4FLLA

Human metap1 with bengamide analog yz6, in mn form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fllA00
1R5GA 1YJ3A 4IECA 2BWSA 3RORA 3BIQA 3FMRA 3CTZA 4A6VA 3PKCA 1WL9A 2BHAA 2BHDA 2GU6A 3CB6A 4S2TP 5CDVA 1BN5A 4B28A 3IU9A 3PKEA 4U6JA 4OOKA 2GA2A 1QXYA 1Y1NA 2GG0A 3Q6DA 4ZNGA 4U6WA 1YW9A 2B3HA 2P98A 4U75A 3PKDA 1R5HA 2G6PA 2BWTA 4U6CA 1KQ0A 1QXWA 5FCFA 1WN1A 2EA2A 1B59A 2BWVA 2Q95A 4ZWUA 2GGBA 2B3KA 5JI6A 4QR8A 1W7VA 2NQ7A 4IKSA 4IKTA 4JUQA 2GGCA 4MATA 4Z7MA 5D6FA 2GU4A 3L7GA 1XGSA 1QZYA 1WLRA 2Q93A 3FM3A 4IPAA 1WKMA 5JHUA 4U76A 2Q96A 2DFIA 4FO7A 1YW7A 2HOWA 3FMQA 3MATA 4S00A 5CDEA 4A6WA 2BN7A 4U69A 3IU7A 4ZWOA 2EA4A 1XGOA 1A16A 1KQ9A 4U6EA 4S01A 1YW8A 3IG4A 1C24A 4U6ZA 2IW2A 1KP0A 1M35A 4RZZA 2BH3A 2BWYA 3L24A 4KM3A 1BOAA 4HXXA 2GTXA 2GG8A 3BITA 1XGNA 5CNXA 3CB5A 2GG5A 1JAWA 4IKRA 1C22A 2GG3A 2NQ6A 1C23A 5D6EA 1C21A 4U1BA 1XNZA 2EVOA 4FLKA 4PV4A 4FLLA 2BWXA 2GG9A 4FLJA 2V6CA 2GZ5A 2V3XA 4IF7A 4FLIA 4FUKA 3IU8A 2BWUA 4IKUA 2ZSGA 2OKNA 2Q92A 3MR1A 4ZWPA 3D27A 2P9AA 1O0XA 3PKBA 1MATA 4R60A 2ADUA 2OAZA 1QXZA 1WY2A 2Q94A 4RZYA 5CIKA 5FCHA 1YVMA 2BHBA 3BIPA 4IU6A 1B6AA 4IDYA 1R58A 3TAVA 3TB5A 4S2RP 4FKCA 4U71A 2BWWA 4RGZ1 2Q8KA 4PNCA 1XGMA 2EVCA 1WL6A 1CHMA 3S6BA 3PKAA 5JFRA 4FO8A 2P99A 2V3YA 5CLSA 3RVAA 1PV9A 2EVMA 5E5BA 1C27A 2MATA 5CDLA 2GU7A 2BB7A 2GU5A 2BHCA 2V3ZA 2GG2A 1N51A 1W2MA 2B3LA 4EGEA 4U70A 3MX6A 4U73A 5CE6A 1WBQA 2GG7A
chains in the Genus database with same CATH superfamily
1R5GA 1YJ3A 4IECA 2BWSA 3RORA 3BIQA 3FMRA 3CTZA 4A6VA 3PKCA 1WL9A 2BHAA 2BHDA 2GU6A 3CB6A 4S2TP 5CDVA 1BN5A 4B28A 3IU9A 3PKEA 4U6JA 4OOKA 2GA2A 1QXYA 1Y1NA 2GG0A 3Q6DA 4ZNGA 4U6WA 1YW9A 2B3HA 2P98A 4U75A 3PKDA 1R5HA 2G6PA 2BWTA 4U6CA 1KQ0A 1QXWA 5FCFA 1WN1A 2EA2A 1B59A 2BWVA 2Q95A 4ZWUA 2GGBA 2B3KA 5JI6A 4QR8A 1W7VA 2NQ7A 4IKSA 4IKTA 4JUQA 2GGCA 4MATA 4Z7MA 5D6FA 2GU4A 3L7GA 1XGSA 1QZYA 1WLRA 2Q93A 3FM3A 4IPAA 1WKMA 5JHUA 4U76A 2Q96A 2DFIA 4FO7A 1YW7A 2HOWA 3FMQA 3MATA 4S00A 5CDEA 4A6WA 2BN7A 4U69A 3IU7A 4ZWOA 2EA4A 1XGOA 1A16A 1KQ9A 