4FO7A

Pseudomonas aeruginosa metap, in mn form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo7A00
4Z7MA 1XGNA 2DFIA 4U71A 1KQ0A 4U69A 3PKBA 1C27A 2GG8A 2BH3A 2BWVA 2GG0A 1XGMA 1C21A 2GGCA 2BWYA 2V3ZA 1KQ9A 4S01A 5CNXA 3FM3A 3MATA 1QXZA 4B28A 3PKDA 1WL6A 2P9AA 1YW8A 5D6EA 5JHUA 2V6CA 1M35A 5D6FA 4IKRA 1N51A 2OKNA 2BB7A 2GG2A 1WY2A 4IPAA 2ADUA 2GA2A 1JAWA 1WKMA 3PKCA 4U70A 5CIKA 1R5GA 4RZYA 4FLKA 5JFRA 2GU5A 4IF7A 2NQ6A 2Q93A 4EGEA 2GZ5A 1B59A 1PV9A 2B3HA 2P98A 2Q92A 4S2RP 2Q8KA 4A6WA 4IDYA 4RGZ1 4IECA 1QXYA 2GU7A 3CB5A 4ZNGA 3CB6A 2EVMA 3IU7A 5CDVA 4FKCA 3MX6A 4U6JA 1WBQA 5E5BA 5CE6A 2GU4A 4IU6A 3CTZA 2BWTA 2B3LA 2BWUA 2GG3A 3RORA 2BWSA 2OAZA 3BIPA 3L24A 4HXXA 1YW7A 3IU8A 5JI6A 1WL9A 4PV4A 3FMQA 2BHAA 4FO7A 3PKEA 4ZWPA 5CLSA 1XGSA 4FUKA 4IKSA 4IKTA 4PNCA 5FCFA 4ZWOA 1C23A 2ZSGA 3S6BA 1R5HA 3MR1A 2BHCA 2EVCA 3IU9A 2B3KA 4U6EA 1WN1A 1W7VA 4MATA 2Q94A 4U76A 1BOAA 4JUQA 1R58A 3TB5A 4U6ZA 2BWXA 4FO8A 4ZWUA 1C24A 3IG4A 4S2TP 2IW2A 4U6CA 2V3YA 2GG5A 4U75A 2G6PA 3FMRA 5CDEA 1W2MA 1Y1NA 2EA4A 2NQ7A 5FCHA 4FLJA 4S00A 2MATA 2V3XA 2BHDA 1QZYA 1KP0A 2BN7A 4QR8A 3Q6DA 5CDLA 4A6VA 2EVOA 3D27A 2Q96A 3L7GA 3BIQA 1C22A 1WLRA 2GG9A 4FLLA 1BN5A 4IKUA 4R60A 1O0XA 1XGOA 2GTXA 3PKAA 4OOKA 1QXWA 2HOWA 1A16A 2Q95A 2BHBA 1XNZA 2GU6A 2GGBA 2EA2A 3BITA 2BWWA 4KM3A 1YJ3A 4U1BA 2P99A 1MATA 3TAVA 1B6AA 4U73A 4FLIA 1CHMA 4U6WA 1YW9A 3RVAA 4RZZA 1YVMA 2GG7A
chains in the Genus database with same CATH superfamily
4Z7MA 1XGNA 2DFIA 4U71A 1KQ0A 4U69A 3PKBA 1C27A 2GG8A 2BH3A 2BWVA 2GG0A 1XGMA 1C21A 2GGCA 2BWYA 2V3ZA 1KQ9A 4S01A 5CNXA 3FM3A 3MATA 1QXZA 4B28A 3PKDA 1WL6A 2P9AA 1YW8A 5D6EA 5JHUA 2V6CA 1M35A 5D6FA 4IKRA 1N51A 2OKNA 2BB7A 2GG2A 1WY2A 4IPAA 2ADUA 2GA2A 1JAWA 1WKMA 3PKCA 4U70A 5CIKA 1R5GA 4RZYA 4FLKA 5JFRA 2GU5A 4IF7A 2NQ6A 2Q93A 4EGEA 2GZ5A 1B59A 1PV9A 2B3HA 2P98A 2Q92A 4S2RP 2Q8KA 4A6WA 4IDYA 4RGZ1 4IECA 1QXYA 2GU7A 3CB5A 4ZNGA 3CB6A 2EVMA 3IU7A 5CDVA 4FKCA 3MX6A 4U6JA 1WBQA 5E5BA 5CE6A 2GU4A 4IU6A 3CTZA 2BWTA 2B3LA 2BWUA 2GG3A 3RORA 2BWSA 