4U71A

Hsmetap(f309m) in complex with 1- amino(cyclohexyl)methy)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u71A00
4MATA 2HOWA 3D27A 2GGCA 2GU6A 3MR1A 2BWXA 5CDEA 4U6JA 1W7VA 5CE6A 3CTZA 1XGMA 1C22A 2V3ZA 4PV4A 4U6EA 4U70A 4IDYA 4U73A 4RZYA 2EA4A 1WY2A 4B28A 1XGNA 2B3KA 2ZSGA 3PKDA 1CHMA 3IG4A 5E5BA 1B59A 4FUKA 2DFIA 2MATA 3FMQA 2Q96A 4U6WA 2G6PA 2P98A 4U71A 4IPAA 5FCFA 1M35A 1BN5A 3PKCA 4U76A 1XGOA 5CDVA 2IW2A 4A6VA 5D6FA 2GGBA 1YW8A 1QXZA 2GG3A 4U6ZA 2V3YA 2BHAA 2Q8KA 2ADUA 3RORA 4FKCA 2GU5A 1W2MA 2BWUA 1BOAA 4FO8A 5FCHA 4FLKA 5D6EA 1WN1A 2BB7A 1YVMA 4RGZ1 2BHCA 4IKRA 5CNXA 3BITA 4ZNGA 1JAWA 5JI6A 2GG2A 3IU7A 4U1BA 2EVOA 1O0XA 2GG7A 2OKNA 4IECA 1XNZA 2BWYA 3RVAA 5CDLA 2B3LA 1C27A 1A16A 2GG5A 3TAVA 3TB5A 3IU9A 1WL9A 2GA2A 2BN7A 2NQ6A 2GZ5A 5JHUA 4RZZA 1B6AA 2BWVA 1WKMA 3L24A 2V3XA 2GTXA 3IU8A 1QZYA 2BHBA 2Q93A 4Z7MA 1KP0A 4R60A 4U6CA 4KM3A 1WBQA 4IKTA 3BIPA 4U75A 4HXXA 2EA2A 2BWSA 2GG9A 2GG8A 4ZWOA 2BWWA 1C24A 2EVCA 5CLSA 1PV9A 3FMRA 4S01A 3CB5A 4FLLA 4IKUA 3MATA 1MATA 4FLIA 4ZWPA 1KQ9A 1Y1NA 3S6BA 4A6WA 2GU7A 2GU4A 4S00A 4IU6A 3L7GA 2V6CA 1XGSA 3PKBA 3Q6DA 2BHDA 2P99A 2OAZA 4ZWUA 2GG0A 2B3HA 2NQ7A 4S2TP 1YW9A 1R58A 4S2RP 1WLRA 2Q92A 1QXWA 4U69A 1R5GA 1R5HA 3BIQA 3PKAA 4IF7A 4QR8A 2EVMA 3CB6A 4IKSA 1YJ3A 1N51A 2BWTA 1YW7A 4JUQA 4PNCA 2Q95A 1QXYA 3FM3A 1WL6A 4FO7A 2BH3A 3PKEA 4FLJA 5CIKA 4EGEA 2Q94A 1C23A 1C21A 2P9AA 4OOKA 3MX6A 1KQ0A 5JFRA
chains in the Genus database with same CATH superfamily
4MATA 2HOWA 3D27A 2GGCA 2GU6A 3MR1A 2BWXA 5CDEA 4U6JA 1W7VA 5CE6A 3CTZA 1XGMA 1C22A 2V3ZA 4PV4A 4U6EA 4U70A 4IDYA 4U73A 4RZYA 2EA4A 1WY2A 4B28A 1XGNA 2B3KA 2ZSGA 3PKDA 1CHMA 3IG4A 5E5BA 1B59A 4FUKA 2DFIA 2MATA 3FMQA 2Q96A 4U6WA 2G6PA 2P98A 4U71A 4IPAA 5FCFA 1M35A 1BN5A 3PKCA 4U76A 1XGOA 5CDVA 2IW2A 4A6VA 5D6FA 2GGBA 1YW8A 1QXZA 2GG3A 4U6ZA 2V3YA 2BHAA 2Q8KA 2ADUA 3RORA 4FKCA 2GU5A 1W2MA 2BWUA 1BOAA 4FO8A 5FCHA 4FLKA 5D6EA 1WN1A 2BB7A 1YVMA 4RGZ1 2BHCA 4IKRA 5CNXA 3BITA 4ZNGA 1JAWA 5JI6A 2GG2A 3IU7A 4U1BA 2EVOA 1O0XA 2GG7A 2OKNA 