4U6EA 4S01A 1YW8A 3IG4A 1C24A 4U6ZA 2IW2A 1KP0A 1M35A 4RZZA 2BH3A 2BWYA 3L24A 4KM3A 1BOAA 4HXXA 2GTXA 2GG8A 3BITA 1XGNA 5CNXA 3CB5A 2GG5A 1JAWA 4IKRA 1C22A 2GG3A 2NQ6A 1C23A 5D6EA 1C21A 4U1BA 1XNZA 2EVOA 4FLKA 4PV4A 4FLLA 2BWXA 2GG9A 4FLJA 2V6CA 2GZ5A 2V3XA 4IF7A 4FLIA 4FUKA 3IU8A 2BWUA 4IKUA 2ZSGA 2OKNA 2Q92A 3MR1A 4ZWPA 3D27A 2P9AA 1O0XA 3PKBA 1MATA 4R60A 2ADUA 2OAZA 1QXZA 1WY2A 2Q94A 4RZYA 5CIKA 5FCHA 1YVMA 2BHBA 3BIPA 4IU6A 1B6AA 4IDYA 1R58A 3TAVA 3TB5A 4S2RP 4FKCA 4U71A 2BWWA 4RGZ1 2Q8KA 4PNCA 1XGMA 2EVCA 1WL6A 1CHMA 3S6BA 3PKAA 5JFRA 4FO8A 2P99A 2V3YA 5CLSA 3RVAA 1PV9A 2EVMA 5E5BA 1C27A 2MATA 5CDLA 2GU7A 2BB7A 2GU5A 2BHCA 2V3ZA 2GG2A 1N51A 1W2MA 2B3LA 4EGEA 4U70A 3MX6A 4U73A 5CE6A 1WBQA 2GG7A
chains in the Genus database with same CATH topology
1R5GA 1YJ3A 4IECA 2BWSA 3RORA 3BIQA 3FMRA 3CTZA 4A6VA 3PKCA 1WL9A 2BHAA 2BHDA 2GU6A 3CB6A 4S2TP 5CDVA 1BN5A 4B28A 3IU9A 3PKEA 4U6JA 4OOKA 2GA2A 1QXYA 1Y1NA 2GG0A 3Q6DA 4ZNGA 4U6WA 1YW9A 2B3HA 2P98A 4U75A 3PKDA 1R5HA 2G6PA 2BWTA 4U6CA 1KQ0A 1QXWA 5FCFA 1WN1A 2EA2A 1B59A 2BWVA 2Q95A 4ZWUA 2GGBA 2B3KA 5JI6A 4QR8A 1W7VA 2NQ7A 4IKSA 4IKTA 4JUQA 2GGCA 4MATA 4Z7MA 5D6FA 2GU4A 3L7GA 1XGSA 1QZYA 1WLRA 2Q93A 3FM3A 4IPAA 1WKMA 5JHUA 4U76A 2Q96A 2DFIA 4FO7A 1YW7A 2HOWA 3FMQA 3MATA 4S00A 5CDEA 4A6WA 2BN7A 4U69A 3IU7A 4ZWOA 2EA4A 1XGOA 1A16A 1KQ9A 4U6EA 4S01A 1YW8A 3IG4A 1C24A 4U6ZA 2IW2A 1KP0A 1M35A 4RZZA 2BH3A 2BWYA 3L24A 4KM3A 1BOAA 4HXXA 2GTXA 2GG8A 3BITA 1XGNA 5CNXA 3CB5A 2GG5A 1JAWA 4IKRA 1C22A 2GG3A 2NQ6A 1C23A 5D6EA 1C21A 4U1BA 1XNZA 2EVOA 4FLKA 4PV4A 4FLLA 2BWXA 2GG9A 4FLJA 2V6CA 2GZ5A 2V3XA 4IF7A 4FLIA 4FUKA 3IU8A 2BWUA 4IKUA 2ZSGA 2OKNA 2Q92A 3MR1A 4ZWPA 3D27A 2P9AA 1O0XA 3PKBA 1MATA 4R60A 2ADUA 2OAZA 1QXZA 1WY2A 2Q94A 4RZYA 5CIKA 5FCHA 1YVMA 2BHBA 3BIPA 4IU6A 1B6AA 4IDYA 1R58A 3TAVA 3TB5A 4S2RP 4FKCA 4U71A 2BWWA 4RGZ1 2Q8KA 4PNCA 1XGMA 2EVCA 1WL6A 1CHMA 3S6BA 3PKAA 5JFRA 4FO8A 2P99A 2V3YA 5CLSA 3RVAA 1PV9A 2EVMA 5E5BA 1C27A 2MATA 5CDLA 2GU7A 2BB7A 2GU5A 2BHCA 2V3ZA 2GG2A 1N51A 