2OAZA 3BIPA 3L24A 4HXXA 1YW7A 3IU8A 5JI6A 1WL9A 4PV4A 3FMQA 2BHAA 4FO7A 3PKEA 4ZWPA 5CLSA 1XGSA 4FUKA 4IKSA 4IKTA 4PNCA 5FCFA 4ZWOA 1C23A 2ZSGA 3S6BA 1R5HA 3MR1A 2BHCA 2EVCA 3IU9A 2B3KA 4U6EA 1WN1A 1W7VA 4MATA 2Q94A 4U76A 1BOAA 4JUQA 1R58A 3TB5A 4U6ZA 2BWXA 4FO8A 4ZWUA 1C24A 3IG4A 4S2TP 2IW2A 4U6CA 2V3YA 2GG5A 4U75A 2G6PA 3FMRA 5CDEA 1W2MA 1Y1NA 2EA4A 2NQ7A 5FCHA 4FLJA 4S00A 2MATA 2V3XA 2BHDA 1QZYA 1KP0A 2BN7A 4QR8A 3Q6DA 5CDLA 4A6VA 2EVOA 3D27A 2Q96A 3L7GA 3BIQA 1C22A 1WLRA 2GG9A 4FLLA 1BN5A 4IKUA 4R60A 1O0XA 1XGOA 2GTXA 3PKAA 4OOKA 1QXWA 2HOWA 1A16A 2Q95A 2BHBA 1XNZA 2GU6A 2GGBA 2EA2A 3BITA 2BWWA 4KM3A 1YJ3A 4U1BA 2P99A 1MATA 3TAVA 1B6AA 4U73A 4FLIA 1CHMA 4U6WA 1YW9A 3RVAA 4RZZA 1YVMA 2GG7A
chains in the Genus database with same CATH topology
4Z7MA 1XGNA 2DFIA 4U71A 1KQ0A 4U69A 3PKBA 1C27A 2GG8A 2BH3A 2BWVA 2GG0A 1XGMA 1C21A 2GGCA 2BWYA 2V3ZA 1KQ9A 4S01A 5CNXA 3FM3A 3MATA 1QXZA 4B28A 3PKDA 1WL6A 2P9AA 1YW8A 5D6EA 5JHUA 2V6CA 1M35A 5D6FA 4IKRA 1N51A 2OKNA 2BB7A 2GG2A 1WY2A 4IPAA 2ADUA 2GA2A 1JAWA 1WKMA 3PKCA 4U70A 5CIKA 1R5GA 4RZYA 4FLKA 5JFRA 2GU5A 4IF7A 2NQ6A 2Q93A 4EGEA 2GZ5A 1B59A 1PV9A 2B3HA 2P98A 2Q92A 4S2RP 2Q8KA 4A6WA 4IDYA 4RGZ1 4IECA 1QXYA 2GU7A 3CB5A 4ZNGA 3CB6A 2EVMA 3IU7A 5CDVA 4FKCA 3MX6A 4U6JA 1WBQA 5E5BA 5CE6A 2GU4A 4IU6A 3CTZA 2BWTA 2B3LA 2BWUA 2GG3A 3RORA 2BWSA 2OAZA 3BIPA 3L24A 4HXXA 1YW7A 3IU8A 5JI6A 1WL9A 4PV4A 3FMQA 2BHAA 4FO7A 3PKEA 4ZWPA 5CLSA 1XGSA 4FUKA 4IKSA 4IKTA 4PNCA 5FCFA 4ZWOA 1C23A 2ZSGA 3S6BA 1R5HA 3MR1A 2BHCA 2EVCA 3IU9A 2B3KA 4U6EA 1WN1A 1W7VA 4MATA 2Q94A 4U76A 1BOAA 4JUQA 1R58A 3TB5A 4U6ZA 2BWXA 4FO8A 4ZWUA 1C24A 3IG4A 4S2TP 2IW2A 4U6CA 2V3YA 2GG5A 4U75A 2G6PA 3FMRA 5CDEA 1W2MA 1Y1NA 2EA4A 2NQ7A 5FCHA 4FLJA 4S00A 2MATA 2V3XA 2BHDA 1QZYA 1KP0A 2BN7A 4QR8A 3Q6DA 5CDLA 4A6VA 2EVOA 3D27A 2Q96A 3L7GA 3BIQA 1C22A 1WLRA 2GG9A 4FLLA 1BN5A 4IKUA 4R60A 1O0XA 1XGOA 2GTXA 3PKAA 4OOKA 1QXWA 2HOWA 1A16A 2Q95A 2BHBA 1XNZA 2GU6A 2GGBA 2EA2A 3BITA 2BWWA 4KM3A 1YJ3A 4U1BA 2P99A 1MATA 3TAVA 1B6AA 4U73A 