA 4FLLA 4FO7A 4U76A 5CLSA 4U69A 4PNCA 4RGZ1 5JI6A 2BWUA 1Y1NA 1WL9A 2BHBA 2GG0A 3IU8A 4IKRA 1JAWA 5CNXA 2GU6A 2BWYA 2BWXA 3S6BA 4A6VA 1R5GA 2DFIA 2GG9A 1A16A 2EA2A 2P9AA 4KM3A 2BB7A 2GG5A 1XGOA 1WBQA 1WY2A 5CDLA 1PV9A 5JFRA 4HXXA 5D6FA 4U6ZA 1QXYA 2V3XA 5CDEA 2V3ZA 1YJ3A 1N51A 1WLRA 2Q8KA 4IDYA 2GGCA 2Q92A 4U70A 2G6PA 2ZSGA 4R60A 2GU4A 2GG3A 3PKDA 2NQ6A 1WKMA 1B6AA 1BN5A 3BITA 3CB6A 4EGEA 1XGNA 1XGSA 2B3LA 4IKSA 2Q96A 3CB5A 2V3YA 1C22A 4S00A 2BHDA 2GU7A 3PKEA 3FM3A 4U73A 4U75A 4PV4A 4FLIA 3RVAA 2V6CA 5JHUA 3MR1A 2BWWA 2BHCA 1QXWA 2BWTA 4IKUA 4RZZA 3L24A 1XGMA 4FO8A 5CE6A 1WL6A 2BWVA 3D27A 4S01A
chains in the Genus database with same CATH superfamily
2P98A 3IG4A 2P99A 2HOWA 2BH3A 1WN1A 2B3HA 1KQ9A 4U1BA 1QZYA 1YW7A 4IPAA 3PKCA 2BN7A 4RZYA 5CIKA 1B59A 3IU9A 5FCFA 4A6WA 1C24A 2Q94A 4S2RP 4U6WA 4B28A 1KP0A 4QR8A 3MATA 2GGBA 4IF7A 3PKAA 1BOAA 4IU6A 2GG7A 3BIPA 1M35A 4S2TP 4FLJA 4FKCA 2IW2A 3MX6A 1W2MA 2NQ7A 4JUQA 2MATA 4U71A 4OOKA 4FUKA 2BWSA 1C21A 2EVCA 5D6EA 4ZWPA 3TAVA 2OKNA 4ZNGA 4IECA 3IU7A 1R5HA 4MATA 2EVOA 5CDVA 1MATA 1YW8A 3L7GA 4FLKA 2GG2A 1R58A 2OAZA 3CTZA 3FMRA 4ZWUA 1YW9A 1C23A 5E5BA 2GU5A 1XNZA 4U6EA 4ZWOA 4U6CA 1KQ0A 2EA4A 2Q93A 1QXZA 3PKBA 1W7VA 2ADUA 2GG8A 2GTXA 4Z7MA 2EVMA 4U6JA 3TB5A 1O0XA 2GZ5A 2Q95A 3RORA 1C27A 2B3KA 2BHAA 3FMQA 5FCHA 4IKTA 2GA2A 1CHMA 1YVMA 3BIQA 3Q6DA 4FLLA 4FO7A 4U76A 5CLSA 4U69A 4PNCA 4RGZ1 5JI6A 2BWUA 1Y1NA 1WL9A 2BHBA 2GG0A 3IU8A 4IKRA 1JAWA 5CNXA 2GU6A 2BWYA 2BWXA 3S6BA 4A6VA 1R5GA 2DFIA 2GG9A 1A16A 2EA2A 2P9AA 4KM3A 2BB7A 2GG5A 1XGOA 1WBQA 1WY2A 5CDLA 1PV9A 5JFRA 4HXXA 5D6FA 4U6ZA 1QXYA 2V3XA 5CDEA 2V3ZA 1YJ3A 1N51A 1WLRA 2Q8KA 4IDYA 2GGCA 2Q92A 4U70A 2G6PA 2ZSGA 4R60A 2GU4A 2GG3A 3PKDA 2NQ6A 1WKMA 1B6AA 1BN5A 3BITA 3CB6A 4EGEA 1XGNA 1XGSA 2B3LA 4IKSA 2Q96A 3CB5A 2V3YA 1C22A 4S00A 2BHDA 2GU7A 3PKEA 3FM3A 4U73A 4U75A 4PV4A 4FLIA 3RVAA 2V6CA 5JHUA 3MR1A 2BWWA 2BHCA 1QXWA 2BWTA 4IKUA 4RZZA 3L24A 1XGMA 4FO8A 5CE6A 1WL6A 2BWVA 3D27A 4S01A