4IECA 1XNZA 2BWYA 3RVAA 5CDLA 2B3LA 1C27A 1A16A 2GG5A 3TAVA 3TB5A 3IU9A 1WL9A 2GA2A 2BN7A 2NQ6A 2GZ5A 5JHUA 4RZZA 1B6AA 2BWVA 1WKMA 3L24A 2V3XA 2GTXA 3IU8A 1QZYA 2BHBA 2Q93A 4Z7MA 1KP0A 4R60A 4U6CA 4KM3A 1WBQA 4IKTA 3BIPA 4U75A 4HXXA 2EA2A 2BWSA 2GG9A 2GG8A 4ZWOA 2BWWA 1C24A 2EVCA 5CLSA 1PV9A 3FMRA 4S01A 3CB5A 4FLLA 4IKUA 3MATA 1MATA 4FLIA 4ZWPA 1KQ9A 1Y1NA 3S6BA 4A6WA 2GU7A 2GU4A 4S00A 4IU6A 3L7GA 2V6CA 1XGSA 3PKBA 3Q6DA 2BHDA 2P99A 2OAZA 4ZWUA 2GG0A 2B3HA 2NQ7A 4S2TP 1YW9A 1R58A 4S2RP 1WLRA 2Q92A 1QXWA 4U69A 1R5GA 1R5HA 3BIQA 3PKAA 4IF7A 4QR8A 2EVMA 3CB6A 4IKSA 1YJ3A 1N51A 2BWTA 1YW7A 4JUQA 4PNCA 2Q95A 1QXYA 3FM3A 1WL6A 4FO7A 2BH3A 3PKEA 4FLJA 5CIKA 4EGEA 2Q94A 1C23A 1C21A 2P9AA 4OOKA 3MX6A 1KQ0A 5JFRA
chains in the Genus database with same CATH topology
4MATA 2HOWA 3D27A 2GGCA 2GU6A 3MR1A 2BWXA 5CDEA 4U6JA 1W7VA 5CE6A 3CTZA 1XGMA 1C22A 2V3ZA 4PV4A 4U6EA 4U70A 4IDYA 4U73A 4RZYA 2EA4A 1WY2A 4B28A 1XGNA 2B3KA 2ZSGA 3PKDA 1CHMA 3IG4A 5E5BA 1B59A 4FUKA 2DFIA 2MATA 3FMQA 2Q96A 4U6WA 2G6PA 2P98A 4U71A 4IPAA 5FCFA 1M35A 1BN5A 3PKCA 4U76A 1XGOA 5CDVA 2IW2A 4A6VA 5D6FA 2GGBA 1YW8A 1QXZA 2GG3A 4U6ZA 2V3YA 2BHAA 2Q8KA 2ADUA 3RORA 4FKCA 2GU5A 1W2MA 2BWUA 1BOAA 4FO8A 5FCHA 4FLKA 5D6EA 1WN1A 2BB7A 1YVMA 4RGZ1 2BHCA 4IKRA 5CNXA 3BITA 4ZNGA 1JAWA 5JI6A 2GG2A 3IU7A 4U1BA 2EVOA 1O0XA 2GG7A 2OKNA 4IECA 1XNZA 2BWYA 3RVAA 5CDLA 2B3LA 1C27A 1A16A 2GG5A 3TAVA 3TB5A 3IU9A 1WL9A 2GA2A 2BN7A 2NQ6A 2GZ5A 5JHUA 4RZZA 1B6AA 2BWVA 1WKMA 3L24A 2V3XA 2GTXA 3IU8A 1QZYA 2BHBA 2Q93A 4Z7MA 1KP0A 4R60A 4U6CA 4KM3A 1WBQA 4IKTA 3BIPA 4U75A 4HXXA 2EA2A 2BWSA 2GG9A 2GG8A 4ZWOA 2BWWA 1C24A 2EVCA 5CLSA 1PV9A 3FMRA 4S01A 3CB5A 4FLLA 4IKUA 3MATA 1MATA 4FLIA 4ZWPA 1KQ9A 1Y1NA 3S6BA 4A6WA 2GU7A 2GU4A 4S00A 4IU6A 3L7GA 2V6CA 1XGSA 3PKBA 3Q6DA 2BHDA 2P99A 2OAZA 4ZWUA 2GG0A 2B3HA 2NQ7A 4S2TP 1YW9A 1R58A 4S2RP 1WLRA 2Q92A 1QXWA 4U69A 1R5GA 1R5HA 3BIQA 3PKAA 4IF7A 4QR8A 2EVMA 3CB6A 4IKSA 1YJ3A 1N51A 2BWTA 1YW7A 4JUQA 4PNCA 2Q95A 1QXYA 3FM3A 1WL6A 4FO7A 2BH3A 3PKEA 4FLJA 5CIKA 