4FLIA 1CHMA 4U6WA 1YW9A 3RVAA 4RZZA 1YVMA 2GG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7M A;  1XGN A;  2DFI A;  4U71 A;  1KQ0 A;  4U69 A;  3PKB A;  1C27 A;  2GG8 A;  2BH3 A;  2BWV A;  2GG0 A;  1XGM A;  1C21 A;  2GGC A;  2BWY A;  2V3Z A;  1KQ9 A;  4S01 A;  5CNX A;  3FM3 A;  3MAT A;  1QXZ A;  4B28 A;  3PKD A;  1WL6 A;  2P9A A;  1YW8 A;  5D6E A;  5JHU A;  2V6C A;  1M35 A;  5D6F A;  4IKR A;  1N51 A;  2OKN A;  2BB7 A;  2GG2 A;  1WY2 A;  4IPA A;  2ADU A;  2GA2 A;  1JAW A;  1WKM A;  3PKC A;  4U70 A;  5CIK A;  1R5G A;  4RZY A;  4FLK A;  5JFR A;  2GU5 A;  4IF7 A;  2NQ6 A;  2Q93 A;  4EGE A;  2GZ5 A;  1B59 A;  1PV9 A;  2B3H A;  2P98 A;  2Q92 A;  4S2R P;  2Q8K A;  4A6W A;  4IDY A;  4RGZ 1;  4IEC A;  1QXY A;  2GU7 A;  3CB5 A;  4ZNG A;  3CB6 A;  2EVM A;  3IU7 A;  5CDV A;  4FKC A;  3MX6 A;  4U6J A;  1WBQ A;  5E5B A;  5CE6 A;  2GU4 A;  4IU6 A;  3CTZ A;  2BWT A;  2B3L A;  2BWU A;  2GG3 A;  3ROR A;  2BWS A;  2OAZ A;  3BIP A;  3L24 A;  4HXX A;  1YW7 A;  3IU8 A;  5JI6 A;  1WL9 A;  4PV4 A;  3FMQ A;  2BHA A;  4FO7 A;  3PKE A;  4ZWP A;  5CLS A;  1XGS A;  4FUK A;  4IKS A;  4IKT A;  4PNC A;  5FCF A;  4ZWO A;  1C23 A;  2ZSG A;  3S6B A;  1R5H A;  3MR1 A;  2BHC A;  2EVC A;  3IU9 A;  2B3K A;  4U6E A;  1WN1 A;  1W7V A;  4MAT A;  2Q94 A;  4U76 A;  1BOA A;  4JUQ A;  1R58 A;  3TB5 A;  4U6Z A;  2BWX A;  4FO8 A;  4ZWU A;  1C24 A;  3IG4 A;  4S2T P;  2IW2 A;  4U6C A;  2V3Y A;  2GG5 A;  4U75 A;  2G6P A;  3FMR A;  5CDE A;  1W2M A;  1Y1N A;  2EA4 A;  2NQ7 A;  5FCH A;  4FLJ A;  4S00 A;  2MAT A;  2V3X A;  2BHD A;  1QZY A;  1KP0 A;  2BN7 A;  4QR8 A;  3Q6D A;  5CDL A;  4A6V A;  2EVO A;  3D27 A;  2Q96 A;  3L7G A;  3BIQ A;  1C22 A;  1WLR A;  2GG9 A;  4FLL A;  1BN5 A;  4IKU A;  4R60 A;  1O0X A;  1XGO A;  2GTX A;  3PKA A;  4OOK A;  1QXW A;  2HOW A;  1A16 A;  2Q95 A;  2BHB A;  1XNZ A;  2GU6 A;  2GGB A;  2EA2 A;  3BIT A;  2BWW A;  4KM3 A;  1YJ3 A;  4U1B A;  2P99 A;  1MAT A;  3TAV A;  1B6A A;  4U73 A;  4FLI A;  1CHM A;  4U6W A;  1YW9 A;  3RVA A;  4RZZ A;  1YVM A;  2GG7 A; 