chains in the Genus database with same CATH topology
2P98A 3IG4A 2P99A 2HOWA 2BH3A 1WN1A 2B3HA 1KQ9A 4U1BA 1QZYA 1YW7A 4IPAA 3PKCA 2BN7A 4RZYA 5CIKA 1B59A 3IU9A 5FCFA 4A6WA 1C24A 2Q94A 4S2RP 4U6WA 4B28A 1KP0A 4QR8A 3MATA 2GGBA 4IF7A 3PKAA 1BOAA 4IU6A 2GG7A 3BIPA 1M35A 4S2TP 4FLJA 4FKCA 2IW2A 3MX6A 1W2MA 2NQ7A 4JUQA 2MATA 4U71A 4OOKA 4FUKA 2BWSA 1C21A 2EVCA 5D6EA 4ZWPA 3TAVA 2OKNA 4ZNGA 4IECA 3IU7A 1R5HA 4MATA 2EVOA 5CDVA 1MATA 1YW8A 3L7GA 4FLKA 2GG2A 1R58A 2OAZA 3CTZA 3FMRA 4ZWUA 1YW9A 1C23A 5E5BA 2GU5A 1XNZA 4U6EA 4ZWOA 4U6CA 1KQ0A 2EA4A 2Q93A 1QXZA 3PKBA 1W7VA 2ADUA 2GG8A 2GTXA 4Z7MA 2EVMA 4U6JA 3TB5A 1O0XA 2GZ5A 2Q95A 3RORA 1C27A 2B3KA 2BHAA 3FMQA 5FCHA 4IKTA 2GA2A 1CHMA 1YVMA 3BIQA 3Q6DA 4FLLA 4FO7A 4U76A 5CLSA 4U69A 4PNCA 4RGZ1 5JI6A 2BWUA 1Y1NA 1WL9A 2BHBA 2GG0A 3IU8A 4IKRA 1JAWA 5CNXA 2GU6A 2BWYA 2BWXA 3S6BA 4A6VA 1R5GA 2DFIA 2GG9A 1A16A 2EA2A 2P9AA 4KM3A 2BB7A 2GG5A 1XGOA 1WBQA 1WY2A 5CDLA 1PV9A 5JFRA 4HXXA 5D6FA 4U6ZA 1QXYA 2V3XA 5CDEA 2V3ZA 1YJ3A 1N51A 1WLRA 2Q8KA 4IDYA 2GGCA 2Q92A 4U70A 2G6PA 2ZSGA 4R60A 2GU4A 2GG3A 3PKDA 2NQ6A 1WKMA 1B6AA 1BN5A 3BITA 3CB6A 4EGEA 1XGNA 1XGSA 2B3LA 4IKSA 2Q96A 3CB5A 2V3YA 1C22A 4S00A 2BHDA 2GU7A 3PKEA 3FM3A 4U73A 4U75A 4PV4A 4FLIA 3RVAA 2V6CA 5JHUA 3MR1A 2BWWA 2BHCA 1QXWA 2BWTA 4IKUA 4RZZA 3L24A 1XGMA 4FO8A 5CE6A 1WL6A 2BWVA 3D27A 4S01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P98 A;  3IG4 A;  2P99 A;  2HOW A;  2BH3 A;  1WN1 A;  2B3H A;  1KQ9 A;  4U1B A;  1QZY A;  1YW7 A;  4IPA A;  3PKC A;  2BN7 A;  4RZY A;  5CIK A;  1B59 A;  3IU9 A;  5FCF A;  4A6W A;  1C24 A;  2Q94 A;  4S2R P;  4U6W A;  4B28 A;  1KP0 A;  4QR8 A;  3MAT A;  2GGB A;  4IF7 A;  3PKA A;  1BOA A;  4IU6 A;  2GG7 A;  3BIP A;  1M35 A;  4S2T P;  4FLJ A;  4FKC A;  2IW2 