4FO7A

Pseudomonas aeruginosa metap, in mn form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo7A00
2EVMA 3TB5A 4IKSA 1PV9A 3RORA 4IKUA 1C21A 2GG5A 1XGNA 2V3XA 1QXZA 3D27A 4FLIA 2GZ5A 1C27A 3IU7A 4U6WA 2BHCA 4U76A 1R58A 2BN7A 3MATA 4RGZ1 2V6CA 4U6ZA 5CLSA 2V3ZA 1KP0A 1YW7A 1XGOA 5CNXA 4ZNGA 1W2MA 1XNZA 3FM3A 2EA2A 2NQ6A 2GG0A 1N51A 2ZSGA 4IF7A 4IKTA 3IU9A 4IKRA 4EGEA 3CTZA 5JFRA 3MR1A 2OAZA 2P9AA 1CHMA 2BWXA 3S6BA 2EA4A 2Q94A 4FKCA 2EVOA 4OOKA 2Q95A 5FCHA 1WL9A 4A6WA 4QR8A 4U6EA 2BWVA 4U69A 3Q6DA 5CDLA 1XGMA 4S00A 1A16A 1R5GA 1KQ9A 4S2TP 2Q8KA 3CB5A 1BOAA 3FMQA 4IECA 1MATA 1WN1A 5D6FA 2B3HA 2B3KA 1WY2A 1YJ3A 4ZWPA 5CIKA 2BWYA 1QXYA 1WLRA 2NQ7A 3MX6A 5E5BA 2BWUA 4U6CA 3PKCA 3BITA 4KM3A 4PNCA 5JI6A 2V3YA 5D6EA 2GG9A 1Y1NA 1YW8A 2GA2A 4FUKA 4S01A 3TAVA 4HXXA 2HOWA 2EVCA 4A6VA 4B28A 2GG8A 1KQ0A 2Q93A 3BIQA 4S2RP 4ZWUA 4U73A 3FMRA 3PKBA 2BWSA 4FO8A 3PKDA 4IPAA 3IG4A 4MATA 2BHBA 4IU6A 1WL6A 2GG2A 4RZYA 3PKAA 4Z7MA 2BWTA 1WKMA 2IW2A 2GG7A 3RVAA 4JUQA 4U70A 1BN5A 3IU8A 1C22A 3L24A 1B59A 4U6JA 1M35A 1C23A 1W7VA 2G6PA 1B6AA 2BB7A 3PKEA 4R60A 5CDEA 2ADUA 2MATA 1XGSA 2BWWA 2GU7A 3CB6A 2Q92A 1O0XA 2BHAA 2DFIA 1QXWA 2OKNA 4ZWOA 2GU6A 1JAWA 1QZYA 1YW9A 2GG3A 5JHUA 2GTXA 2P98A 1C24A 4FLLA 2B3LA 5FCFA 4PV4A 5CE6A 2GU4A 2BH3A 3BIPA 5CDVA 4FLJA 2GGBA 2P99A 4U71A 1YVMA 4FO7A 4U1BA 1R5HA 1WBQA 4IDYA 4RZZA 2Q96A 2GGCA 3L7GA 4FLKA 4U75A 2BHDA 2GU5A
chains in the Genus database with same CATH superfamily
2EVMA 3TB5A 4IKSA 1PV9A 3RORA 4IKUA 1C21A 2GG5A 1XGNA 2V3XA 1QXZA 3D27A 4FLIA 2GZ5A 1C27A 3IU7A 4U6WA 2BHCA 4U76A 1R58A 2BN7A 3MATA 4RGZ1 2V6CA 4U6ZA 5CLSA 2V3ZA 1KP0A 1YW7A 1XGOA 5CNXA 4ZNGA 1W2MA 1XNZA 3FM3A 2EA2A 2NQ6A 2GG0A 1N51A 2ZSGA 4IF7A 4IKTA 3IU9A 4IKRA 4EGEA 3CTZA 5JFRA 3MR1A 2OAZA 2P9AA 1CHMA 2BWXA 3S6BA 2EA4A 2Q94A 4FKCA 2EVOA 4OOKA 2Q95A 5FCHA 1WL9A 4A6WA 4QR8A 4U6EA 2BWVA 4U69A 3Q6DA 5CDLA 1XGMA 4S00A 1A16A 1R5GA 1KQ9A 4S2TP 2Q8KA 3CB5A 1BOAA 3FMQA 4IECA 1MATA 1WN1A 5D6FA 2B3HA 2B3KA 1WY2A 1YJ3A 4ZWPA 5CIKA 2BWYA 1QXYA 1WLRA 