4FO7A

Pseudomonas aeruginosa metap, in mn form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo7A00
3RVAA 4IECA 2HOWA 2IW2A 4S2RP 4U75A 2GG2A 2BHBA 4PV4A 4ZWUA 2GU7A 1PV9A 1YW7A 4EGEA 3IG4A 3PKDA 2BH3A 4RZYA 3MX6A 5FCHA 4RGZ1 3S6BA 2EA2A 2GU4A 2GG0A 2BWTA 2GTXA 4FKCA 1WBQA 4B28A 4IF7A 2BN7A 1WL6A 2BWVA 3L7GA 2Q96A 1QXYA 2GGCA 5CNXA 1C27A 2Q95A 4IKUA 1WY2A 2B3LA 3RORA 2GG7A 1A16A 4PNCA 2V3YA 5E5BA 1XNZA 1KQ0A 4U69A 1R5HA 3PKAA 2Q93A 5CDEA 3IU7A 1WN1A 1XGSA 1WKMA 1WLRA 4U1BA 1C24A 2GU6A 1Y1NA 2BWUA 2B3KA 4FLKA 1C23A 4U76A 2BWWA 1KQ9A 4U6CA 2DFIA 1C21A 4IKSA 5CLSA 2P98A 3CB5A 4U6JA 3TAVA 4IDYA 4KM3A 1JAWA 3IU8A 2NQ6A 3Q6DA 1KP0A 4ZWOA 2MATA 4U6EA 2EA4A 4S00A 2P99A 3CB6A 1R58A 4IKRA 4A6WA 1WL9A 4U70A 3FMRA 1YJ3A 1W2MA 1CHMA 4S2TP 5CE6A 4ZWPA 2BWXA 4U6ZA 1M35A 2BHAA 2GA2A 1XGOA 1N51A 5JFRA 1XGNA 2GG8A 1XGMA 2ADUA 2GGBA 4FLIA 1O0XA 2BWYA 3BIQA 3TB5A 2EVCA 1B6AA 2B3HA 5CIKA 2BWSA 2GZ5A 1W7VA 3IU9A 2ZSGA 3PKBA 4FLLA 3D27A 4U71A 1BOAA 2OAZA 2V6CA 1YW8A 5CDVA 2BB7A 2GG3A 3FMQA 1MATA 3PKCA 4MATA 2G6PA 3MATA 3MR1A 5D6FA 5D6EA 1YVMA 3BITA 5CDLA 4U73A 4U6WA 4QR8A 2BHCA 2P9AA 4RZZA 3CTZA 2GU5A 4IKTA 4HXXA 2Q8KA 1QZYA 2GG5A 2Q92A 2Q94A 2BHDA 4FO7A 4FUKA 3BIPA 4R60A 1BN5A 5FCFA 3PKEA 1QXWA 1C22A 3FM3A 4FLJA 2EVMA 2V3XA 4A6VA 2GG9A 1YW9A 4Z7MA 1R5GA 2NQ7A 4JUQA 3L24A 4S01A 4ZNGA 4IPAA 4OOKA 2V3ZA 1QXZA 1B59A 2OKNA 5JHUA 5JI6A 2EVOA 4IU6A 4FO8A
chains in the Genus database with same CATH superfamily
3RVAA 4IECA 2HOWA 2IW2A 4S2RP 4U75A 2GG2A 2BHBA 4PV4A 4ZWUA 2GU7A 1PV9A 1YW7A 4EGEA 3IG4A 3PKDA 2BH3A 4RZYA 3MX6A 5FCHA 4RGZ1 3S6BA 2EA2A 2GU4A 2GG0A 2BWTA 2GTXA 4FKCA 1WBQA 4B28A 4IF7A 2BN7A 1WL6A 2BWVA 3L7GA 2Q96A 1QXYA 2GGCA 5CNXA 1C27A 2Q95A 4IKUA 1WY2A 2B3LA 3RORA 2GG7A 1A16A 4PNCA 2V3YA 5E5BA 1XNZA 1KQ0A 4U69A 1R5HA 3PKAA 2Q93A 5CDEA 3IU7A 1WN1A 1XGSA 1WKMA 1WLRA 4U1BA 1C24A 2GU6A 1Y1NA 2BWUA 2B3KA 4FLKA 1C23A 4U76A 2BWWA 1KQ9A 4U6CA 2DFIA 1C21A 4IKSA 5CLSA 2P98A 3CB5A 4U6JA 3TAVA 4IDYA 4KM3A 1JAWA 3IU8A 2NQ6A 3Q6DA 1KP0A 4ZWOA 2MATA 