1W2MA 2B3LA 4EGEA 4U70A 3MX6A 4U73A 5CE6A 1WBQA 2GG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5G A;  1YJ3 A;  4IEC A;  2BWS A;  3ROR A;  3BIQ A;  3FMR A;  3CTZ A;  4A6V A;  3PKC A;  1WL9 A;  2BHA A;  2BHD A;  2GU6 A;  3CB6 A;  4S2T P;  5CDV A;  1BN5 A;  4B28 A;  3IU9 A;  3PKE A;  4U6J A;  4OOK A;  2GA2 A;  1QXY A;  1Y1N A;  2GG0 A;  3Q6D A;  4ZNG A;  4U6W A;  1YW9 A;  2B3H A;  2P98 A;  4U75 A;  3PKD A;  1R5H A;  2G6P A;  2BWT A;  4U6C A;  1KQ0 A;  1QXW A;  5FCF A;  1WN1 A;  2EA2 A;  1B59 A;  2BWV A;  2Q95 A;  4ZWU A;  2GGB A;  2B3K A;  5JI6 A;  4QR8 A;  1W7V A;  2NQ7 A;  4IKS A;  4IKT A;  4JUQ A;  2GGC A;  4MAT A;  4Z7M A;  5D6F A;  2GU4 A;  3L7G A;  1XGS A;  1QZY A;  1WLR A;  2Q93 A;  3FM3 A;  4IPA A;  1WKM A;  5JHU A;  4U76 A;  2Q96 A;  2DFI A;  4FO7 A;  1YW7 A;  2HOW A;  3FMQ A;  3MAT A;  4S00 A;  5CDE A;  4A6W A;  2BN7 A;  4U69 A;  3IU7 A;  4ZWO A;  2EA4 A;  1XGO A;  1A16 A;  1KQ9 A;  4U6E A;  4S01 A;  1YW8 A;  3IG4 A;  1C24 A;  4U6Z A;  2IW2 A;  1KP0 A;  1M35 A;  4RZZ A;  2BH3 A;  2BWY A;  3L24 A;  4KM3 A;  1BOA A;  4HXX A;  2GTX A;  2GG8 A;  3BIT A;  1XGN A;  5CNX A;  3CB5 A;  2GG5 A;  1JAW A;  4IKR A;  1C22 A;  2GG3 A;  2NQ6 A;  1C23 A;  5D6E A;  1C21 A;  4U1B A;  1XNZ A;  2EVO A;  4FLK A;  4PV4 A;  4FLL A;  2BWX A;  2GG9 A;  4FLJ A;  2V6C A;  2GZ5 A;  2V3X A;  4IF7 A;  4FLI A;  4FUK A;  3IU8 A;  2BWU A;  4IKU A;  2ZSG A;  2OKN A;  2Q92 A;  3MR1 A;  4ZWP A;  3D27 A;  2P9A A;  1O0X A;  3PKB A;  1MAT A;  4R60 A;  2ADU A;  2OAZ A;  1QXZ A;  1WY2 A;  2Q94 A;  4RZY A;  5CIK A;  5FCH A;  1YVM A;  2BHB A;  3BIP A;  4IU6 A;  1B6A A;  4IDY A;  1R58 A;  3TAV A;  3TB5 A;  4S2R P;  4FKC A;  4U71 A;  2BWW A;  4RGZ 1;  2Q8K A;  4PNC A;  1XGM A;  2EVC A;  1WL6 A;  1CHM A;  3S6B A;  3PKA A;  5JFR A;  4FO8 A;  2P99 A;  2V3Y A;  5CLS A;  3RVA A;  1PV9 A;  2EVM A;  5E5B A;  1C27 A;  2MAT A;  5CDL A;  2GU7 A;  2BB7 A;  2GU5 A;  2BHC A;  2V3Z A;  2GG2 A;  1N51 A;  1W2M A;  2B3L A;  4EGE A;  4U70 A;  3MX6 A;  4U73 A;  5CE6 A;  1WBQ A;  2GG7 A; 
