4FO7A

Pseudomonas aeruginosa metap, in mn form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo7A00
4B28A 2BN7A 2GU6A 2Q95A 2ZSGA 5E5BA 2BHAA 4S2TP 4FLJA 2GG8A 3S6BA 3MATA 4QR8A 2V3ZA 1W7VA 2Q96A 3BIPA 1PV9A 2BWSA 2P9AA 2HOWA 3FM3A 2GA2A 1C23A 2GGCA 1KQ9A 4IPAA 4JUQA 4U6ZA 1R5GA 2B3HA 3IU8A 2NQ6A 3L24A 5CIKA 2BWTA 1B59A 2BH3A 3D27A 3PKEA 1WBQA 4RGZ1 3RVAA 4ZWUA 1C21A 1WL6A 4S2RP 1XGOA 2MATA 2P98A 1B6AA 2EA2A 4IKSA 1Y1NA 2V3YA 4U75A 2BWXA 5CDLA 1XGSA 2BWWA 3CTZA 4EGEA 4PNCA 4U1BA 1YW7A 3PKDA 4PV4A 3IG4A 2GG7A 3TB5A 5JI6A 1BOAA 3MR1A 4FUKA 4U6JA 4ZWPA 2EVMA 1C24A 2BB7A 4FKCA 3L7GA 4IECA 5CDVA 2GG9A 4IDYA 1WLRA 1WY2A 2EVOA 3PKBA 1YW9A 4U70A 4U71A 1WL9A 1W2MA 4U73A 5FCHA 1QZYA 1QXYA 2BWYA 2GG2A 2G6PA 4IKTA 1QXZA 5FCFA 5JFRA 3CB5A 4FO8A 1XNZA 2Q93A 2IW2A 2GZ5A 2OAZA 3Q6DA 3RORA 1XGNA 4RZZA 1A16A 1C22A 1YVMA 5CE6A 4FLIA 4U6WA 3MX6A 2NQ7A 1CHMA 4U76A 4FLLA 4MATA 1JAWA 4FO7A 1R58A 1M35A 2GG0A 4U6CA 2Q8KA 2Q94A 4U69A 2BWUA 3IU9A 5CLSA 2BWVA 4ZWOA 1YJ3A 4HXXA 2EVCA 3TAVA 1BN5A 4Z7MA 2V3XA 2GU4A 1KQ0A 2BHDA 4IKRA 1C27A 4R60A 4S00A 4RZYA 2ADUA 2P99A 1XGMA 3IU7A 4ZNGA 4A6WA 1YW8A 2GGBA 1O0XA 1WKMA 2GG3A 5D6FA 3CB6A 2GU5A 1QXWA 4KM3A 2GG5A 4U6EA 5JHUA 5CNXA 3FMRA 4S01A 1N51A 5D6EA 4A6VA 2Q92A 4FLKA 4IF7A 1WN1A 3BIQA 2GU7A 2BHCA 2DFIA 3PKCA 2B3KA 1MATA 2BHBA 3BITA 2B3LA 2V6CA 1KP0A 3FMQA 2OKNA 2GTXA 4IKUA 1R5HA 3PKAA 4IU6A 4OOKA 5CDEA 2EA4A
chains in the Genus database with same CATH superfamily
4B28A 2BN7A 2GU6A 2Q95A 2ZSGA 5E5BA 2BHAA 4S2TP 4FLJA 2GG8A 3S6BA 3MATA 4QR8A 2V3ZA 1W7VA 2Q96A 3BIPA 1PV9A 2BWSA 2P9AA 2HOWA 3FM3A 2GA2A 1C23A 2GGCA 1KQ9A 4IPAA 4JUQA 4U6ZA 1R5GA 2B3HA 3IU8A 2NQ6A 3L24A 5CIKA 2BWTA 1B59A 2BH3A 3D27A 3PKEA 1WBQA 4RGZ1 3RVAA 4ZWUA 1C21A 1WL6A 4S2RP 1XGOA 2MATA 2P98A 1B6AA 2EA2A 4IKSA 1Y1NA 2V3YA 4U75A 2BWXA 5CDLA 1XGSA 2BWWA 3CTZA 4EGEA 4PNCA 4U1BA 1YW7A 3PKDA 4PV4A 3IG4A 2GG7A 3TB5A 5JI6A 1BOAA 3MR1A 4FUKA 4U6JA 4ZWPA 2EVMA 1C24A 2BB7A 4FKCA 3L7GA 4IECA 5CDVA 2GG9A 4IDYA 1WLRA 1WY2A 2EVOA 3PKBA 1YW9A 4U70A 