2NQ7A 3MX6A 5E5BA 2BWUA 4U6CA 3PKCA 3BITA 4KM3A 4PNCA 5JI6A 2V3YA 5D6EA 2GG9A 1Y1NA 1YW8A 2GA2A 4FUKA 4S01A 3TAVA 4HXXA 2HOWA 2EVCA 4A6VA 4B28A 2GG8A 1KQ0A 2Q93A 3BIQA 4S2RP 4ZWUA 4U73A 3FMRA 3PKBA 2BWSA 4FO8A 3PKDA 4IPAA 3IG4A 4MATA 2BHBA 4IU6A 1WL6A 2GG2A 4RZYA 3PKAA 4Z7MA 2BWTA 1WKMA 2IW2A 2GG7A 3RVAA 4JUQA 4U70A 1BN5A 3IU8A 1C22A 3L24A 1B59A 4U6JA 1M35A 1C23A 1W7VA 2G6PA 1B6AA 2BB7A 3PKEA 4R60A 5CDEA 2ADUA 2MATA 1XGSA 2BWWA 2GU7A 3CB6A 2Q92A 1O0XA 2BHAA 2DFIA 1QXWA 2OKNA 4ZWOA 2GU6A 1JAWA 1QZYA 1YW9A 2GG3A 5JHUA 2GTXA 2P98A 1C24A 4FLLA 2B3LA 5FCFA 4PV4A 5CE6A 2GU4A 2BH3A 3BIPA 5CDVA 4FLJA 2GGBA 2P99A 4U71A 1YVMA 4FO7A 4U1BA 1R5HA 1WBQA 4IDYA 4RZZA 2Q96A 2GGCA 3L7GA 4FLKA 4U75A 2BHDA 2GU5A
chains in the Genus database with same CATH topology
2EVMA 3TB5A 4IKSA 1PV9A 3RORA 4IKUA 1C21A 2GG5A 1XGNA 2V3XA 1QXZA 3D27A 4FLIA 2GZ5A 1C27A 3IU7A 4U6WA 2BHCA 4U76A 1R58A 2BN7A 3MATA 4RGZ1 2V6CA 4U6ZA 5CLSA 2V3ZA 1KP0A 1YW7A 1XGOA 5CNXA 4ZNGA 1W2MA 1XNZA 3FM3A 2EA2A 2NQ6A 2GG0A 1N51A 2ZSGA 4IF7A 4IKTA 3IU9A 4IKRA 4EGEA 3CTZA 5JFRA 3MR1A 2OAZA 2P9AA 1CHMA 2BWXA 3S6BA 2EA4A 2Q94A 4FKCA 2EVOA 4OOKA 2Q95A 5FCHA 1WL9A 4A6WA 4QR8A 4U6EA 2BWVA 4U69A 3Q6DA 5CDLA 1XGMA 4S00A 1A16A 1R5GA 1KQ9A 4S2TP 2Q8KA 3CB5A 1BOAA 3FMQA 4IECA 1MATA 1WN1A 5D6FA 2B3HA 2B3KA 1WY2A 1YJ3A 4ZWPA 5CIKA 2BWYA 1QXYA 1WLRA 2NQ7A 3MX6A 5E5BA 2BWUA 4U6CA 3PKCA 3BITA 4KM3A 4PNCA 5JI6A 2V3YA 5D6EA 2GG9A 1Y1NA 1YW8A 2GA2A 4FUKA 4S01A 3TAVA 4HXXA 2HOWA 2EVCA 4A6VA 4B28A 2GG8A 1KQ0A 2Q93A 3BIQA 4S2RP 4ZWUA 4U73A 3FMRA 3PKBA 2BWSA 4FO8A 3PKDA 4IPAA 3IG4A 4MATA 2BHBA 4IU6A 1WL6A 2GG2A 4RZYA 3PKAA 4Z7MA 2BWTA 1WKMA 2IW2A 2GG7A 3RVAA 4JUQA 4U70A 1BN5A 3IU8A 1C22A 3L24A 1B59A 4U6JA 1M35A 1C23A 1W7VA 2G6PA 1B6AA 2BB7A 3PKEA 4R60A 5CDEA 2ADUA 2MATA 1XGSA 2BWWA 2GU7A 3CB6A 2Q92A 1O0XA 2BHAA 2DFIA 1QXWA 2OKNA 4ZWOA 2GU6A 1JAWA 1QZYA 1YW9A 2GG3A 5JHUA 2GTXA 2P98A 1C24A 4FLLA 2B3LA 5FCFA 4PV4A 5CE6A 2GU4A 2BH3A 3BIPA 5CDVA 4FLJA 2GGBA 2P99A 4U71A 1YVMA 4FO7A 4U1BA 1R5HA 1WBQA 4IDYA 