#chains in the Genus database with same CATH topology
 4Z7M A;  1XGN A;  2DFI A;  4U71 A;  1KQ0 A;  4U69 A;  3PKB A;  1C27 A;  2GG8 A;  2BH3 A;  2BWV A;  2GG0 A;  1XGM A;  1C21 A;  2GGC A;  2BWY A;  2V3Z A;  1KQ9 A;  4S01 A;  5CNX A;  3FM3 A;  3MAT A;  1QXZ A;  4B28 A;  3PKD A;  1WL6 A;  2P9A A;  1YW8 A;  5D6E A;  5JHU A;  2V6C A;  1M35 A;  5D6F A;  4IKR A;  1N51 A;  2OKN A;  2BB7 A;  2GG2 A;  1WY2 A;  4IPA A;  2ADU A;  2GA2 A;  1JAW A;  1WKM A;  3PKC A;  4U70 A;  5CIK A;  1R5G A;  4RZY A;  4FLK A;  5JFR A;  2GU5 A;  4IF7 A;  2NQ6 A;  2Q93 A;  4EGE A;  2GZ5 A;  1B59 A;  1PV9 A;  2B3H A;  2P98 A;  2Q92 A;  4S2R P;  2Q8K A;  4A6W A;  4IDY A;  4RGZ 1;  4IEC A;  1QXY A;  2GU7 A;  3CB5 A;  4ZNG A;  3CB6 A;  2EVM A;  3IU7 A;  5CDV A;  4FKC A;  3MX6 A;  4U6J A;  1WBQ A;  5E5B A;  5CE6 A;  2GU4 A;  4IU6 A;  3CTZ A;  2BWT A;  2B3L A;  2BWU A;  2GG3 A;  3ROR A;  2BWS A;  2OAZ A;  3BIP A;  3L24 A;  4HXX A;  1YW7 A;  3IU8 A;  5JI6 A;  1WL9 A;  4PV4 A;  3FMQ A;  2BHA A;  4FO7 A;  3PKE A;  4ZWP A;  5CLS A;  1XGS A;  4FUK A;  4IKS A;  4IKT A;  4PNC A;  5FCF A;  4ZWO A;  1C23 A;  2ZSG A;  3S6B A;  1R5H A;  3MR1 A;  2BHC A;  2EVC A;  3IU9 A;  2B3K A;  4U6E A;  1WN1 A;  1W7V A;  4MAT A;  2Q94 A;  4U76 A;  1BOA A;  4JUQ A;  1R58 A;  3TB5 A;  4U6Z A;  2BWX A;  4FO8 A;  4ZWU A;  1C24 A;  3IG4 A;  4S2T P;  2IW2 A;  4U6C A;  2V3Y A;  2GG5 A;  4U75 A;  2G6P A;  3FMR A;  5CDE A;  1W2M A;  1Y1N A;  2EA4 A;  2NQ7 A;  5FCH A;  4FLJ A;  4S00 A;  2MAT A;  2V3X A;  2BHD A;  1QZY A;  1KP0 A;  2BN7 A;  4QR8 A;  3Q6D A;  5CDL A;  4A6V A;  2EVO A;  3D27 A;  2Q96 A;  3L7G A;  3BIQ A;  1C22 A;  1WLR A;  2GG9 A;  4FLL A;  1BN5 A;  4IKU A;  4R60 A;  1O0X A;  1XGO A;  2GTX A;  3PKA A;  4OOK A;  1QXW A;  2HOW A;  1A16 A;  2Q95 A;  2BHB A;  1XNZ A;  2GU6 A;  2GGB A;  2EA2 A;  3BIT A;  2BWW A;  4KM3 A;  1YJ3 A;  4U1B A;  2P99 A;  1MAT A;  3TAV A;  1B6A A;  4U73 A;  4FLI A;  1CHM A;  4U6W A;  1YW9 A;  3RVA A;  4RZZ A;  1YVM A;  2GG7 A; 