#chains in the Genus database with same CATH topology
 1R5G A;  1YJ3 A;  4IEC A;  2BWS A;  3ROR A;  3BIQ A;  3FMR A;  3CTZ A;  4A6V A;  3PKC A;  1WL9 A;  2BHA A;  2BHD A;  2GU6 A;  3CB6 A;  4S2T P;  5CDV A;  1BN5 A;  4B28 A;  3IU9 A;  3PKE A;  4U6J A;  4OOK A;  2GA2 A;  1QXY A;  1Y1N A;  2GG0 A;  3Q6D A;  4ZNG A;  4U6W A;  1YW9 A;  2B3H A;  2P98 A;  4U75 A;  3PKD A;  1R5H A;  2G6P A;  2BWT A;  4U6C A;  1KQ0 A;  1QXW A;  5FCF A;  1WN1 A;  2EA2 A;  1B59 A;  2BWV A;  2Q95 A;  4ZWU A;  2GGB A;  2B3K A;  5JI6 A;  4QR8 A;  1W7V A;  2NQ7 A;  4IKS A;  4IKT A;  4JUQ A;  2GGC A;  4MAT A;  4Z7M A;  5D6F A;  2GU4 A;  3L7G A;  1XGS A;  1QZY A;  1WLR A;  2Q93 A;  3FM3 A;  4IPA A;  1WKM A;  5JHU A;  4U76 A;  2Q96 A;  2DFI A;  4FO7 A;  1YW7 A;  2HOW A;  3FMQ A;  3MAT A;  4S00 A;  5CDE A;  4A6W A;  2BN7 A;  4U69 A;  3IU7 A;  4ZWO A;  2EA4 A;  1XGO A;  1A16 A;  1KQ9 A;  4U6E A;  4S01 A;  1YW8 A;  3IG4 A;  1C24 A;  4U6Z A;  2IW2 A;  1KP0 A;  1M35 A;  4RZZ A;  2BH3 A;  2BWY A;  3L24 A;  4KM3 A;  1BOA A;  4HXX A;  2GTX A;  2GG8 A;  3BIT A;  1XGN A;  5CNX A;  3CB5 A;  2GG5 A;  1JAW A;  4IKR A;  1C22 A;  2GG3 A;  2NQ6 A;  1C23 A;  5D6E A;  1C21 A;  4U1B A;  1XNZ A;  2EVO A;  4FLK A;  4PV4 A;  4FLL A;  2BWX A;  2GG9 A;  4FLJ A;  2V6C A;  2GZ5 A;  2V3X A;  4IF7 A;  4FLI A;  4FUK A;  3IU8 A;  2BWU A;  4IKU A;  2ZSG A;  2OKN A;  2Q92 A;  3MR1 A;  4ZWP A;  3D27 A;  2P9A A;  1O0X A;  3PKB A;  1MAT A;  4R60 A;  2ADU A;  2OAZ A;  1QXZ A;  1WY2 A;  2Q94 A;  4RZY A;  5CIK A;  5FCH A;  1YVM A;  2BHB A;  3BIP A;  4IU6 A;  1B6A A;  4IDY A;  1R58 A;  3TAV A;  3TB5 A;  4S2R P;  4FKC A;  4U71 A;  2BWW A;  4RGZ 1;  2Q8K A;  4PNC A;  1XGM A;  2EVC A;  1WL6 A;  1CHM A;  3S6B A;  3PKA A;  5JFR A;  4FO8 A;  2P99 A;  2V3Y A;  5CLS A;  3RVA A;  1PV9 A;  2EVM A;  5E5B A;  1C27 A;  2MAT A;  5CDL A;  2GU7 A;  2BB7 A;  2GU5 A;  2BHC A;  2V3Z A;  2GG2 A;  1N51 A;  1W2M A;  2B3L A;  4EGE A;  4U70 A;  3MX6 A;  4U73 A;  5CE6 A;  1WBQ A;  2GG7 A; 