4EGEA 2Q94A 1C23A 1C21A 2P9AA 4OOKA 3MX6A 1KQ0A 5JFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAT A;  2HOW A;  3D27 A;  2GGC A;  2GU6 A;  3MR1 A;  2BWX A;  5CDE A;  4U6J A;  1W7V A;  5CE6 A;  3CTZ A;  1XGM A;  1C22 A;  2V3Z A;  4PV4 A;  4U6E A;  4U70 A;  4IDY A;  4U73 A;  4RZY A;  2EA4 A;  1WY2 A;  4B28 A;  1XGN A;  2B3K A;  2ZSG A;  3PKD A;  1CHM A;  3IG4 A;  5E5B A;  1B59 A;  4FUK A;  2DFI A;  2MAT A;  3FMQ A;  2Q96 A;  4U6W A;  2G6P A;  2P98 A;  4U71 A;  4IPA A;  5FCF A;  1M35 A;  1BN5 A;  3PKC A;  4U76 A;  1XGO A;  5CDV A;  2IW2 A;  4A6V A;  5D6F A;  2GGB A;  1YW8 A;  1QXZ A;  2GG3 A;  4U6Z A;  2V3Y A;  2BHA A;  2Q8K A;  2ADU A;  3ROR A;  4FKC A;  2GU5 A;  1W2M A;  2BWU A;  1BOA A;  4FO8 A;  5FCH A;  4FLK A;  5D6E A;  1WN1 A;  2BB7 A;  1YVM A;  4RGZ 1;  2BHC A;  4IKR A;  5CNX A;  3BIT A;  4ZNG A;  1JAW A;  5JI6 A;  2GG2 A;  3IU7 A;  4U1B A;  2EVO A;  1O0X A;  2GG7 A;  2OKN A;  4IEC A;  1XNZ A;  2BWY A;  3RVA A;  5CDL A;  2B3L A;  1C27 A;  1A16 A;  2GG5 A;  3TAV A;  3TB5 A;  3IU9 A;  1WL9 A;  2GA2 A;  2BN7 A;  2NQ6 A;  2GZ5 A;  5JHU A;  4RZZ A;  1B6A A;  2BWV A;  1WKM A;  3L24 A;  2V3X A;  2GTX A;  3IU8 A;  1QZY A;  2BHB A;  2Q93 A;  4Z7M A;  1KP0 A;  4R60 A;  4U6C A;  4KM3 A;  1WBQ A;  4IKT A;  3BIP A;  4U75 A;  4HXX A;  2EA2 A;  2BWS A;  2GG9 A;  2GG8 A;  4ZWO A;  2BWW A;  1C24 A;  2EVC A;  5CLS A;  1PV9 A;  3FMR A;  4S01 A;  3CB5 A;  4FLL A;  4IKU A;  3MAT A;  1MAT A;  4FLI A;  4ZWP A;  1KQ9 A;  1Y1N A;  3S6B A;  4A6W A;  2GU7 A;  2GU4 A;  4S00 A;  4IU6 A;  3L7G A;  2V6C A;  1XGS A;  3PKB A;  3Q6D A;  2BHD A;  2P99 A;  2OAZ A;  4ZWU A;  2GG0 A;  2B3H A;  2NQ7 A;  4S2T P;  1YW9 A;  1R58 A;  4S2R P;  1WLR A;  2Q92 A;  1QXW A;  4U69 A;  1R5G A;  1R5H A;  3BIQ A;  3PKA A;  4IF7 A;  4QR8 A;  2EVM A;  3CB6 A;  4IKS A;  1YJ3 A;  1N51 A;  2BWT A;  1YW7 A;  4JUQ A;  4PNC A;  2Q95 A;  1QXY A;  3FM3 A;  1WL6 A;  4FO7 A;  2BH3 A;  3PKE A;  4FLJ A;  5CIK A;  4EGE A;  2Q94 A;  1C23 A;  1C21 A;  2P9A A;  4OOK A;  3MX6 A;  1KQ0 A;  5JFR A; 