4U6EA 2EA4A 4S00A 2P99A 3CB6A 1R58A 4IKRA 4A6WA 1WL9A 4U70A 3FMRA 1YJ3A 1W2MA 1CHMA 4S2TP 5CE6A 4ZWPA 2BWXA 4U6ZA 1M35A 2BHAA 2GA2A 1XGOA 1N51A 5JFRA 1XGNA 2GG8A 1XGMA 2ADUA 2GGBA 4FLIA 1O0XA 2BWYA 3BIQA 3TB5A 2EVCA 1B6AA 2B3HA 5CIKA 2BWSA 2GZ5A 1W7VA 3IU9A 2ZSGA 3PKBA 4FLLA 3D27A 4U71A 1BOAA 2OAZA 2V6CA 1YW8A 5CDVA 2BB7A 2GG3A 3FMQA 1MATA 3PKCA 4MATA 2G6PA 3MATA 3MR1A 5D6FA 5D6EA 1YVMA 3BITA 5CDLA 4U73A 4U6WA 4QR8A 2BHCA 2P9AA 4RZZA 3CTZA 2GU5A 4IKTA 4HXXA 2Q8KA 1QZYA 2GG5A 2Q92A 2Q94A 2BHDA 4FO7A 4FUKA 3BIPA 4R60A 1BN5A 5FCFA 3PKEA 1QXWA 1C22A 3FM3A 4FLJA 2EVMA 2V3XA 4A6VA 2GG9A 1YW9A 4Z7MA 1R5GA 2NQ7A 4JUQA 3L24A 4S01A 4ZNGA 4IPAA 4OOKA 2V3ZA 1QXZA 1B59A 2OKNA 5JHUA 5JI6A 2EVOA 4IU6A 4FO8A
chains in the Genus database with same CATH topology
3RVAA 4IECA 2HOWA 2IW2A 4S2RP 4U75A 2GG2A 2BHBA 4PV4A 4ZWUA 2GU7A 1PV9A 1YW7A 4EGEA 3IG4A 3PKDA 2BH3A 4RZYA 3MX6A 5FCHA 4RGZ1 3S6BA 2EA2A 2GU4A 2GG0A 2BWTA 2GTXA 4FKCA 1WBQA 4B28A 4IF7A 2BN7A 1WL6A 2BWVA 3L7GA 2Q96A 1QXYA 2GGCA 5CNXA 1C27A 2Q95A 4IKUA 1WY2A 2B3LA 3RORA 2GG7A 1A16A 4PNCA 2V3YA 5E5BA 1XNZA 1KQ0A 4U69A 1R5HA 3PKAA 2Q93A 5CDEA 3IU7A 1WN1A 1XGSA 1WKMA 1WLRA 4U1BA 1C24A 2GU6A 1Y1NA 2BWUA 2B3KA 4FLKA 1C23A 4U76A 2BWWA 1KQ9A 4U6CA 2DFIA 1C21A 4IKSA 5CLSA 2P98A 3CB5A 4U6JA 3TAVA 4IDYA 4KM3A 1JAWA 3IU8A 2NQ6A 3Q6DA 1KP0A 4ZWOA 2MATA 4U6EA 2EA4A 4S00A 2P99A 3CB6A 1R58A 4IKRA 4A6WA 1WL9A 4U70A 3FMRA 1YJ3A 1W2MA 1CHMA 4S2TP 5CE6A 4ZWPA 2BWXA 4U6ZA 1M35A 2BHAA 2GA2A 1XGOA 1N51A 5JFRA 1XGNA 2GG8A 1XGMA 2ADUA 2GGBA 4FLIA 1O0XA 2BWYA 3BIQA 3TB5A 2EVCA 1B6AA 2B3HA 5CIKA 2BWSA 2GZ5A 1W7VA 3IU9A 2ZSGA 3PKBA 4FLLA 3D27A 4U71A 1BOAA 2OAZA 2V6CA 1YW8A 5CDVA 2BB7A 2GG3A 3FMQA 1MATA 3PKCA 4MATA 2G6PA 3MATA 3MR1A 5D6FA 5D6EA 1YVMA 3BITA 5CDLA 4U73A 4U6WA 4QR8A 2BHCA 2P9AA 4RZZA 3CTZA 2GU5A 4IKTA 4HXXA 2Q8KA 1QZYA 2GG5A 2Q92A 2Q94A 2BHDA 4FO7A 4FUKA 3BIPA 4R60A 1BN5A 5FCFA 3PKEA 1QXWA 1C22A 3FM3A 4FLJA 2EVMA 2V3XA 4A6VA 2GG9A 1YW9A 4Z7MA 1R5GA 2NQ7A 4JUQA 3L24A 4S01A 4ZNGA 4IPAA 4OOKA 2V3ZA 