4U71A 1WL9A 1W2MA 4U73A 5FCHA 1QZYA 1QXYA 2BWYA 2GG2A 2G6PA 4IKTA 1QXZA 5FCFA 5JFRA 3CB5A 4FO8A 1XNZA 2Q93A 2IW2A 2GZ5A 2OAZA 3Q6DA 3RORA 1XGNA 4RZZA 1A16A 1C22A 1YVMA 5CE6A 4FLIA 4U6WA 3MX6A 2NQ7A 1CHMA 4U76A 4FLLA 4MATA 1JAWA 4FO7A 1R58A 1M35A 2GG0A 4U6CA 2Q8KA 2Q94A 4U69A 2BWUA 3IU9A 5CLSA 2BWVA 4ZWOA 1YJ3A 4HXXA 2EVCA 3TAVA 1BN5A 4Z7MA 2V3XA 2GU4A 1KQ0A 2BHDA 4IKRA 1C27A 4R60A 4S00A 4RZYA 2ADUA 2P99A 1XGMA 3IU7A 4ZNGA 4A6WA 1YW8A 2GGBA 1O0XA 1WKMA 2GG3A 5D6FA 3CB6A 2GU5A 1QXWA 4KM3A 2GG5A 4U6EA 5JHUA 5CNXA 3FMRA 4S01A 1N51A 5D6EA 4A6VA 2Q92A 4FLKA 4IF7A 1WN1A 3BIQA 2GU7A 2BHCA 2DFIA 3PKCA 2B3KA 1MATA 2BHBA 3BITA 2B3LA 2V6CA 1KP0A 3FMQA 2OKNA 2GTXA 4IKUA 1R5HA 3PKAA 4IU6A 4OOKA 5CDEA 2EA4A
chains in the Genus database with same CATH topology
4B28A 2BN7A 2GU6A 2Q95A 2ZSGA 5E5BA 2BHAA 4S2TP 4FLJA 2GG8A 3S6BA 3MATA 4QR8A 2V3ZA 1W7VA 2Q96A 3BIPA 1PV9A 2BWSA 2P9AA 2HOWA 3FM3A 2GA2A 1C23A 2GGCA 1KQ9A 4IPAA 4JUQA 4U6ZA 1R5GA 2B3HA 3IU8A 2NQ6A 3L24A 5CIKA 2BWTA 1B59A 2BH3A 3D27A 3PKEA 1WBQA 4RGZ1 3RVAA 4ZWUA 1C21A 1WL6A 4S2RP 1XGOA 2MATA 2P98A 1B6AA 2EA2A 4IKSA 1Y1NA 2V3YA 4U75A 2BWXA 5CDLA 1XGSA 2BWWA 3CTZA 4EGEA 4PNCA 4U1BA 1YW7A 3PKDA 4PV4A 3IG4A 2GG7A 3TB5A 5JI6A 1BOAA 3MR1A 4FUKA 4U6JA 4ZWPA 2EVMA 1C24A 2BB7A 4FKCA 3L7GA 4IECA 5CDVA 2GG9A 4IDYA 1WLRA 1WY2A 2EVOA 3PKBA 1YW9A 4U70A 4U71A 1WL9A 1W2MA 4U73A 5FCHA 1QZYA 1QXYA 2BWYA 2GG2A 2G6PA 4IKTA 1QXZA 5FCFA 5JFRA 3CB5A 4FO8A 1XNZA 2Q93A 2IW2A 2GZ5A 2OAZA 3Q6DA 3RORA 1XGNA 4RZZA 1A16A 1C22A 1YVMA 5CE6A 4FLIA 4U6WA 3MX6A 2NQ7A 1CHMA 4U76A 4FLLA 4MATA 1JAWA 4FO7A 1R58A 1M35A 2GG0A 4U6CA 2Q8KA 2Q94A 4U69A 2BWUA 3IU9A 5CLSA 2BWVA 4ZWOA 1YJ3A 4HXXA 2EVCA 3TAVA 1BN5A 4Z7MA 2V3XA 2GU4A 1KQ0A 2BHDA 4IKRA 1C27A 4R60A 4S00A 4RZYA 2ADUA 2P99A 1XGMA 3IU7A 4ZNGA 4A6WA 1YW8A 2GGBA 1O0XA 1WKMA 2GG3A 5D6FA 3CB6A 2GU5A 1QXWA 4KM3A 2GG5A 4U6EA 5JHUA 5CNXA 3FMRA 4S01A 1N51A 5D6EA 4A6VA 2Q92A 4FLKA 4IF7A 1WN1A 3BIQA 2GU7A 2BHCA 2DFIA 3PKCA 2B3KA 1MATA 2BHBA 3BITA 2B3LA 2V6CA 1KP0A 3FMQA 2OKNA 