A;  3MX6 A;  1W2M A;  2NQ7 A;  4JUQ A;  2MAT A;  4U71 A;  4OOK A;  4FUK A;  2BWS A;  1C21 A;  2EVC A;  5D6E A;  4ZWP A;  3TAV A;  2OKN A;  4ZNG A;  4IEC A;  3IU7 A;  1R5H A;  4MAT A;  2EVO A;  5CDV A;  1MAT A;  1YW8 A;  3L7G A;  4FLK A;  2GG2 A;  1R58 A;  2OAZ A;  3CTZ A;  3FMR A;  4ZWU A;  1YW9 A;  1C23 A;  5E5B A;  2GU5 A;  1XNZ A;  4U6E A;  4ZWO A;  4U6C A;  1KQ0 A;  2EA4 A;  2Q93 A;  1QXZ A;  3PKB A;  1W7V A;  2ADU A;  2GG8 A;  2GTX A;  4Z7M A;  2EVM A;  4U6J A;  3TB5 A;  1O0X A;  2GZ5 A;  2Q95 A;  3ROR A;  1C27 A;  2B3K A;  2BHA A;  3FMQ A;  5FCH A;  4IKT A;  2GA2 A;  1CHM A;  1YVM A;  3BIQ A;  3Q6D A;  4FLL A;  4FO7 A;  4U76 A;  5CLS A;  4U69 A;  4PNC A;  4RGZ 1;  5JI6 A;  2BWU A;  1Y1N A;  1WL9 A;  2BHB A;  2GG0 A;  3IU8 A;  4IKR A;  1JAW A;  5CNX A;  2GU6 A;  2BWY A;  2BWX A;  3S6B A;  4A6V A;  1R5G A;  2DFI A;  2GG9 A;  1A16 A;  2EA2 A;  2P9A A;  4KM3 A;  2BB7 A;  2GG5 A;  1XGO A;  1WBQ A;  1WY2 A;  5CDL A;  1PV9 A;  5JFR A;  4HXX A;  5D6F A;  4U6Z A;  1QXY A;  2V3X A;  5CDE A;  2V3Z A;  1YJ3 A;  1N51 A;  1WLR A;  2Q8K A;  4IDY A;  2GGC A;  2Q92 A;  4U70 A;  2G6P A;  2ZSG A;  4R60 A;  2GU4 A;  2GG3 A;  3PKD A;  2NQ6 A;  1WKM A;  1B6A A;  1BN5 A;  3BIT A;  3CB6 A;  4EGE A;  1XGN A;  1XGS A;  2B3L A;  4IKS A;  2Q96 A;  3CB5 A;  2V3Y A;  1C22 A;  4S00 A;  2BHD A;  2GU7 A;  3PKE A;  3FM3 A;  4U73 A;  4U75 A;  4PV4 A;  4FLI A;  3RVA A;  2V6C A;  5JHU A;  3MR1 A;  2BWW A;  2BHC A;  1QXW A;  2BWT A;  4IKU A;  4RZZ A;  3L24 A;  1XGM A;  4FO8 A;  5CE6 A;  1WL6 A;  2BWV A;  3D27 A;  4S01 A; 
#chains in the Genus database with same CATH topology