#chains in the Genus database with same CATH homology
 1R5G A;  1YJ3 A;  4IEC A;  2BWS A;  3ROR A;  3BIQ A;  3FMR A;  3CTZ A;  4A6V A;  3PKC A;  1WL9 A;  2BHA A;  2BHD A;  2GU6 A;  3CB6 A;  4S2T P;  5CDV A;  1BN5 A;  4B28 A;  3IU9 A;  3PKE A;  4U6J A;  4OOK A;  2GA2 A;  1QXY A;  1Y1N A;  2GG0 A;  3Q6D A;  4ZNG A;  4U6W A;  1YW9 A;  2B3H A;  2P98 A;  4U75 A;  3PKD A;  1R5H A;  2G6P A;  2BWT A;  4U6C A;  1KQ0 A;  1QXW A;  5FCF A;  1WN1 A;  2EA2 A;  1B59 A;  2BWV A;  2Q95 A;  4ZWU A;  2GGB A;  2B3K A;  5JI6 A;  4QR8 A;  1W7V A;  2NQ7 A;  4IKS A;  4IKT A;  4JUQ A;  2GGC A;  4MAT A;  4Z7M A;  5D6F A;  2GU4 A;  3L7G A;  1XGS A;  1QZY A;  1WLR A;  2Q93 A;  3FM3 A;  4IPA A;  1WKM A;  5JHU A;  4U76 A;  2Q96 A;  2DFI A;  4FO7 A;  1YW7 A;  2HOW A;  3FMQ A;  3MAT A;  4S00 A;  5CDE A;  4A6W A;  2BN7 A;  4U69 A;  3IU7 A;  4ZWO A;  2EA4 A;  1XGO A;  1A16 A;  1KQ9 A;  4U6E A;  4S01 A;  1YW8 A;  3IG4 A;  1C24 A;  4U6Z A;  2IW2 A;  1KP0 A;  1M35 A;  4RZZ A;  2BH3 A;  2BWY A;  3L24 A;  4KM3 A;  1BOA A;  4HXX A;  2GTX A;  2GG8 A;  3BIT A;  1XGN A;  5CNX A;  3CB5 A;  2GG5 A;  1JAW A;  4IKR A;  1C22 A;  2GG3 A;  2NQ6 A;  1C23 A;  5D6E A;  1C21 A;  4U1B A;  1XNZ A;  2EVO A;  4FLK A;  4PV4 A;  4FLL A;  2BWX A;  2GG9 A;  4FLJ A;  2V6C A;  2GZ5 A;  2V3X A;  4IF7 A;  4FLI A;  4FUK A;  3IU8 A;  2BWU A;  4IKU A;  2ZSG A;  2OKN A;  2Q92 A;  3MR1 A;  4ZWP A;  3D27 A;  2P9A A;  1O0X A;  3PKB A;  1MAT A;  4R60 A;  2ADU A;  2OAZ A;  1QXZ A;  1WY2 A;  2Q94 A;  4RZY A;  5CIK A;  5FCH A;  1YVM A;  2BHB A;  3BIP A;  4IU6 A;  1B6A A;  4IDY A;  1R58 A;  3TAV A;  3TB5 A;  4S2R P;  4FKC A;  4U71 A;  2BWW A;  4RGZ 1;  2Q8K A;  4PNC A;  1XGM A;  2EVC A;  1WL6 A;  1CHM A;  3S6B A;  3PKA A;  5JFR A;  4FO8 A;  2P99 A;  2V3Y A;  5CLS A;  3RVA A;  1PV9 A;  2EVM A;  5E5B A;  1C27 A;  2MAT A;  5CDL A;  2GU7 A;  2BB7 A;  2GU5 A;  2BHC A;  2V3Z A;  2GG2 A;  1N51 A;  1W2M A;  2B3L A;  4EGE A;  4U70 A;  3MX6 A;  4U73 A;  5CE6 A;  1WBQ A;  2GG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...