#chains in the Genus database with same CATH topology
 4MAT A;  2HOW A;  3D27 A;  2GGC A;  2GU6 A;  3MR1 A;  2BWX A;  5CDE A;  4U6J A;  1W7V A;  5CE6 A;  3CTZ A;  1XGM A;  1C22 A;  2V3Z A;  4PV4 A;  4U6E A;  4U70 A;  4IDY A;  4U73 A;  4RZY A;  2EA4 A;  1WY2 A;  4B28 A;  1XGN A;  2B3K A;  2ZSG A;  3PKD A;  1CHM A;  3IG4 A;  5E5B A;  1B59 A;  4FUK A;  2DFI A;  2MAT A;  3FMQ A;  2Q96 A;  4U6W A;  2G6P A;  2P98 A;  4U71 A;  4IPA A;  5FCF A;  1M35 A;  1BN5 A;  3PKC A;  4U76 A;  1XGO A;  5CDV A;  2IW2 A;  4A6V A;  5D6F A;  2GGB A;  1YW8 A;  1QXZ A;  2GG3 A;  4U6Z A;  2V3Y A;  2BHA A;  2Q8K A;  2ADU A;  3ROR A;  4FKC A;  2GU5 A;  1W2M A;  2BWU A;  1BOA A;  4FO8 A;  5FCH A;  4FLK A;  5D6E A;  1WN1 A;  2BB7 A;  1YVM A;  4RGZ 1;  2BHC A;  4IKR A;  5CNX A;  3BIT A;  4ZNG A;  1JAW A;  5JI6 A;  2GG2 A;  3IU7 A;  4U1B A;  2EVO A;  1O0X A;  2GG7 A;  2OKN A;  4IEC A;  1XNZ A;  2BWY A;  3RVA A;  5CDL A;  2B3L A;  1C27 A;  1A16 A;  2GG5 A;  3TAV A;  3TB5 A;  3IU9 A;  1WL9 A;  2GA2 A;  2BN7 A;  2NQ6 A;  2GZ5 A;  5JHU A;  4RZZ A;  1B6A A;  2BWV A;  1WKM A;  3L24 A;  2V3X A;  2GTX A;  3IU8 A;  1QZY A;  2BHB A;  2Q93 A;  4Z7M A;  1KP0 A;  4R60 A;  4U6C A;  4KM3 A;  1WBQ A;  4IKT A;  3BIP A;  4U75 A;  4HXX A;  2EA2 A;  2BWS A;  2GG9 A;  2GG8 A;  4ZWO A;  2BWW A;  1C24 A;  2EVC A;  5CLS A;  1PV9 A;  3FMR A;  4S01 A;  3CB5 A;  4FLL A;  4IKU A;  3MAT A;  1MAT A;  4FLI A;  4ZWP A;  1KQ9 A;  1Y1N A;  3S6B A;  4A6W A;  2GU7 A;  2GU4 A;  4S00 A;  4IU6 A;  3L7G A;  2V6C A;  1XGS A;  3PKB A;  3Q6D A;  2BHD A;  2P99 A;  2OAZ A;  4ZWU A;  2GG0 A;  2B3H A;  2NQ7 A;  4S2T P;  1YW9 A;  1R58 A;  4S2R P;  1WLR A;  2Q92 A;  1QXW A;  4U69 A;  1R5G A;  1R5H A;  3BIQ A;  3PKA A;  4IF7 A;  4QR8 A;  2EVM A;  3CB6 A;  4IKS A;  1YJ3 A;  1N51 A;  2BWT A;  1YW7 A;  4JUQ A;  4PNC A;  2Q95 A;  1QXY A;  3FM3 A;  1WL6 A;  4FO7 A;  2BH3 A;  3PKE A;  4FLJ A;  5CIK A;  4EGE A;  2Q94 A;  1C23 A;  1C21 A;  2P9A A;  4OOK A;  3MX6 A;  1KQ0 A;  5JFR A; 