 2P98 A;  3IG4 A;  2P99 A;  2HOW A;  2BH3 A;  1WN1 A;  2B3H A;  1KQ9 A;  4U1B A;  1QZY A;  1YW7 A;  4IPA A;  3PKC A;  2BN7 A;  4RZY A;  5CIK A;  1B59 A;  3IU9 A;  5FCF A;  4A6W A;  1C24 A;  2Q94 A;  4S2R P;  4U6W A;  4B28 A;  1KP0 A;  4QR8 A;  3MAT A;  2GGB A;  4IF7 A;  3PKA A;  1BOA A;  4IU6 A;  2GG7 A;  3BIP A;  1M35 A;  4S2T P;  4FLJ A;  4FKC A;  2IW2 A;  3MX6 A;  1W2M A;  2NQ7 A;  4JUQ A;  2MAT A;  4U71 A;  4OOK A;  4FUK A;  2BWS A;  1C21 A;  2EVC A;  5D6E A;  4ZWP A;  3TAV A;  2OKN A;  4ZNG A;  4IEC A;  3IU7 A;  1R5H A;  4MAT A;  2EVO A;  5CDV A;  1MAT A;  1YW8 A;  3L7G A;  4FLK A;  2GG2 A;  1R58 A;  2OAZ A;  3CTZ A;  3FMR A;  4ZWU A;  1YW9 A;  1C23 A;  5E5B A;  2GU5 A;  1XNZ A;  4U6E A;  4ZWO A;  4U6C A;  1KQ0 A;  2EA4 A;  2Q93 A;  1QXZ A;  3PKB A;  1W7V A;  2ADU A;  2GG8 A;  2GTX A;  4Z7M A;  2EVM A;  4U6J A;  3TB5 A;  1O0X A;  2GZ5 A;  2Q95 A;  3ROR A;  1C27 A;  2B3K A;  2BHA A;  3FMQ A;  5FCH A;  4IKT A;  2GA2 A;  1CHM A;  1YVM A;  3BIQ A;  3Q6D A;  4FLL A;  4FO7 A;  4U76 A;  5CLS A;  4U69 A;  4PNC A;  4RGZ 1;  5JI6 A;  2BWU A;  1Y1N A;  1WL9 A;  2BHB A;  2GG0 A;  3IU8 A;  4IKR A;  1JAW A;  5CNX A;  2GU6 A;  2BWY A;  2BWX A;  3S6B A;  4A6V A;  1R5G A;  2DFI A;  2GG9 A;  1A16 A;  2EA2 A;  2P9A A;  4KM3 A;  2BB7 A;  2GG5 A;  1XGO A;  1WBQ A;  1WY2 A;  5CDL A;  1PV9 A;  5JFR A;  4HXX A;  5D6F A;  4U6Z A;  1QXY A;  2V3X A;  5CDE A;  2V3Z A;  1YJ3 A;  1N51 A;  1WLR A;  2Q8K A;  4IDY A;  2GGC A;  2Q92 A;  4U70 A;  2G6P A;  2ZSG A;  4R60 A;  2GU4 A;  2GG3 A;  3PKD A;  2NQ6 A;  1WKM A;  1B6A A;  1BN5 A;  3BIT A;  3CB6 A;  4EGE A;  1XGN A;  1XGS A;  2B3L A;  4IKS A;  2Q96 A;  3CB5 A;  2V3Y A;  1C22 A;  4S00 A;  2BHD A;  2GU7 A;  3PKE A;  3FM3 A;  4U73 A;  4U75 A;  4PV4 A;  4FLI A;  3RVA A;  2V6C A;  5JHU A;  3MR1 A;  2BWW A;  2BHC A;  1QXW A;  2BWT A;  4IKU A;  4RZZ A;  3L24 A;  1XGM A;  4FO8 A;  5CE6 A;  1WL6 A;  2BWV A;  3D27 A;  4S01 A; 
#chains in the Genus database with same CATH homology
