4FO7A

Pseudomonas aeruginosa metap, in mn form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo7A00
5CE6A 4FO7A 4FLKA 4U71A 4IU6A 1XNZA 1YJ3A 2GG3A 3MATA 4HXXA 4RGZ1 4S2TP 2EVOA 1R5HA 3IU9A 3PKBA 2GU5A 2Q94A 2Q96A 2HOWA 4IKSA 3CTZA 3IU8A 5CDVA 1QXYA 2BN7A 4FLJA 1Y1NA 4U1BA 3PKAA 2GG0A 4IKUA 4U6CA 1R58A 4U76A 2MATA 4FO8A 2BWSA 1WL9A 4ZWUA 2V3ZA 1CHMA 4IF7A 2P9AA 1QXWA 2EVCA 1XGNA 3IG4A 3IU7A 1YW7A 4U6JA 4FLLA 2V3XA 4U70A 1YW9A 5CDLA 2BH3A 4U73A 2GG7A 2B3LA 5CDEA 1B59A 3S6BA 4RZZA 2Q93A 2Q92A 4A6WA 1WBQA 2ZSGA 2IW2A 3PKEA 2ADUA 1PV9A 3PKCA 1C21A 3RORA 4QR8A 3FMRA 1O0XA 2GG5A 1W7VA 4FKCA 3MX6A 3RVAA 2EA2A 2GG2A 4U75A 2BWTA 1WL6A 5D6FA 1C23A 4U69A 1C27A 4KM3A 2GGBA 1MATA 2NQ7A 4OOKA 4ZWPA 1C24A 5CNXA 1BOAA 4ZWOA 2B3KA 1A16A 2OKNA 4IKRA 2BWYA 3Q6DA 1JAWA 4FUKA 1WY2A 4B28A 1YW8A 5FCHA 3PKDA 4S2RP 3CB5A 1R5GA 1WKMA 4JUQA 5E5BA 4EGEA 1QZYA 5FCFA 3FM3A 5JI6A 1XGOA 2GG9A 3BIPA 1YVMA 2BWUA 5CLSA 3TAVA 2GU7A 1BN5A 2EA4A 4R60A 2DFIA 3TB5A 2GU6A 4U6ZA 4U6WA 4IECA 2Q95A 2EVMA 4S00A 2GA2A 4A6VA 1M35A 4FLIA 2B3HA 4PV4A 1B6AA 4IKTA 2GTXA 4RZYA 2OAZA 1XGSA 4MATA 4PNCA 3CB6A 2BB7A 1N51A 2BWVA 2BWWA 2G6PA 2GZ5A 2BHAA 4ZNGA 1WLRA 4IDYA 1W2MA 2BHBA 5JHUA 5JFRA 3L7GA 1C22A 2BHCA 2GGCA 2BWXA 3D27A 2Q8KA 4S01A 2V6CA 2BHDA 4IPAA 3BITA 3BIQA 2GG8A 1WN1A 5CIKA 1QXZA 3FMQA 1KP0A 1XGMA 2P99A 2GU4A 1KQ0A 2NQ6A 5D6EA 1KQ9A 3MR1A 2V3YA 4Z7MA 4U6EA 3L24A 2P98A
chains in the Genus database with same CATH superfamily
5CE6A 4FO7A 4FLKA 4U71A 4IU6A 1XNZA 1YJ3A 2GG3A 3MATA 4HXXA 4RGZ1 4S2TP 2EVOA 1R5HA 3IU9A 3PKBA 2GU5A 2Q94A 2Q96A 2HOWA 4IKSA 3CTZA 3IU8A 5CDVA 1QXYA 2BN7A 4FLJA 1Y1NA 4U1BA 3PKAA 2GG0A 4IKUA 4U6CA 1R58A 4U76A 2MATA 4FO8A 2BWSA 1WL9A 4ZWUA 2V3ZA 1CHMA 4IF7A 2P9AA 1QXWA 2EVCA 1XGNA 3IG4A 3IU7A 1YW7A 4U6JA 4FLLA 2V3XA 4U70A 1YW9A 5CDLA 2BH3A 4U73A 2GG7A 2B3LA 5CDEA 1B59A 3S6BA 4RZZA 2Q93A 2Q92A 4A6WA 1WBQA 2ZSGA 2IW2A 3PKEA 2ADUA 1PV9A 3PKCA 1C21A 3RORA 4QR8A 3FMRA 1O0XA 2GG5A 1W7VA 4FKCA 3MX6A 3RVAA 2EA2A 2GG2A 4U75A 2BWTA 1WL6A 5D6FA 1C23A 