2GTXA 4IKUA 1R5HA 3PKAA 4IU6A 4OOKA 5CDEA 2EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B28 A;  2BN7 A;  2GU6 A;  2Q95 A;  2ZSG A;  5E5B A;  2BHA A;  4S2T P;  4FLJ A;  2GG8 A;  3S6B A;  3MAT A;  4QR8 A;  2V3Z A;  1W7V A;  2Q96 A;  3BIP A;  1PV9 A;  2BWS A;  2P9A A;  2HOW A;  3FM3 A;  2GA2 A;  1C23 A;  2GGC A;  1KQ9 A;  4IPA A;  4JUQ A;  4U6Z A;  1R5G A;  2B3H A;  3IU8 A;  2NQ6 A;  3L24 A;  5CIK A;  2BWT A;  1B59 A;  2BH3 A;  3D27 A;  3PKE A;  1WBQ A;  4RGZ 1;  3RVA A;  4ZWU A;  1C21 A;  1WL6 A;  4S2R P;  1XGO A;  2MAT A;  2P98 A;  1B6A A;  2EA2 A;  4IKS A;  1Y1N A;  2V3Y A;  4U75 A;  2BWX A;  5CDL A;  1XGS A;  2BWW A;  3CTZ A;  4EGE A;  4PNC A;  4U1B A;  1YW7 A;  3PKD A;  4PV4 A;  3IG4 A;  2GG7 A;  3TB5 A;  5JI6 A;  1BOA A;  3MR1 A;  4FUK A;  4U6J A;  4ZWP A;  2EVM A;  1C24 A;  2BB7 A;  4FKC A;  3L7G A;  4IEC A;  5CDV A;  2GG9 A;  4IDY A;  1WLR A;  1WY2 A;  2EVO A;  3PKB A;  1YW9 A;  4U70 A;  4U71 A;  1WL9 A;  1W2M A;  4U73 A;  5FCH A;  1QZY A;  1QXY A;  2BWY A;  2GG2 A;  2G6P A;  4IKT A;  1QXZ A;  5FCF A;  5JFR A;  3CB5 A;  4FO8 A;  1XNZ A;  2Q93 A;  2IW2 A;  2GZ5 A;  2OAZ A;  3Q6D A;  3ROR A;  1XGN A;  4RZZ A;  1A16 A;  1C22 A;  1YVM A;  5CE6 A;  4FLI A;  4U6W A;  3MX6 A;  2NQ7 A;  1CHM A;  4U76 A;  4FLL A;  4MAT A;  1JAW A;  4FO7 A;  1R58 A;  1M35 A;  2GG0 A;  4U6C A;  2Q8K A;  2Q94 A;  4U69 A;  2BWU A;  3IU9 A;  5CLS A;  2BWV A;  4ZWO A;  1YJ3 A;  4HXX A;  2EVC A;  3TAV A;  1BN5 A;  4Z7M A;  2V3X A;  2GU4 A;  1KQ0 A;  2BHD A;  4IKR A;  1C27 A;  4R60 A;  4S00 A;  4RZY A;  2ADU A;  2P99 A;  1XGM A;  3IU7 A;  4ZNG A;  4A6W A;  1YW8 A;  2GGB A;  1O0X A;  1WKM A;  2GG3 A;  5D6F A;  3CB6 A;  2GU5 A;  1QXW A;  4KM3 A;  2GG5 A;  4U6E A;  5JHU A;  5CNX A;  3FMR A;  4S01 A;  1N51 A;  5D6E A;  4A6V A;  2Q92 A;  4FLK A;  4IF7 A;  1WN1 A;  3BIQ A;  2GU7 A;  2BHC A;  2DFI A;  3PKC A;  2B3K A;  1MAT A;  2BHB A;  3BIT A;  2B3L A;  2V6C A;  1KP0 A;  3FMQ A;  2OKN A;  2GTX A;  4IKU A;  1R5H A;  3PKA A;  4IU6 A;  4OOK A;  5CDE A;  2EA4 A; 