1QXZA 1B59A 2OKNA 5JHUA 5JI6A 2EVOA 4IU6A 4FO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVA A;  4IEC A;  2HOW A;  2IW2 A;  4S2R P;  4U75 A;  2GG2 A;  2BHB A;  4PV4 A;  4ZWU A;  2GU7 A;  1PV9 A;  1YW7 A;  4EGE A;  3IG4 A;  3PKD A;  2BH3 A;  4RZY A;  3MX6 A;  5FCH A;  4RGZ 1;  3S6B A;  2EA2 A;  2GU4 A;  2GG0 A;  2BWT A;  2GTX A;  4FKC A;  1WBQ A;  4B28 A;  4IF7 A;  2BN7 A;  1WL6 A;  2BWV A;  3L7G A;  2Q96 A;  1QXY A;  2GGC A;  5CNX A;  1C27 A;  2Q95 A;  4IKU A;  1WY2 A;  2B3L A;  3ROR A;  2GG7 A;  1A16 A;  4PNC A;  2V3Y A;  5E5B A;  1XNZ A;  1KQ0 A;  4U69 A;  1R5H A;  3PKA A;  2Q93 A;  5CDE A;  3IU7 A;  1WN1 A;  1XGS A;  1WKM A;  1WLR A;  4U1B A;  1C24 A;  2GU6 A;  1Y1N A;  2BWU A;  2B3K A;  4FLK A;  1C23 A;  4U76 A;  2BWW A;  1KQ9 A;  4U6C A;  2DFI A;  1C21 A;  4IKS A;  5CLS A;  2P98 A;  3CB5 A;  4U6J A;  3TAV A;  4IDY A;  4KM3 A;  1JAW A;  3IU8 A;  2NQ6 A;  3Q6D A;  1KP0 A;  4ZWO A;  2MAT A;  4U6E A;  2EA4 A;  4S00 A;  2P99 A;  3CB6 A;  1R58 A;  4IKR A;  4A6W A;  1WL9 A;  4U70 A;  3FMR A;  1YJ3 A;  1W2M A;  1CHM A;  4S2T P;  5CE6 A;  4ZWP A;  2BWX A;  4U6Z A;  1M35 A;  2BHA A;  2GA2 A;  1XGO A;  1N51 A;  5JFR A;  1XGN A;  2GG8 A;  1XGM A;  2ADU A;  2GGB A;  4FLI A;  1O0X A;  2BWY A;  3BIQ A;  3TB5 A;  2EVC A;  1B6A A;  2B3H A;  5CIK A;  2BWS A;  2GZ5 A;  1W7V A;  3IU9 A;  2ZSG A;  3PKB A;  4FLL A;  3D27 A;  4U71 A;  1BOA A;  2OAZ A;  2V6C A;  1YW8 A;  5CDV A;  2BB7 A;  2GG3 A;  3FMQ A;  1MAT A;  3PKC A;  4MAT A;  2G6P A;  3MAT A;  3MR1 A;  5D6F A;  5D6E A;  1YVM A;  3BIT A;  5CDL A;  4U73 A;  4U6W A;  4QR8 A;  2BHC A;  2P9A A;  4RZZ A;  3CTZ A;  2GU5 A;  4IKT A;  4HXX A;  2Q8K A;  1QZY A;  2GG5 A;  2Q92 A;  2Q94 A;  2BHD A;  4FO7 A;  4FUK A;  3BIP A;  4R60 A;  1BN5 A;  5FCF A;  3PKE A;  1QXW A;  1C22 A;  3FM3 A;  4FLJ A;  2EVM A;  2V3X A;  4A6V A;  2GG9 A;  1YW9 A;  4Z7M A;  1R5G A;  2NQ7 A;  4JUQ A;  3L24 A;  4S01 A;  4ZNG A;  4IPA A;  4OOK A;  2V3Z A;  1QXZ A;  1B59 A;  2OKN A;  5JHU A;  5JI6 A;  2EVO A;  4IU6 A;  4FO8 A; 