4U69A 1C27A 4KM3A 2GGBA 1MATA 2NQ7A 4OOKA 4ZWPA 1C24A 5CNXA 1BOAA 4ZWOA 2B3KA 1A16A 2OKNA 4IKRA 2BWYA 3Q6DA 1JAWA 4FUKA 1WY2A 4B28A 1YW8A 5FCHA 3PKDA 4S2RP 3CB5A 1R5GA 1WKMA 4JUQA 5E5BA 4EGEA 1QZYA 5FCFA 3FM3A 5JI6A 1XGOA 2GG9A 3BIPA 1YVMA 2BWUA 5CLSA 3TAVA 2GU7A 1BN5A 2EA4A 4R60A 2DFIA 3TB5A 2GU6A 4U6ZA 4U6WA 4IECA 2Q95A 2EVMA 4S00A 2GA2A 4A6VA 1M35A 4FLIA 2B3HA 4PV4A 1B6AA 4IKTA 2GTXA 4RZYA 2OAZA 1XGSA 4MATA 4PNCA 3CB6A 2BB7A 1N51A 2BWVA 2BWWA 2G6PA 2GZ5A 2BHAA 4ZNGA 1WLRA 4IDYA 1W2MA 2BHBA 5JHUA 5JFRA 3L7GA 1C22A 2BHCA 2GGCA 2BWXA 3D27A 2Q8KA 4S01A 2V6CA 2BHDA 4IPAA 3BITA 3BIQA 2GG8A 1WN1A 5CIKA 1QXZA 3FMQA 1KP0A 1XGMA 2P99A 2GU4A 1KQ0A 2NQ6A 5D6EA 1KQ9A 3MR1A 2V3YA 4Z7MA 4U6EA 3L24A 2P98A
chains in the Genus database with same CATH topology
5CE6A 4FO7A 4FLKA 4U71A 4IU6A 1XNZA 1YJ3A 2GG3A 3MATA 4HXXA 4RGZ1 4S2TP 2EVOA 1R5HA 3IU9A 3PKBA 2GU5A 2Q94A 2Q96A 2HOWA 4IKSA 3CTZA 3IU8A 5CDVA 1QXYA 2BN7A 4FLJA 1Y1NA 4U1BA 3PKAA 2GG0A 4IKUA 4U6CA 1R58A 4U76A 2MATA 4FO8A 2BWSA 1WL9A 4ZWUA 2V3ZA 1CHMA 4IF7A 2P9AA 1QXWA 2EVCA 1XGNA 3IG4A 3IU7A 1YW7A 4U6JA 4FLLA 2V3XA 4U70A 1YW9A 5CDLA 2BH3A 4U73A 2GG7A 2B3LA 5CDEA 1B59A 3S6BA 4RZZA 2Q93A 2Q92A 4A6WA 1WBQA 2ZSGA 2IW2A 3PKEA 2ADUA 1PV9A 3PKCA 1C21A 3RORA 4QR8A 3FMRA 1O0XA 2GG5A 1W7VA 4FKCA 3MX6A 3RVAA 2EA2A 2GG2A 4U75A 2BWTA 1WL6A 5D6FA 1C23A 4U69A 1C27A 4KM3A 2GGBA 1MATA 2NQ7A 4OOKA 4ZWPA 1C24A 5CNXA 1BOAA 4ZWOA 2B3KA 1A16A 2OKNA 4IKRA 2BWYA 3Q6DA 1JAWA 4FUKA 1WY2A 4B28A 1YW8A 5FCHA 3PKDA 4S2RP 3CB5A 1R5GA 1WKMA 4JUQA 5E5BA 4EGEA 1QZYA 5FCFA 3FM3A 5JI6A 1XGOA 2GG9A 3BIPA 1YVMA 2BWUA 5CLSA 3TAVA 2GU7A 1BN5A 2EA4A 4R60A 2DFIA 3TB5A 2GU6A 4U6ZA 4U6WA 4IECA 2Q95A 2EVMA 4S00A 2GA2A 4A6VA 1M35A 4FLIA 2B3HA 4PV4A 1B6AA 4IKTA 2GTXA 4RZYA 2OAZA 1XGSA 4MATA 4PNCA 3CB6A 2BB7A 1N51A 2BWVA 2BWWA 2G6PA 2GZ5A 2BHAA 4ZNGA 1WLRA 4IDYA 1W2MA 2BHBA 5JHUA 5JFRA 3L7GA 1C22A 2BHCA 2GGCA 2BWXA 3D27A 2Q8KA 4S01A 2V6CA 2BHDA 4IPAA 3BITA 3BIQA 2GG8A 1WN1A 5CIKA 1QXZA 3FMQA 1KP0A 1XGMA 2P99A 2GU4A 1KQ0A 2NQ6A 5D6EA 