#chains in the Genus database with same CATH topology
 4B28 A;  2BN7 A;  2GU6 A;  2Q95 A;  2ZSG A;  5E5B A;  2BHA A;  4S2T P;  4FLJ A;  2GG8 A;  3S6B A;  3MAT A;  4QR8 A;  2V3Z A;  1W7V A;  2Q96 A;  3BIP A;  1PV9 A;  2BWS A;  2P9A A;  2HOW A;  3FM3 A;  2GA2 A;  1C23 A;  2GGC A;  1KQ9 A;  4IPA A;  4JUQ A;  4U6Z A;  1R5G A;  2B3H A;  3IU8 A;  2NQ6 A;  3L24 A;  5CIK A;  2BWT A;  1B59 A;  2BH3 A;  3D27 A;  3PKE A;  1WBQ A;  4RGZ 1;  3RVA A;  4ZWU A;  1C21 A;  1WL6 A;  4S2R P;  1XGO A;  2MAT A;  2P98 A;  1B6A A;  2EA2 A;  4IKS A;  1Y1N A;  2V3Y A;  4U75 A;  2BWX A;  5CDL A;  1XGS A;  2BWW A;  3CTZ A;  4EGE A;  4PNC A;  4U1B A;  1YW7 A;  3PKD A;  4PV4 A;  3IG4 A;  2GG7 A;  3TB5 A;  5JI6 A;  1BOA A;  3MR1 A;  4FUK A;  4U6J A;  4ZWP A;  2EVM A;  1C24 A;  2BB7 A;  4FKC A;  3L7G A;  4IEC A;  5CDV A;  2GG9 A;  4IDY A;  1WLR A;  1WY2 A;  2EVO A;  3PKB A;  1YW9 A;  4U70 A;  4U71 A;  1WL9 A;  1W2M A;  4U73 A;  5FCH A;  1QZY A;  1QXY A;  2BWY A;  2GG2 A;  2G6P A;  4IKT A;  1QXZ A;  5FCF A;  5JFR A;  3CB5 A;  4FO8 A;  1XNZ A;  2Q93 A;  2IW2 A;  2GZ5 A;  2OAZ A;  3Q6D A;  3ROR A;  1XGN A;  4RZZ A;  1A16 A;  1C22 A;  1YVM A;  5CE6 A;  4FLI A;  4U6W A;  3MX6 A;  2NQ7 A;  1CHM A;  4U76 A;  4FLL A;  4MAT A;  1JAW A;  4FO7 A;  1R58 A;  1M35 A;  2GG0 A;  4U6C A;  2Q8K A;  2Q94 A;  4U69 A;  2BWU A;  3IU9 A;  5CLS A;  2BWV A;  4ZWO A;  1YJ3 A;  4HXX A;  2EVC A;  3TAV A;  1BN5 A;  4Z7M A;  2V3X A;  2GU4 A;  1KQ0 A;  2BHD A;  4IKR A;  1C27 A;  4R60 A;  4S00 A;  4RZY A;  2ADU A;  2P99 A;  1XGM A;  3IU7 A;  4ZNG A;  4A6W A;  1YW8 A;  2GGB A;  1O0X A;  1WKM A;  2GG3 A;  5D6F A;  3CB6 A;  2GU5 A;  1QXW A;  4KM3 A;  2GG5 A;  4U6E A;  5JHU A;  5CNX A;  3FMR A;  4S01 A;  1N51 A;  5D6E A;  4A6V A;  2Q92 A;  4FLK A;  4IF7 A;  1WN1 A;  3BIQ A;  2GU7 A;  2BHC A;  2DFI A;  3PKC A;  2B3K A;  1MAT A;  2BHB A;  3BIT A;  2B3L A;  2V6C A;  1KP0 A;  3FMQ A;  2OKN A;  2GTX A;  4IKU A;  1R5H A;  3PKA A;  4IU6 A;  4OOK A;  5CDE A;  2EA4 A; 