4RZZA 2Q96A 2GGCA 3L7GA 4FLKA 4U75A 2BHDA 2GU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVM A;  3TB5 A;  4IKS A;  1PV9 A;  3ROR A;  4IKU A;  1C21 A;  2GG5 A;  1XGN A;  2V3X A;  1QXZ A;  3D27 A;  4FLI A;  2GZ5 A;  1C27 A;  3IU7 A;  4U6W A;  2BHC A;  4U76 A;  1R58 A;  2BN7 A;  3MAT A;  4RGZ 1;  2V6C A;  4U6Z A;  5CLS A;  2V3Z A;  1KP0 A;  1YW7 A;  1XGO A;  5CNX A;  4ZNG A;  1W2M A;  1XNZ A;  3FM3 A;  2EA2 A;  2NQ6 A;  2GG0 A;  1N51 A;  2ZSG A;  4IF7 A;  4IKT A;  3IU9 A;  4IKR A;  4EGE A;  3CTZ A;  5JFR A;  3MR1 A;  2OAZ A;  2P9A A;  1CHM A;  2BWX A;  3S6B A;  2EA4 A;  2Q94 A;  4FKC A;  2EVO A;  4OOK A;  2Q95 A;  5FCH A;  1WL9 A;  4A6W A;  4QR8 A;  4U6E A;  2BWV A;  4U69 A;  3Q6D A;  5CDL A;  1XGM A;  4S00 A;  1A16 A;  1R5G A;  1KQ9 A;  4S2T P;  2Q8K A;  3CB5 A;  1BOA A;  3FMQ A;  4IEC A;  1MAT A;  1WN1 A;  5D6F A;  2B3H A;  2B3K A;  1WY2 A;  1YJ3 A;  4ZWP A;  5CIK A;  2BWY A;  1QXY A;  1WLR A;  2NQ7 A;  3MX6 A;  5E5B A;  2BWU A;  4U6C A;  3PKC A;  3BIT A;  4KM3 A;  4PNC A;  5JI6 A;  2V3Y A;  5D6E A;  2GG9 A;  1Y1N A;  1YW8 A;  2GA2 A;  4FUK A;  4S01 A;  3TAV A;  4HXX A;  2HOW A;  2EVC A;  4A6V A;  4B28 A;  2GG8 A;  1KQ0 A;  2Q93 A;  3BIQ A;  4S2R P;  4ZWU A;  4U73 A;  3FMR A;  3PKB A;  2BWS A;  4FO8 A;  3PKD A;  4IPA A;  3IG4 A;  4MAT A;  2BHB A;  4IU6 A;  1WL6 A;  2GG2 A;  4RZY A;  3PKA A;  4Z7M A;  2BWT A;  1WKM A;  2IW2 A;  2GG7 A;  3RVA A;  4JUQ A;  4U70 A;  1BN5 A;  3IU8 A;  1C22 A;  3L24 A;  1B59 A;  4U6J A;  1M35 A;  1C23 A;  1W7V A;  2G6P A;  1B6A A;  2BB7 A;  3PKE A;  4R60 A;  5CDE A;  2ADU A;  2MAT A;  1XGS A;  2BWW A;  2GU7 A;  3CB6 A;  2Q92 A;  1O0X A;  2BHA A;  2DFI A;  1QXW A;  2OKN A;  4ZWO A;  2GU6 A;  1JAW A;  1QZY A;  1YW9 A;  2GG3 A;  5JHU A;  2GTX A;  2P98 A;  1C24 A;  4FLL A;  2B3L A;  5FCF A;  4PV4 A;  5CE6 A;  2GU4 A;  2BH3 A;  3BIP A;  5CDV A;  4FLJ A;  2GGB A;  2P99 A;  4U71 A;  1YVM A;  4FO7 A;  4U1B A;  1R5H A;  1WBQ A;  4IDY A;  4RZZ A;  2Q96 A;  2GGC A;  3L7G A;  4FLK A;  4U75 A;  2BHD A;  2GU5 A; 