1KQ9A 3MR1A 2V3YA 4Z7MA 4U6EA 3L24A 2P98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CE6 A;  4FO7 A;  4FLK A;  4U71 A;  4IU6 A;  1XNZ A;  1YJ3 A;  2GG3 A;  3MAT A;  4HXX A;  4RGZ 1;  4S2T P;  2EVO A;  1R5H A;  3IU9 A;  3PKB A;  2GU5 A;  2Q94 A;  2Q96 A;  2HOW A;  4IKS A;  3CTZ A;  3IU8 A;  5CDV A;  1QXY A;  2BN7 A;  4FLJ A;  1Y1N A;  4U1B A;  3PKA A;  2GG0 A;  4IKU A;  4U6C A;  1R58 A;  4U76 A;  2MAT A;  4FO8 A;  2BWS A;  1WL9 A;  4ZWU A;  2V3Z A;  1CHM A;  4IF7 A;  2P9A A;  1QXW A;  2EVC A;  1XGN A;  3IG4 A;  3IU7 A;  1YW7 A;  4U6J A;  4FLL A;  2V3X A;  4U70 A;  1YW9 A;  5CDL A;  2BH3 A;  4U73 A;  2GG7 A;  2B3L A;  5CDE A;  1B59 A;  3S6B A;  4RZZ A;  2Q93 A;  2Q92 A;  4A6W A;  1WBQ A;  2ZSG A;  2IW2 A;  3PKE A;  2ADU A;  1PV9 A;  3PKC A;  1C21 A;  3ROR A;  4QR8 A;  3FMR A;  1O0X A;  2GG5 A;  1W7V A;  4FKC A;  3MX6 A;  3RVA A;  2EA2 A;  2GG2 A;  4U75 A;  2BWT A;  1WL6 A;  5D6F A;  1C23 A;  4U69 A;  1C27 A;  4KM3 A;  2GGB A;  1MAT A;  2NQ7 A;  4OOK A;  4ZWP A;  1C24 A;  5CNX A;  1BOA A;  4ZWO A;  2B3K A;  1A16 A;  2OKN A;  4IKR A;  2BWY A;  3Q6D A;  1JAW A;  4FUK A;  1WY2 A;  4B28 A;  1YW8 A;  5FCH A;  3PKD A;  4S2R P;  3CB5 A;  1R5G A;  1WKM A;  4JUQ A;  5E5B A;  4EGE A;  1QZY A;  5FCF A;  3FM3 A;  5JI6 A;  1XGO A;  2GG9 A;  3BIP A;  1YVM A;  2BWU A;  5CLS A;  3TAV A;  2GU7 A;  1BN5 A;  2EA4 A;  4R60 A;  2DFI A;  3TB5 A;  2GU6 A;  4U6Z A;  4U6W A;  4IEC A;  2Q95 A;  2EVM A;  4S00 A;  2GA2 A;  4A6V A;  1M35 A;  4FLI A;  2B3H A;  4PV4 A;  1B6A A;  4IKT A;  2GTX A;  4RZY A;  2OAZ A;  1XGS A;  4MAT A;  4PNC A;  3CB6 A;  2BB7 A;  1N51 A;  2BWV A;  2BWW A;  2G6P A;  2GZ5 A;  2BHA A;  4ZNG A;  1WLR A;  4IDY A;  1W2M A;  2BHB A;  5JHU A;  5JFR A;  3L7G A;  1C22 A;  2BHC A;  2GGC A;  2BWX A;  3D27 A;  2Q8K A;  4S01 A;  2V6C A;  2BHD A;  4IPA A;  3BIT A;  3BIQ A;  2GG8 A;  1WN1 A;  5CIK A;  1QXZ A;  3FMQ A;  1KP0 A;  1XGM A;  2P99 A;  2GU4 A;  1KQ0 A;  2NQ6 A;  5D6E A;  1KQ9 A;  3MR1 A;  2V3Y A;  4Z7M A;  4U6E A;  3L24 A;  2P98 A; 
