4FO7A

Pseudomonas aeruginosa metap, in mn form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
b'TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo7A00
3TAVA 4FLKA 1WBQA 1KP0A 1JAWA 3PKCA 5CDLA 4IPAA 1QXYA 1C27A 4IKSA 4FLLA 2BHDA 5D6EA 1YW8A 2GG3A 1XGOA 3PKDA 2BH3A 3L24A 1WL6A 2Q94A 4ZWPA 1CHMA 1C22A 4FKCA 2BWVA 5FCHA 5D6FA 2V3XA 3RORA 4IF7A 5CNXA 3PKBA 3L7GA 4U73A 2EVMA 1KQ9A 4R60A 2B3KA 2BHAA 2BWYA 3IU8A 4U6ZA 4HXXA 2GU5A 4U70A 4ZNGA 2GG8A 2IW2A 4U69A 1C21A 1MATA 2P99A 4IU6A 1QXWA 4IKTA 3CTZA 2GG9A 4EGEA 3CB5A 2BN7A 2BWWA 1YW7A 2BWSA 3FMRA 1YW9A 3D27A 4U6EA 1C23A 1WN1A 2Q96A 4U1BA 3FMQA 4KM3A 1R5HA 2P98A 1R58A 4ZWOA 1XGMA 2GU6A 1W7VA 2G6PA 1XNZA 4S2TP 2GU4A 4U71A 1YJ3A 2EVCA 4U75A 2V3YA 4JUQA 2BB7A 3BIQA 2V3ZA 1B6AA 4A6WA 2OKNA 1QZYA 2GU7A 1BN5A 2HOWA 2GG7A 5CDVA 4PV4A 4U6WA 2Q95A 2BWTA 2GA2A 1O0XA 2GG5A 4IKRA 4S00A 3MR1A 4A6VA 1WKMA 2NQ6A 2GG2A 1R5GA 2BHCA 2DFIA 4Z7MA 4S01A 2V6CA 4FO8A 5E5BA 5JI6A 4IDYA 4OOKA 1WL9A 5JFRA 5CLSA 3Q6DA 3MX6A 2BWXA 4QR8A 1M35A 1N51A 1W2MA 2EVOA 4RGZ1 3IU9A 2GZ5A 3FM3A 4ZWUA 2GGCA 1B59A 4FO7A 5CE6A 2B3LA 1PV9A 4RZYA 4U6JA 4RZZA 4FLJA 2GTXA 1QXZA 5FCFA 2NQ7A 3MATA 4PNCA 1Y1NA 2EA2A 1KQ0A 4U76A 3TB5A 3BIPA 1XGNA 3PKEA 4FUKA 3BITA 4B28A 1WY2A 5JHUA 3IU7A 4IECA 4U6CA 1A16A 4MATA 3CB6A 2Q8KA 3S6BA 5CDEA 1WLRA 2GGBA 1BOAA 3IG4A 2Q93A 2BHBA 3PKAA 4S2RP 1XGSA 2GG0A 5CIKA 2ZSGA 2Q92A 1YVMA 2OAZA 4FLIA 2BWUA 2B3HA 1C24A 2EA4A 2P9AA 2ADUA 2MATA 4IKUA 3RVAA
chains in the Genus database with same CATH superfamily
3TAVA 4FLKA 1WBQA 1KP0A 1JAWA 3PKCA 5CDLA 4IPAA 1QXYA 1C27A 4IKSA 4FLLA 2BHDA 5D6EA 1YW8A 2GG3A 1XGOA 3PKDA 2BH3A 3L24A 1WL6A 2Q94A 4ZWPA 1CHMA 1C22A 4FKCA 2BWVA 5FCHA 5D6FA 2V3XA 3RORA 4IF7A 5CNXA 3PKBA 3L7GA 4U73A 2EVMA 1KQ9A 4R60A 2B3KA 2BHAA 2BWYA 3IU8A 4U6ZA 4HXXA 2GU5A 4U70A 4ZNGA 2GG8A 2IW2A 4U69A 1C21A 1MATA 2P99A 4IU6A 1QXWA 4IKTA 3CTZA 2GG9A 4EGEA 3CB5A 2BN7A 2BWWA 1YW7A 2BWSA 3FMRA 1YW9A 3D27A 4U6EA 1C23A 1WN1A 2Q96A 4U1BA 3FMQA 4KM3A 1R5HA 2P98A 1R58A 4ZWOA 1XGMA 2GU6A 1W7VA 2G6PA 