 2P98 A;  3IG4 A;  2P99 A;  2HOW A;  2BH3 A;  1WN1 A;  2B3H A;  1KQ9 A;  4U1B A;  1QZY A;  1YW7 A;  4IPA A;  3PKC A;  2BN7 A;  4RZY A;  5CIK A;  1B59 A;  3IU9 A;  5FCF A;  4A6W A;  1C24 A;  2Q94 A;  4S2R P;  4U6W A;  4B28 A;  1KP0 A;  4QR8 A;  3MAT A;  2GGB A;  4IF7 A;  3PKA A;  1BOA A;  4IU6 A;  2GG7 A;  3BIP A;  1M35 A;  4S2T P;  4FLJ A;  4FKC A;  2IW2 A;  3MX6 A;  1W2M A;  2NQ7 A;  4JUQ A;  2MAT A;  4U71 A;  4OOK A;  4FUK A;  2BWS A;  1C21 A;  2EVC A;  5D6E A;  4ZWP A;  3TAV A;  2OKN A;  4ZNG A;  4IEC A;  3IU7 A;  1R5H A;  4MAT A;  2EVO A;  5CDV A;  1MAT A;  1YW8 A;  3L7G A;  4FLK A;  2GG2 A;  1R58 A;  2OAZ A;  3CTZ A;  3FMR A;  4ZWU A;  1YW9 A;  1C23 A;  5E5B A;  2GU5 A;  1XNZ A;  4U6E A;  4ZWO A;  4U6C A;  1KQ0 A;  2EA4 A;  2Q93 A;  1QXZ A;  3PKB A;  1W7V A;  2ADU A;  2GG8 A;  2GTX A;  4Z7M A;  2EVM A;  4U6J A;  3TB5 A;  1O0X A;  2GZ5 A;  2Q95 A;  3ROR A;  1C27 A;  2B3K A;  2BHA A;  3FMQ A;  5FCH A;  4IKT A;  2GA2 A;  1CHM A;  1YVM A;  3BIQ A;  3Q6D A;  4FLL A;  4FO7 A;  4U76 A;  5CLS A;  4U69 A;  4PNC A;  4RGZ 1;  5JI6 A;  2BWU A;  1Y1N A;  1WL9 A;  2BHB A;  2GG0 A;  3IU8 A;  4IKR A;  1JAW A;  5CNX A;  2GU6 A;  2BWY A;  2BWX A;  3S6B A;  4A6V A;  1R5G A;  2DFI A;  2GG9 A;  1A16 A;  2EA2 A;  2P9A A;  4KM3 A;  2BB7 A;  2GG5 A;  1XGO A;  1WBQ A;  1WY2 A;  5CDL A;  1PV9 A;  5JFR A;  4HXX A;  5D6F A;  4U6Z A;  1QXY A;  2V3X A;  5CDE A;  2V3Z A;  1YJ3 A;  1N51 A;  1WLR A;  2Q8K A;  4IDY A;  2GGC A;  2Q92 A;  4U70 A;  2G6P A;  2ZSG A;  4R60 A;  2GU4 A;  2GG3 A;  3PKD A;  2NQ6 A;  1WKM A;  1B6A A;  1BN5 A;  3BIT A;  3CB6 A;  4EGE A;  1XGN A;  1XGS A;  2B3L A;  4IKS A;  2Q96 A;  3CB5 A;  2V3Y A;  1C22 A;  4S00 A;  2BHD A;  2GU7 A;  3PKE A;  3FM3 A;  4U73 A;  4U75 A;  4PV4 A;  4FLI A;  3RVA A;  2V6C A;  5JHU A;  3MR1 A;  2BWW A;  2BHC A;  1QXW A;  2BWT A;  4IKU A;  4RZZ A;  3L24 A;  1XGM A;  4FO8 A;  5CE6 A;  1WL6 A;  2BWV A;  3D27 A;  4S01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...