#chains in the Genus database with same CATH topology
 5CE6 A;  4FO7 A;  4FLK A;  4U71 A;  4IU6 A;  1XNZ A;  1YJ3 A;  2GG3 A;  3MAT A;  4HXX A;  4RGZ 1;  4S2T P;  2EVO A;  1R5H A;  3IU9 A;  3PKB A;  2GU5 A;  2Q94 A;  2Q96 A;  2HOW A;  4IKS A;  3CTZ A;  3IU8 A;  5CDV A;  1QXY A;  2BN7 A;  4FLJ A;  1Y1N A;  4U1B A;  3PKA A;  2GG0 A;  4IKU A;  4U6C A;  1R58 A;  4U76 A;  2MAT A;  4FO8 A;  2BWS A;  1WL9 A;  4ZWU A;  2V3Z A;  1CHM A;  4IF7 A;  2P9A A;  1QXW A;  2EVC A;  1XGN A;  3IG4 A;  3IU7 A;  1YW7 A;  4U6J A;  4FLL A;  2V3X A;  4U70 A;  1YW9 A;  5CDL A;  2BH3 A;  4U73 A;  2GG7 A;  2B3L A;  5CDE A;  1B59 A;  3S6B A;  4RZZ A;  2Q93 A;  2Q92 A;  4A6W A;  1WBQ A;  2ZSG A;  2IW2 A;  3PKE A;  2ADU A;  1PV9 A;  3PKC A;  1C21 A;  3ROR A;  4QR8 A;  3FMR A;  1O0X A;  2GG5 A;  1W7V A;  4FKC A;  3MX6 A;  3RVA A;  2EA2 A;  2GG2 A;  4U75 A;  2BWT A;  1WL6 A;  5D6F A;  1C23 A;  4U69 A;  1C27 A;  4KM3 A;  2GGB A;  1MAT A;  2NQ7 A;  4OOK A;  4ZWP A;  1C24 A;  5CNX A;  1BOA A;  4ZWO A;  2B3K A;  1A16 A;  2OKN A;  4IKR A;  2BWY A;  3Q6D A;  1JAW A;  4FUK A;  1WY2 A;  4B28 A;  1YW8 A;  5FCH A;  3PKD A;  4S2R P;  3CB5 A;  1R5G A;  1WKM A;  4JUQ A;  5E5B A;  4EGE A;  1QZY A;  5FCF A;  3FM3 A;  5JI6 A;  1XGO A;  2GG9 A;  3BIP A;  1YVM A;  2BWU A;  5CLS A;  3TAV A;  2GU7 A;  1BN5 A;  2EA4 A;  4R60 A;  2DFI A;  3TB5 A;  2GU6 A;  4U6Z A;  4U6W A;  4IEC A;  2Q95 A;  2EVM A;  4S00 A;  2GA2 A;  4A6V A;  1M35 A;  4FLI A;  2B3H A;  4PV4 A;  1B6A A;  4IKT A;  2GTX A;  4RZY A;  2OAZ A;  1XGS A;  4MAT A;  4PNC A;  3CB6 A;  2BB7 A;  1N51 A;  2BWV A;  2BWW A;  2G6P A;  2GZ5 A;  2BHA A;  4ZNG A;  1WLR A;  4IDY A;  1W2M A;  2BHB A;  5JHU A;  5JFR A;  3L7G A;  1C22 A;  2BHC A;  2GGC A;  2BWX A;  3D27 A;  2Q8K A;  4S01 A;  2V6C A;  2BHD A;  4IPA A;  3BIT A;  3BIQ A;  2GG8 A;  1WN1 A;  5CIK A;  1QXZ A;  3FMQ A;  1KP0 A;  1XGM A;  2P99 A;  2GU4 A;  1KQ0 A;  2NQ6 A;  5D6E A;  1KQ9 A;  3MR1 A;  2V3Y A;  4Z7M A;  4U6E A;  3L24 A;  2P98 A; 