1XNZA 4S2TP 2GU4A 4U71A 1YJ3A 2EVCA 4U75A 2V3YA 4JUQA 2BB7A 3BIQA 2V3ZA 1B6AA 4A6WA 2OKNA 1QZYA 2GU7A 1BN5A 2HOWA 2GG7A 5CDVA 4PV4A 4U6WA 2Q95A 2BWTA 2GA2A 1O0XA 2GG5A 4IKRA 4S00A 3MR1A 4A6VA 1WKMA 2NQ6A 2GG2A 1R5GA 2BHCA 2DFIA 4Z7MA 4S01A 2V6CA 4FO8A 5E5BA 5JI6A 4IDYA 4OOKA 1WL9A 5JFRA 5CLSA 3Q6DA 3MX6A 2BWXA 4QR8A 1M35A 1N51A 1W2MA 2EVOA 4RGZ1 3IU9A 2GZ5A 3FM3A 4ZWUA 2GGCA 1B59A 4FO7A 5CE6A 2B3LA 1PV9A 4RZYA 4U6JA 4RZZA 4FLJA 2GTXA 1QXZA 5FCFA 2NQ7A 3MATA 4PNCA 1Y1NA 2EA2A 1KQ0A 4U76A 3TB5A 3BIPA 1XGNA 3PKEA 4FUKA 3BITA 4B28A 1WY2A 5JHUA 3IU7A 4IECA 4U6CA 1A16A 4MATA 3CB6A 2Q8KA 3S6BA 5CDEA 1WLRA 2GGBA 1BOAA 3IG4A 2Q93A 2BHBA 3PKAA 4S2RP 1XGSA 2GG0A 5CIKA 2ZSGA 2Q92A 1YVMA 2OAZA 4FLIA 2BWUA 2B3HA 1C24A 2EA4A 2P9AA 2ADUA 2MATA 4IKUA 3RVAA
chains in the Genus database with same CATH topology
3TAVA 4FLKA 1WBQA 1KP0A 1JAWA 3PKCA 5CDLA 4IPAA 1QXYA 1C27A 4IKSA 4FLLA 2BHDA 5D6EA 1YW8A 2GG3A 1XGOA 3PKDA 2BH3A 3L24A 1WL6A 2Q94A 4ZWPA 1CHMA 1C22A 4FKCA 2BWVA 5FCHA 5D6FA 2V3XA 3RORA 4IF7A 5CNXA 3PKBA 3L7GA 4U73A 2EVMA 1KQ9A 4R60A 2B3KA 2BHAA 2BWYA 3IU8A 4U6ZA 4HXXA 2GU5A 4U70A 4ZNGA 2GG8A 2IW2A 4U69A 1C21A 1MATA 2P99A 4IU6A 1QXWA 4IKTA 3CTZA 2GG9A 4EGEA 3CB5A 2BN7A 2BWWA 1YW7A 2BWSA 3FMRA 1YW9A 3D27A 4U6EA 1C23A 1WN1A 2Q96A 4U1BA 3FMQA 4KM3A 1R5HA 2P98A 1R58A 4ZWOA 1XGMA 2GU6A 1W7VA 2G6PA 1XNZA 4S2TP 2GU4A 4U71A 1YJ3A 2EVCA 4U75A 2V3YA 4JUQA 2BB7A 3BIQA 2V3ZA 1B6AA 4A6WA 2OKNA 1QZYA 2GU7A 1BN5A 2HOWA 2GG7A 5CDVA 4PV4A 4U6WA 2Q95A 2BWTA 2GA2A 1O0XA 2GG5A 4IKRA 4S00A 3MR1A 4A6VA 1WKMA 2NQ6A 2GG2A 1R5GA 2BHCA 2DFIA 4Z7MA 4S01A 2V6CA 4FO8A 5E5BA 5JI6A 4IDYA 4OOKA 1WL9A 5JFRA 5CLSA 3Q6DA 3MX6A 2BWXA 4QR8A 1M35A 1N51A 1W2MA 2EVOA 4RGZ1 3IU9A 2GZ5A 3FM3A 4ZWUA 2GGCA 1B59A 4FO7A 5CE6A 2B3LA 1PV9A 4RZYA 4U6JA 4RZZA 4FLJA 2GTXA 1QXZA 5FCFA 2NQ7A 3MATA 4PNCA 1Y1NA 2EA2A 1KQ0A 4U76A 3TB5A 3BIPA 1XGNA 3PKEA 4FUKA 3BITA 4B28A 1WY2A 5JHUA 3IU7A 4IECA 4U6CA 1A16A 4MATA 3CB6A 2Q8KA 3S6BA 5CDEA 1WLRA 2GGBA 1BOAA 3IG4A 2Q93A 2BHBA 3PKAA 4S2RP 1XGSA 2GG0A 5CIKA 2ZSGA 