#chains in the Genus database with same CATH homology
 4Z7M A;  1XGN A;  2DFI A;  4U71 A;  1KQ0 A;  4U69 A;  3PKB A;  1C27 A;  2GG8 A;  2BH3 A;  2BWV A;  2GG0 A;  1XGM A;  1C21 A;  2GGC A;  2BWY A;  2V3Z A;  1KQ9 A;  4S01 A;  5CNX A;  3FM3 A;  3MAT A;  1QXZ A;  4B28 A;  3PKD A;  1WL6 A;  2P9A A;  1YW8 A;  5D6E A;  5JHU A;  2V6C A;  1M35 A;  5D6F A;  4IKR A;  1N51 A;  2OKN A;  2BB7 A;  2GG2 A;  1WY2 A;  4IPA A;  2ADU A;  2GA2 A;  1JAW A;  1WKM A;  3PKC A;  4U70 A;  5CIK A;  1R5G A;  4RZY A;  4FLK A;  5JFR A;  2GU5 A;  4IF7 A;  2NQ6 A;  2Q93 A;  4EGE A;  2GZ5 A;  1B59 A;  1PV9 A;  2B3H A;  2P98 A;  2Q92 A;  4S2R P;  2Q8K A;  4A6W A;  4IDY A;  4RGZ 1;  4IEC A;  1QXY A;  2GU7 A;  3CB5 A;  4ZNG A;  3CB6 A;  2EVM A;  3IU7 A;  5CDV A;  4FKC A;  3MX6 A;  4U6J A;  1WBQ A;  5E5B A;  5CE6 A;  2GU4 A;  4IU6 A;  3CTZ A;  2BWT A;  2B3L A;  2BWU A;  2GG3 A;  3ROR A;  2BWS A;  2OAZ A;  3BIP A;  3L24 A;  4HXX A;  1YW7 A;  3IU8 A;  5JI6 A;  1WL9 A;  4PV4 A;  3FMQ A;  2BHA A;  4FO7 A;  3PKE A;  4ZWP A;  5CLS A;  1XGS A;  4FUK A;  4IKS A;  4IKT A;  4PNC A;  5FCF A;  4ZWO A;  1C23 A;  2ZSG A;  3S6B A;  1R5H A;  3MR1 A;  2BHC A;  2EVC A;  3IU9 A;  2B3K A;  4U6E A;  1WN1 A;  1W7V A;  4MAT A;  2Q94 A;  4U76 A;  1BOA A;  4JUQ A;  1R58 A;  3TB5 A;  4U6Z A;  2BWX A;  4FO8 A;  4ZWU A;  1C24 A;  3IG4 A;  4S2T P;  2IW2 A;  4U6C A;  2V3Y A;  2GG5 A;  4U75 A;  2G6P A;  3FMR A;  5CDE A;  1W2M A;  1Y1N A;  2EA4 A;  2NQ7 A;  5FCH A;  4FLJ A;  4S00 A;  2MAT A;  2V3X A;  2BHD A;  1QZY A;  1KP0 A;  2BN7 A;  4QR8 A;  3Q6D A;  5CDL A;  4A6V A;  2EVO A;  3D27 A;  2Q96 A;  3L7G A;  3BIQ A;  1C22 A;  1WLR A;  2GG9 A;  4FLL A;  1BN5 A;  4IKU A;  4R60 A;  1O0X A;  1XGO A;  2GTX A;  3PKA A;  4OOK A;  1QXW A;  2HOW A;  1A16 A;  2Q95 A;  2BHB A;  1XNZ A;  2GU6 A;  2GGB A;  2EA2 A;  3BIT A;  2BWW A;  4KM3 A;  1YJ3 A;  4U1B A;  2P99 A;  1MAT A;  3TAV A;  1B6A A;  4U73 A;  4FLI A;  1CHM A;  4U6W A;  1YW9 A;  3RVA A;  4RZZ A;  1YVM A;  2GG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...