#chains in the Genus database with same CATH homology
 5CE6 A;  4FO7 A;  4FLK A;  4U71 A;  4IU6 A;  1XNZ A;  1YJ3 A;  2GG3 A;  3MAT A;  4HXX A;  4RGZ 1;  4S2T P;  2EVO A;  1R5H A;  3IU9 A;  3PKB A;  2GU5 A;  2Q94 A;  2Q96 A;  2HOW A;  4IKS A;  3CTZ A;  3IU8 A;  5CDV A;  1QXY A;  2BN7 A;  4FLJ A;  1Y1N A;  4U1B A;  3PKA A;  2GG0 A;  4IKU A;  4U6C A;  1R58 A;  4U76 A;  2MAT A;  4FO8 A;  2BWS A;  1WL9 A;  4ZWU A;  2V3Z A;  1CHM A;  4IF7 A;  2P9A A;  1QXW A;  2EVC A;  1XGN A;  3IG4 A;  3IU7 A;  1YW7 A;  4U6J A;  4FLL A;  2V3X A;  4U70 A;  1YW9 A;  5CDL A;  2BH3 A;  4U73 A;  2GG7 A;  2B3L A;  5CDE A;  1B59 A;  3S6B A;  4RZZ A;  2Q93 A;  2Q92 A;  4A6W A;  1WBQ A;  2ZSG A;  2IW2 A;  3PKE A;  2ADU A;  1PV9 A;  3PKC A;  1C21 A;  3ROR A;  4QR8 A;  3FMR A;  1O0X A;  2GG5 A;  1W7V A;  4FKC A;  3MX6 A;  3RVA A;  2EA2 A;  2GG2 A;  4U75 A;  2BWT A;  1WL6 A;  5D6F A;  1C23 A;  4U69 A;  1C27 A;  4KM3 A;  2GGB A;  1MAT A;  2NQ7 A;  4OOK A;  4ZWP A;  1C24 A;  5CNX A;  1BOA A;  4ZWO A;  2B3K A;  1A16 A;  2OKN A;  4IKR A;  2BWY A;  3Q6D A;  1JAW A;  4FUK A;  1WY2 A;  4B28 A;  1YW8 A;  5FCH A;  3PKD A;  4S2R P;  3CB5 A;  1R5G A;  1WKM A;  4JUQ A;  5E5B A;  4EGE A;  1QZY A;  5FCF A;  3FM3 A;  5JI6 A;  1XGO A;  2GG9 A;  3BIP A;  1YVM A;  2BWU A;  5CLS A;  3TAV A;  2GU7 A;  1BN5 A;  2EA4 A;  4R60 A;  2DFI A;  3TB5 A;  2GU6 A;  4U6Z A;  4U6W A;  4IEC A;  2Q95 A;  2EVM A;  4S00 A;  2GA2 A;  4A6V A;  1M35 A;  4FLI A;  2B3H A;  4PV4 A;  1B6A A;  4IKT A;  2GTX A;  4RZY A;  2OAZ A;  1XGS A;  4MAT A;  4PNC A;  3CB6 A;  2BB7 A;  1N51 A;  2BWV A;  2BWW A;  2G6P A;  2GZ5 A;  2BHA A;  4ZNG A;  1WLR A;  4IDY A;  1W2M A;  2BHB A;  5JHU A;  5JFR A;  3L7G A;  1C22 A;  2BHC A;  2GGC A;  2BWX A;  3D27 A;  2Q8K A;  4S01 A;  2V6C A;  2BHD A;  4IPA A;  3BIT A;  3BIQ A;  2GG8 A;  1WN1 A;  5CIK A;  1QXZ A;  3FMQ A;  1KP0 A;  1XGM A;  2P99 A;  2GU4 A;  1KQ0 A;  2NQ6 A;  5D6E A;  1KQ9 A;  3MR1 A;  2V3Y A;  4Z7M A;  4U6E A;  3L24 A;  2P98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...