2Q92A 1YVMA 2OAZA 4FLIA 2BWUA 2B3HA 1C24A 2EA4A 2P9AA 2ADUA 2MATA 4IKUA 3RVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAV A;  4FLK A;  1WBQ A;  1KP0 A;  1JAW A;  3PKC A;  5CDL A;  4IPA A;  1QXY A;  1C27 A;  4IKS A;  4FLL A;  2BHD A;  5D6E A;  1YW8 A;  2GG3 A;  1XGO A;  3PKD A;  2BH3 A;  3L24 A;  1WL6 A;  2Q94 A;  4ZWP A;  1CHM A;  1C22 A;  4FKC A;  2BWV A;  5FCH A;  5D6F A;  2V3X A;  3ROR A;  4IF7 A;  5CNX A;  3PKB A;  3L7G A;  4U73 A;  2EVM A;  1KQ9 A;  4R60 A;  2B3K A;  2BHA A;  2BWY A;  3IU8 A;  4U6Z A;  4HXX A;  2GU5 A;  4U70 A;  4ZNG A;  2GG8 A;  2IW2 A;  4U69 A;  1C21 A;  1MAT A;  2P99 A;  4IU6 A;  1QXW A;  4IKT A;  3CTZ A;  2GG9 A;  4EGE A;  3CB5 A;  2BN7 A;  2BWW A;  1YW7 A;  2BWS A;  3FMR A;  1YW9 A;  3D27 A;  4U6E A;  1C23 A;  1WN1 A;  2Q96 A;  4U1B A;  3FMQ A;  4KM3 A;  1R5H A;  2P98 A;  1R58 A;  4ZWO A;  1XGM A;  2GU6 A;  1W7V A;  2G6P A;  1XNZ A;  4S2T P;  2GU4 A;  4U71 A;  1YJ3 A;  2EVC A;  4U75 A;  2V3Y A;  4JUQ A;  2BB7 A;  3BIQ A;  2V3Z A;  1B6A A;  4A6W A;  2OKN A;  1QZY A;  2GU7 A;  1BN5 A;  2HOW A;  2GG7 A;  5CDV A;  4PV4 A;  4U6W A;  2Q95 A;  2BWT A;  2GA2 A;  1O0X A;  2GG5 A;  4IKR A;  4S00 A;  3MR1 A;  4A6V A;  1WKM A;  2NQ6 A;  2GG2 A;  1R5G A;  2BHC A;  2DFI A;  4Z7M A;  4S01 A;  2V6C A;  4FO8 A;  5E5B A;  5JI6 A;  4IDY A;  4OOK A;  1WL9 A;  5JFR A;  5CLS A;  3Q6D A;  3MX6 A;  2BWX A;  4QR8 A;  1M35 A;  1N51 A;  1W2M A;  2EVO A;  4RGZ 1;  3IU9 A;  2GZ5 A;  3FM3 A;  4ZWU A;  2GGC A;  1B59 A;  4FO7 A;  5CE6 A;  2B3L A;  1PV9 A;  4RZY A;  4U6J A;  4RZZ A;  4FLJ A;  2GTX A;  1QXZ A;  5FCF A;  2NQ7 A;  3MAT A;  4PNC A;  1Y1N A;  2EA2 A;  1KQ0 A;  4U76 A;  3TB5 A;  3BIP A;  1XGN A;  3PKE A;  4FUK A;  3BIT A;  4B28 A;  1WY2 A;  5JHU A;  3IU7 A;  4IEC A;  4U6C A;  1A16 A;  4MAT A;  3CB6 A;  2Q8K A;  3S6B A;  5CDE A;  1WLR A;  2GGB A;  1BOA A;  3IG4 A;  2Q93 A;  2BHB A;  3PKA A;  4S2R P;  1XGS A;  2GG0 A;  5CIK A;  2ZSG A;  2Q92 A;  1YVM A;  2OAZ A;  4FLI A;  2BWU A;  2B3H A;  1C24 A;  2EA4 A;  2P9A A;  2ADU A;  2MAT A;  4IKU A;  3RVA A; 