#chains in the Genus database with same CATH homology
 4MAT A;  2HOW A;  3D27 A;  2GGC A;  2GU6 A;  3MR1 A;  2BWX A;  5CDE A;  4U6J A;  1W7V A;  5CE6 A;  3CTZ A;  1XGM A;  1C22 A;  2V3Z A;  4PV4 A;  4U6E A;  4U70 A;  4IDY A;  4U73 A;  4RZY A;  2EA4 A;  1WY2 A;  4B28 A;  1XGN A;  2B3K A;  2ZSG A;  3PKD A;  1CHM A;  3IG4 A;  5E5B A;  1B59 A;  4FUK A;  2DFI A;  2MAT A;  3FMQ A;  2Q96 A;  4U6W A;  2G6P A;  2P98 A;  4U71 A;  4IPA A;  5FCF A;  1M35 A;  1BN5 A;  3PKC A;  4U76 A;  1XGO A;  5CDV A;  2IW2 A;  4A6V A;  5D6F A;  2GGB A;  1YW8 A;  1QXZ A;  2GG3 A;  4U6Z A;  2V3Y A;  2BHA A;  2Q8K A;  2ADU A;  3ROR A;  4FKC A;  2GU5 A;  1W2M A;  2BWU A;  1BOA A;  4FO8 A;  5FCH A;  4FLK A;  5D6E A;  1WN1 A;  2BB7 A;  1YVM A;  4RGZ 1;  2BHC A;  4IKR A;  5CNX A;  3BIT A;  4ZNG A;  1JAW A;  5JI6 A;  2GG2 A;  3IU7 A;  4U1B A;  2EVO A;  1O0X A;  2GG7 A;  2OKN A;  4IEC A;  1XNZ A;  2BWY A;  3RVA A;  5CDL A;  2B3L A;  1C27 A;  1A16 A;  2GG5 A;  3TAV A;  3TB5 A;  3IU9 A;  1WL9 A;  2GA2 A;  2BN7 A;  2NQ6 A;  2GZ5 A;  5JHU A;  4RZZ A;  1B6A A;  2BWV A;  1WKM A;  3L24 A;  2V3X A;  2GTX A;  3IU8 A;  1QZY A;  2BHB A;  2Q93 A;  4Z7M A;  1KP0 A;  4R60 A;  4U6C A;  4KM3 A;  1WBQ A;  4IKT A;  3BIP A;  4U75 A;  4HXX A;  2EA2 A;  2BWS A;  2GG9 A;  2GG8 A;  4ZWO A;  2BWW A;  1C24 A;  2EVC A;  5CLS A;  1PV9 A;  3FMR A;  4S01 A;  3CB5 A;  4FLL A;  4IKU A;  3MAT A;  1MAT A;  4FLI A;  4ZWP A;  1KQ9 A;  1Y1N A;  3S6B A;  4A6W A;  2GU7 A;  2GU4 A;  4S00 A;  4IU6 A;  3L7G A;  2V6C A;  1XGS A;  3PKB A;  3Q6D A;  2BHD A;  2P99 A;  2OAZ A;  4ZWU A;  2GG0 A;  2B3H A;  2NQ7 A;  4S2T P;  1YW9 A;  1R58 A;  4S2R P;  1WLR A;  2Q92 A;  1QXW A;  4U69 A;  1R5G A;  1R5H A;  3BIQ A;  3PKA A;  4IF7 A;  4QR8 A;  2EVM A;  3CB6 A;  4IKS A;  1YJ3 A;  1N51 A;  2BWT A;  1YW7 A;  4JUQ A;  4PNC A;  2Q95 A;  1QXY A;  3FM3 A;  1WL6 A;  4FO7 A;  2BH3 A;  3PKE A;  4FLJ A;  5CIK A;  4EGE A;  2Q94 A;  1C23 A;  1C21 A;  2P9A A;  4OOK A;  3MX6 A;  1KQ0 A;  5JFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...