#chains in the Genus database with same CATH homology
 4B28 A;  2BN7 A;  2GU6 A;  2Q95 A;  2ZSG A;  5E5B A;  2BHA A;  4S2T P;  4FLJ A;  2GG8 A;  3S6B A;  3MAT A;  4QR8 A;  2V3Z A;  1W7V A;  2Q96 A;  3BIP A;  1PV9 A;  2BWS A;  2P9A A;  2HOW A;  3FM3 A;  2GA2 A;  1C23 A;  2GGC A;  1KQ9 A;  4IPA A;  4JUQ A;  4U6Z A;  1R5G A;  2B3H A;  3IU8 A;  2NQ6 A;  3L24 A;  5CIK A;  2BWT A;  1B59 A;  2BH3 A;  3D27 A;  3PKE A;  1WBQ A;  4RGZ 1;  3RVA A;  4ZWU A;  1C21 A;  1WL6 A;  4S2R P;  1XGO A;  2MAT A;  2P98 A;  1B6A A;  2EA2 A;  4IKS A;  1Y1N A;  2V3Y A;  4U75 A;  2BWX A;  5CDL A;  1XGS A;  2BWW A;  3CTZ A;  4EGE A;  4PNC A;  4U1B A;  1YW7 A;  3PKD A;  4PV4 A;  3IG4 A;  2GG7 A;  3TB5 A;  5JI6 A;  1BOA A;  3MR1 A;  4FUK A;  4U6J A;  4ZWP A;  2EVM A;  1C24 A;  2BB7 A;  4FKC A;  3L7G A;  4IEC A;  5CDV A;  2GG9 A;  4IDY A;  1WLR A;  1WY2 A;  2EVO A;  3PKB A;  1YW9 A;  4U70 A;  4U71 A;  1WL9 A;  1W2M A;  4U73 A;  5FCH A;  1QZY A;  1QXY A;  2BWY A;  2GG2 A;  2G6P A;  4IKT A;  1QXZ A;  5FCF A;  5JFR A;  3CB5 A;  4FO8 A;  1XNZ A;  2Q93 A;  2IW2 A;  2GZ5 A;  2OAZ A;  3Q6D A;  3ROR A;  1XGN A;  4RZZ A;  1A16 A;  1C22 A;  1YVM A;  5CE6 A;  4FLI A;  4U6W A;  3MX6 A;  2NQ7 A;  1CHM A;  4U76 A;  4FLL A;  4MAT A;  1JAW A;  4FO7 A;  1R58 A;  1M35 A;  2GG0 A;  4U6C A;  2Q8K A;  2Q94 A;  4U69 A;  2BWU A;  3IU9 A;  5CLS A;  2BWV A;  4ZWO A;  1YJ3 A;  4HXX A;  2EVC A;  3TAV A;  1BN5 A;  4Z7M A;  2V3X A;  2GU4 A;  1KQ0 A;  2BHD A;  4IKR A;  1C27 A;  4R60 A;  4S00 A;  4RZY A;  2ADU A;  2P99 A;  1XGM A;  3IU7 A;  4ZNG A;  4A6W A;  1YW8 A;  2GGB A;  1O0X A;  1WKM A;  2GG3 A;  5D6F A;  3CB6 A;  2GU5 A;  1QXW A;  4KM3 A;  2GG5 A;  4U6E A;  5JHU A;  5CNX A;  3FMR A;  4S01 A;  1N51 A;  5D6E A;  4A6V A;  2Q92 A;  4FLK A;  4IF7 A;  1WN1 A;  3BIQ A;  2GU7 A;  2BHC A;  2DFI A;  3PKC A;  2B3K A;  1MAT A;  2BHB A;  3BIT A;  2B3L A;  2V6C A;  1KP0 A;  3FMQ A;  2OKN A;  2GTX A;  4IKU A;  1R5H A;  3PKA A;  4IU6 A;  4OOK A;  5CDE A;  2EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...