#chains in the Genus database with same CATH topology
 3TAV A;  4FLK A;  1WBQ A;  1KP0 A;  1JAW A;  3PKC A;  5CDL A;  4IPA A;  1QXY A;  1C27 A;  4IKS A;  4FLL A;  2BHD A;  5D6E A;  1YW8 A;  2GG3 A;  1XGO A;  3PKD A;  2BH3 A;  3L24 A;  1WL6 A;  2Q94 A;  4ZWP A;  1CHM A;  1C22 A;  4FKC A;  2BWV A;  5FCH A;  5D6F A;  2V3X A;  3ROR A;  4IF7 A;  5CNX A;  3PKB A;  3L7G A;  4U73 A;  2EVM A;  1KQ9 A;  4R60 A;  2B3K A;  2BHA A;  2BWY A;  3IU8 A;  4U6Z A;  4HXX A;  2GU5 A;  4U70 A;  4ZNG A;  2GG8 A;  2IW2 A;  4U69 A;  1C21 A;  1MAT A;  2P99 A;  4IU6 A;  1QXW A;  4IKT A;  3CTZ A;  2GG9 A;  4EGE A;  3CB5 A;  2BN7 A;  2BWW A;  1YW7 A;  2BWS A;  3FMR A;  1YW9 A;  3D27 A;  4U6E A;  1C23 A;  1WN1 A;  2Q96 A;  4U1B A;  3FMQ A;  4KM3 A;  1R5H A;  2P98 A;  1R58 A;  4ZWO A;  1XGM A;  2GU6 A;  1W7V A;  2G6P A;  1XNZ A;  4S2T P;  2GU4 A;  4U71 A;  1YJ3 A;  2EVC A;  4U75 A;  2V3Y A;  4JUQ A;  2BB7 A;  3BIQ A;  2V3Z A;  1B6A A;  4A6W A;  2OKN A;  1QZY A;  2GU7 A;  1BN5 A;  2HOW A;  2GG7 A;  5CDV A;  4PV4 A;  4U6W A;  2Q95 A;  2BWT A;  2GA2 A;  1O0X A;  2GG5 A;  4IKR A;  4S00 A;  3MR1 A;  4A6V A;  1WKM A;  2NQ6 A;  2GG2 A;  1R5G A;  2BHC A;  2DFI A;  4Z7M A;  4S01 A;  2V6C A;  4FO8 A;  5E5B A;  5JI6 A;  4IDY A;  4OOK A;  1WL9 A;  5JFR A;  5CLS A;  3Q6D A;  3MX6 A;  2BWX A;  4QR8 A;  1M35 A;  1N51 A;  1W2M A;  2EVO A;  4RGZ 1;  3IU9 A;  2GZ5 A;  3FM3 A;  4ZWU A;  2GGC A;  1B59 A;  4FO7 A;  5CE6 A;  2B3L A;  1PV9 A;  4RZY A;  4U6J A;  4RZZ A;  4FLJ A;  2GTX A;  1QXZ A;  5FCF A;  2NQ7 A;  3MAT A;  4PNC A;  1Y1N A;  2EA2 A;  1KQ0 A;  4U76 A;  3TB5 A;  3BIP A;  1XGN A;  3PKE A;  4FUK A;  3BIT A;  4B28 A;  1WY2 A;  5JHU A;  3IU7 A;  4IEC A;  4U6C A;  1A16 A;  4MAT A;  3CB6 A;  2Q8K A;  3S6B A;  5CDE A;  1WLR A;  2GGB A;  1BOA A;  3IG4 A;  2Q93 A;  2BHB A;  3PKA A;  4S2R P;  1XGS A;  2GG0 A;  5CIK A;  2ZSG A;  2Q92 A;  1YVM A;  2OAZ A;  4FLI A;  2BWU A;  2B3H A;  1C24 A;  2EA4 A;  2P9A A;  2ADU A;  2MAT A;  4IKU A;  3RVA A; 