#chains in the Genus database with same CATH topology
 3RVA A;  4IEC A;  2HOW A;  2IW2 A;  4S2R P;  4U75 A;  2GG2 A;  2BHB A;  4PV4 A;  4ZWU A;  2GU7 A;  1PV9 A;  1YW7 A;  4EGE A;  3IG4 A;  3PKD A;  2BH3 A;  4RZY A;  3MX6 A;  5FCH A;  4RGZ 1;  3S6B A;  2EA2 A;  2GU4 A;  2GG0 A;  2BWT A;  2GTX A;  4FKC A;  1WBQ A;  4B28 A;  4IF7 A;  2BN7 A;  1WL6 A;  2BWV A;  3L7G A;  2Q96 A;  1QXY A;  2GGC A;  5CNX A;  1C27 A;  2Q95 A;  4IKU A;  1WY2 A;  2B3L A;  3ROR A;  2GG7 A;  1A16 A;  4PNC A;  2V3Y A;  5E5B A;  1XNZ A;  1KQ0 A;  4U69 A;  1R5H A;  3PKA A;  2Q93 A;  5CDE A;  3IU7 A;  1WN1 A;  1XGS A;  1WKM A;  1WLR A;  4U1B A;  1C24 A;  2GU6 A;  1Y1N A;  2BWU A;  2B3K A;  4FLK A;  1C23 A;  4U76 A;  2BWW A;  1KQ9 A;  4U6C A;  2DFI A;  1C21 A;  4IKS A;  5CLS A;  2P98 A;  3CB5 A;  4U6J A;  3TAV A;  4IDY A;  4KM3 A;  1JAW A;  3IU8 A;  2NQ6 A;  3Q6D A;  1KP0 A;  4ZWO A;  2MAT A;  4U6E A;  2EA4 A;  4S00 A;  2P99 A;  3CB6 A;  1R58 A;  4IKR A;  4A6W A;  1WL9 A;  4U70 A;  3FMR A;  1YJ3 A;  1W2M A;  1CHM A;  4S2T P;  5CE6 A;  4ZWP A;  2BWX A;  4U6Z A;  1M35 A;  2BHA A;  2GA2 A;  1XGO A;  1N51 A;  5JFR A;  1XGN A;  2GG8 A;  1XGM A;  2ADU A;  2GGB A;  4FLI A;  1O0X A;  2BWY A;  3BIQ A;  3TB5 A;  2EVC A;  1B6A A;  2B3H A;  5CIK A;  2BWS A;  2GZ5 A;  1W7V A;  3IU9 A;  2ZSG A;  3PKB A;  4FLL A;  3D27 A;  4U71 A;  1BOA A;  2OAZ A;  2V6C A;  1YW8 A;  5CDV A;  2BB7 A;  2GG3 A;  3FMQ A;  1MAT A;  3PKC A;  4MAT A;  2G6P A;  3MAT A;  3MR1 A;  5D6F A;  5D6E A;  1YVM A;  3BIT A;  5CDL A;  4U73 A;  4U6W A;  4QR8 A;  2BHC A;  2P9A A;  4RZZ A;  3CTZ A;  2GU5 A;  4IKT A;  4HXX A;  2Q8K A;  1QZY A;  2GG5 A;  2Q92 A;  2Q94 A;  2BHD A;  4FO7 A;  4FUK A;  3BIP A;  4R60 A;  1BN5 A;  5FCF A;  3PKE A;  1QXW A;  1C22 A;  3FM3 A;  4FLJ A;  2EVM A;  2V3X A;  4A6V A;  2GG9 A;  1YW9 A;  4Z7M A;  1R5G A;  2NQ7 A;  4JUQ A;  3L24 A;  4S01 A;  4ZNG A;  4IPA A;  4OOK A;  2V3Z A;  1QXZ A;  1B59 A;  2OKN A;  5JHU A;  5JI6 A;  2EVO A;  4IU6 A;  4FO8 A; 