#chains in the Genus database with same CATH topology
 2EVM A;  3TB5 A;  4IKS A;  1PV9 A;  3ROR A;  4IKU A;  1C21 A;  2GG5 A;  1XGN A;  2V3X A;  1QXZ A;  3D27 A;  4FLI A;  2GZ5 A;  1C27 A;  3IU7 A;  4U6W A;  2BHC A;  4U76 A;  1R58 A;  2BN7 A;  3MAT A;  4RGZ 1;  2V6C A;  4U6Z A;  5CLS A;  2V3Z A;  1KP0 A;  1YW7 A;  1XGO A;  5CNX A;  4ZNG A;  1W2M A;  1XNZ A;  3FM3 A;  2EA2 A;  2NQ6 A;  2GG0 A;  1N51 A;  2ZSG A;  4IF7 A;  4IKT A;  3IU9 A;  4IKR A;  4EGE A;  3CTZ A;  5JFR A;  3MR1 A;  2OAZ A;  2P9A A;  1CHM A;  2BWX A;  3S6B A;  2EA4 A;  2Q94 A;  4FKC A;  2EVO A;  4OOK A;  2Q95 A;  5FCH A;  1WL9 A;  4A6W A;  4QR8 A;  4U6E A;  2BWV A;  4U69 A;  3Q6D A;  5CDL A;  1XGM A;  4S00 A;  1A16 A;  1R5G A;  1KQ9 A;  4S2T P;  2Q8K A;  3CB5 A;  1BOA A;  3FMQ A;  4IEC A;  1MAT A;  1WN1 A;  5D6F A;  2B3H A;  2B3K A;  1WY2 A;  1YJ3 A;  4ZWP A;  5CIK A;  2BWY A;  1QXY A;  1WLR A;  2NQ7 A;  3MX6 A;  5E5B A;  2BWU A;  4U6C A;  3PKC A;  3BIT A;  4KM3 A;  4PNC A;  5JI6 A;  2V3Y A;  5D6E A;  2GG9 A;  1Y1N A;  1YW8 A;  2GA2 A;  4FUK A;  4S01 A;  3TAV A;  4HXX A;  2HOW A;  2EVC A;  4A6V A;  4B28 A;  2GG8 A;  1KQ0 A;  2Q93 A;  3BIQ A;  4S2R P;  4ZWU A;  4U73 A;  3FMR A;  3PKB A;  2BWS A;  4FO8 A;  3PKD A;  4IPA A;  3IG4 A;  4MAT A;  2BHB A;  4IU6 A;  1WL6 A;  2GG2 A;  4RZY A;  3PKA A;  4Z7M A;  2BWT A;  1WKM A;  2IW2 A;  2GG7 A;  3RVA A;  4JUQ A;  4U70 A;  1BN5 A;  3IU8 A;  1C22 A;  3L24 A;  1B59 A;  4U6J A;  1M35 A;  1C23 A;  1W7V A;  2G6P A;  1B6A A;  2BB7 A;  3PKE A;  4R60 A;  5CDE A;  2ADU A;  2MAT A;  1XGS A;  2BWW A;  2GU7 A;  3CB6 A;  2Q92 A;  1O0X A;  2BHA A;  2DFI A;  1QXW A;  2OKN A;  4ZWO A;  2GU6 A;  1JAW A;  1QZY A;  1YW9 A;  2GG3 A;  5JHU A;  2GTX A;  2P98 A;  1C24 A;  4FLL A;  2B3L A;  5FCF A;  4PV4 A;  5CE6 A;  2GU4 A;  2BH3 A;  3BIP A;  5CDV A;  4FLJ A;  2GGB A;  2P99 A;  4U71 A;  1YVM A;  4FO7 A;  4U1B A;  1R5H A;  1WBQ A;  4IDY A;  4RZZ A;  2Q96 A;  2GGC A;  3L7G A;  4FLK A;  4U75 A;  2BHD A;  2GU5 A; 