#chains in the Genus database with same CATH homology
 3TAV A;  4FLK A;  1WBQ A;  1KP0 A;  1JAW A;  3PKC A;  5CDL A;  4IPA A;  1QXY A;  1C27 A;  4IKS A;  4FLL A;  2BHD A;  5D6E A;  1YW8 A;  2GG3 A;  1XGO A;  3PKD A;  2BH3 A;  3L24 A;  1WL6 A;  2Q94 A;  4ZWP A;  1CHM A;  1C22 A;  4FKC A;  2BWV A;  5FCH A;  5D6F A;  2V3X A;  3ROR A;  4IF7 A;  5CNX A;  3PKB A;  3L7G A;  4U73 A;  2EVM A;  1KQ9 A;  4R60 A;  2B3K A;  2BHA A;  2BWY A;  3IU8 A;  4U6Z A;  4HXX A;  2GU5 A;  4U70 A;  4ZNG A;  2GG8 A;  2IW2 A;  4U69 A;  1C21 A;  1MAT A;  2P99 A;  4IU6 A;  1QXW A;  4IKT A;  3CTZ A;  2GG9 A;  4EGE A;  3CB5 A;  2BN7 A;  2BWW A;  1YW7 A;  2BWS A;  3FMR A;  1YW9 A;  3D27 A;  4U6E A;  1C23 A;  1WN1 A;  2Q96 A;  4U1B A;  3FMQ A;  4KM3 A;  1R5H A;  2P98 A;  1R58 A;  4ZWO A;  1XGM A;  2GU6 A;  1W7V A;  2G6P A;  1XNZ A;  4S2T P;  2GU4 A;  4U71 A;  1YJ3 A;  2EVC A;  4U75 A;  2V3Y A;  4JUQ A;  2BB7 A;  3BIQ A;  2V3Z A;  1B6A A;  4A6W A;  2OKN A;  1QZY A;  2GU7 A;  1BN5 A;  2HOW A;  2GG7 A;  5CDV A;  4PV4 A;  4U6W A;  2Q95 A;  2BWT A;  2GA2 A;  1O0X A;  2GG5 A;  4IKR A;  4S00 A;  3MR1 A;  4A6V A;  1WKM A;  2NQ6 A;  2GG2 A;  1R5G A;  2BHC A;  2DFI A;  4Z7M A;  4S01 A;  2V6C A;  4FO8 A;  5E5B A;  5JI6 A;  4IDY A;  4OOK A;  1WL9 A;  5JFR A;  5CLS A;  3Q6D A;  3MX6 A;  2BWX A;  4QR8 A;  1M35 A;  1N51 A;  1W2M A;  2EVO A;  4RGZ 1;  3IU9 A;  2GZ5 A;  3FM3 A;  4ZWU A;  2GGC A;  1B59 A;  4FO7 A;  5CE6 A;  2B3L A;  1PV9 A;  4RZY A;  4U6J A;  4RZZ A;  4FLJ A;  2GTX A;  1QXZ A;  5FCF A;  2NQ7 A;  3MAT A;  4PNC A;  1Y1N A;  2EA2 A;  1KQ0 A;  4U76 A;  3TB5 A;  3BIP A;  1XGN A;  3PKE A;  4FUK A;  3BIT A;  4B28 A;  1WY2 A;  5JHU A;  3IU7 A;  4IEC A;  4U6C A;  1A16 A;  4MAT A;  3CB6 A;  2Q8K A;  3S6B A;  5CDE A;  1WLR A;  2GGB A;  1BOA A;  3IG4 A;  2Q93 A;  2BHB A;  3PKA A;  4S2R P;  1XGS A;  2GG0 A;  5CIK A;  2ZSG A;  2Q92 A;  1YVM A;  2OAZ A;  4FLI A;  2BWU A;  2B3H A;  1C24 A;  2EA4 A;  2P9A A;  2ADU A;  2MAT A;  4IKU A;  3RVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...