#chains in the Genus database with same CATH homology
 3RVA A;  4IEC A;  2HOW A;  2IW2 A;  4S2R P;  4U75 A;  2GG2 A;  2BHB A;  4PV4 A;  4ZWU A;  2GU7 A;  1PV9 A;  1YW7 A;  4EGE A;  3IG4 A;  3PKD A;  2BH3 A;  4RZY A;  3MX6 A;  5FCH A;  4RGZ 1;  3S6B A;  2EA2 A;  2GU4 A;  2GG0 A;  2BWT A;  2GTX A;  4FKC A;  1WBQ A;  4B28 A;  4IF7 A;  2BN7 A;  1WL6 A;  2BWV A;  3L7G A;  2Q96 A;  1QXY A;  2GGC A;  5CNX A;  1C27 A;  2Q95 A;  4IKU A;  1WY2 A;  2B3L A;  3ROR A;  2GG7 A;  1A16 A;  4PNC A;  2V3Y A;  5E5B A;  1XNZ A;  1KQ0 A;  4U69 A;  1R5H A;  3PKA A;  2Q93 A;  5CDE A;  3IU7 A;  1WN1 A;  1XGS A;  1WKM A;  1WLR A;  4U1B A;  1C24 A;  2GU6 A;  1Y1N A;  2BWU A;  2B3K A;  4FLK A;  1C23 A;  4U76 A;  2BWW A;  1KQ9 A;  4U6C A;  2DFI A;  1C21 A;  4IKS A;  5CLS A;  2P98 A;  3CB5 A;  4U6J A;  3TAV A;  4IDY A;  4KM3 A;  1JAW A;  3IU8 A;  2NQ6 A;  3Q6D A;  1KP0 A;  4ZWO A;  2MAT A;  4U6E A;  2EA4 A;  4S00 A;  2P99 A;  3CB6 A;  1R58 A;  4IKR A;  4A6W A;  1WL9 A;  4U70 A;  3FMR A;  1YJ3 A;  1W2M A;  1CHM A;  4S2T P;  5CE6 A;  4ZWP A;  2BWX A;  4U6Z A;  1M35 A;  2BHA A;  2GA2 A;  1XGO A;  1N51 A;  5JFR A;  1XGN A;  2GG8 A;  1XGM A;  2ADU A;  2GGB A;  4FLI A;  1O0X A;  2BWY A;  3BIQ A;  3TB5 A;  2EVC A;  1B6A A;  2B3H A;  5CIK A;  2BWS A;  2GZ5 A;  1W7V A;  3IU9 A;  2ZSG A;  3PKB A;  4FLL A;  3D27 A;  4U71 A;  1BOA A;  2OAZ A;  2V6C A;  1YW8 A;  5CDV A;  2BB7 A;  2GG3 A;  3FMQ A;  1MAT A;  3PKC A;  4MAT A;  2G6P A;  3MAT A;  3MR1 A;  5D6F A;  5D6E A;  1YVM A;  3BIT A;  5CDL A;  4U73 A;  4U6W A;  4QR8 A;  2BHC A;  2P9A A;  4RZZ A;  3CTZ A;  2GU5 A;  4IKT A;  4HXX A;  2Q8K A;  1QZY A;  2GG5 A;  2Q92 A;  2Q94 A;  2BHD A;  4FO7 A;  4FUK A;  3BIP A;  4R60 A;  1BN5 A;  5FCF A;  3PKE A;  1QXW A;  1C22 A;  3FM3 A;  4FLJ A;  2EVM A;  2V3X A;  4A6V A;  2GG9 A;  1YW9 A;  4Z7M A;  1R5G A;  2NQ7 A;  4JUQ A;  3L24 A;  4S01 A;  4ZNG A;  4IPA A;  4OOK A;  2V3Z A;  1QXZ A;  1B59 A;  2OKN A;  5JHU A;  5JI6 A;  2EVO A;  4IU6 A;  4FO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...