#chains in the Genus database with same CATH homology
 2EVM A;  3TB5 A;  4IKS A;  1PV9 A;  3ROR A;  4IKU A;  1C21 A;  2GG5 A;  1XGN A;  2V3X A;  1QXZ A;  3D27 A;  4FLI A;  2GZ5 A;  1C27 A;  3IU7 A;  4U6W A;  2BHC A;  4U76 A;  1R58 A;  2BN7 A;  3MAT A;  4RGZ 1;  2V6C A;  4U6Z A;  5CLS A;  2V3Z A;  1KP0 A;  1YW7 A;  1XGO A;  5CNX A;  4ZNG A;  1W2M A;  1XNZ A;  3FM3 A;  2EA2 A;  2NQ6 A;  2GG0 A;  1N51 A;  2ZSG A;  4IF7 A;  4IKT A;  3IU9 A;  4IKR A;  4EGE A;  3CTZ A;  5JFR A;  3MR1 A;  2OAZ A;  2P9A A;  1CHM A;  2BWX A;  3S6B A;  2EA4 A;  2Q94 A;  4FKC A;  2EVO A;  4OOK A;  2Q95 A;  5FCH A;  1WL9 A;  4A6W A;  4QR8 A;  4U6E A;  2BWV A;  4U69 A;  3Q6D A;  5CDL A;  1XGM A;  4S00 A;  1A16 A;  1R5G A;  1KQ9 A;  4S2T P;  2Q8K A;  3CB5 A;  1BOA A;  3FMQ A;  4IEC A;  1MAT A;  1WN1 A;  5D6F A;  2B3H A;  2B3K A;  1WY2 A;  1YJ3 A;  4ZWP A;  5CIK A;  2BWY A;  1QXY A;  1WLR A;  2NQ7 A;  3MX6 A;  5E5B A;  2BWU A;  4U6C A;  3PKC A;  3BIT A;  4KM3 A;  4PNC A;  5JI6 A;  2V3Y A;  5D6E A;  2GG9 A;  1Y1N A;  1YW8 A;  2GA2 A;  4FUK A;  4S01 A;  3TAV A;  4HXX A;  2HOW A;  2EVC A;  4A6V A;  4B28 A;  2GG8 A;  1KQ0 A;  2Q93 A;  3BIQ A;  4S2R P;  4ZWU A;  4U73 A;  3FMR A;  3PKB A;  2BWS A;  4FO8 A;  3PKD A;  4IPA A;  3IG4 A;  4MAT A;  2BHB A;  4IU6 A;  1WL6 A;  2GG2 A;  4RZY A;  3PKA A;  4Z7M A;  2BWT A;  1WKM A;  2IW2 A;  2GG7 A;  3RVA A;  4JUQ A;  4U70 A;  1BN5 A;  3IU8 A;  1C22 A;  3L24 A;  1B59 A;  4U6J A;  1M35 A;  1C23 A;  1W7V A;  2G6P A;  1B6A A;  2BB7 A;  3PKE A;  4R60 A;  5CDE A;  2ADU A;  2MAT A;  1XGS A;  2BWW A;  2GU7 A;  3CB6 A;  2Q92 A;  1O0X A;  2BHA A;  2DFI A;  1QXW A;  2OKN A;  4ZWO A;  2GU6 A;  1JAW A;  1QZY A;  1YW9 A;  2GG3 A;  5JHU A;  2GTX A;  2P98 A;  1C24 A;  4FLL A;  2B3L A;  5FCF A;  4PV4 A;  5CE6 A;  2GU4 A;  2BH3 A;  3BIP A;  5CDV A;  4FLJ A;  2GGB A;  2P99 A;  4U71 A;  1YVM A;  4FO7 A;  4U1B A;  1R5H A;  1WBQ A;  4IDY A;  4RZZ A;  2Q96 A;  2GGC A;  3L7G A;  4FLK A;  4U75 A;  2BHD A;  2GU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...