4U71A

Hsmetap(f309m) in complex with 1- amino(cyclohexyl)methy)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u71A00
3PKEA 4FLIA 4A6VA 3BIPA 3PKDA 1B6AA 1C21A 1KP0A 4RGZ1 1A16A 5D6FA 4U75A 4IKUA 3CB6A 1O0XA 3PKCA 4S2RP 1M35A 2Q92A 4FLLA 4Z7MA 2Q93A 5CLSA 5JFRA 3CB5A 4OOKA 2V3ZA 4FO8A 2BH3A 2BWUA 4IU6A 2GG0A 4U6JA 2BB7A 2BWSA 4U76A 1YVMA 1C23A 4IECA 1XGSA 4R60A 1B59A 2GZ5A 3FMQA 1WL9A 4JUQA 1C24A 5FCHA 1YJ3A 4FKCA 5FCFA 2G6PA 2GG5A 4ZWPA 1W2MA 4EGEA 4U6ZA 3FM3A 2B3LA 2EVMA 3L7GA 4MATA 1WY2A 2GG2A 4IDYA 3BITA 1W7VA 1YW8A 3RVAA 2B3KA 3MX6A 3TAVA 5E5BA 1WLRA 1CHMA 1XGMA 3MATA 2GU4A 1YW9A 3TB5A 2GU7A 1R58A 3D27A 1BOAA 4RZYA 2MATA 2BHAA 2BWYA 2NQ6A 1QXZA 2EVOA 4FO7A 5CDLA 4FLJA 1R5GA 2BHDA 4U70A 2DFIA 2BWVA 3S6BA 5JI6A 2GU6A 4FUKA 1PV9A 2GGBA 2GG8A 2EVCA 4HXXA 2NQ7A 4U73A 4B28A 3RORA 1JAWA 3CTZA 4S2TP 5CE6A 4S01A 4PV4A 2OAZA 1WKMA 2P99A 2B3HA 1WN1A 2BN7A 2Q95A 3Q6DA 1C27A 2GGCA 4U6WA 4U6CA 1KQ0A 2HOWA 5JHUA 1XGNA 1QXYA 2EA4A 2Q96A 3L24A 4IPAA 4FLKA 3FMRA 4QR8A 1KQ9A 3BIQA 4PNCA 5CIKA 1WBQA 1QZYA 2GG3A 4KM3A 2GTXA 4ZNGA 4U69A 2V6CA 3IG4A 4RZZA 1Y1NA 4ZWOA 5CDVA 4IKSA 2BWWA 1R5HA 2P9AA 2V3YA 2EA2A 5CNXA 2GG7A 4A6WA 2IW2A 4IKTA 2BWTA 2ADUA 1MATA 2BHBA 1BN5A 3PKBA 3IU7A 1WL6A 2GA2A 3IU8A 2BHCA 2Q94A 1C22A 2GU5A 3PKAA 1XGOA 4IKRA 5D6EA 1N51A 1YW7A 4S00A 2GG9A 4U71A 2ZSGA 4ZWUA 2Q8KA 4IF7A 2OKNA 3MR1A 5CDEA 1QXWA 4U1BA 3IU9A 4U6EA 2BWXA 1XNZA 2P98A 2V3XA
chains in the Genus database with same CATH superfamily
3PKEA 4FLIA 4A6VA 3BIPA 3PKDA 1B6AA 1C21A 1KP0A 4RGZ1 1A16A 5D6FA 4U75A 4IKUA 3CB6A 1O0XA 3PKCA 4S2RP 1M35A 2Q92A 4FLLA 4Z7MA 2Q93A 5CLSA 5JFRA 3CB5A 4OOKA 2V3ZA 4FO8A 2BH3A 2BWUA 4IU6A 2GG0A 4U6JA 2BB7A 2BWSA 4U76A 1YVMA 1C23A 4IECA 1XGSA 4R60A 1B59A 2GZ5A 3FMQA 1WL9A 4JUQA 1C24A 5FCHA 1YJ3A 4FKCA 5FCFA 2G6PA 2GG5A 4ZWPA 1W2MA 4EGEA 4U6ZA 3FM3A 2B3LA 2EVMA 3L7GA 4MATA 1WY2A 2GG2A 4IDYA 3BITA 1W7VA 1YW8A 3RVAA 2B3KA 3MX6A 3TAVA 5E5BA 1WLRA 1CHMA 1XGMA 3MATA 2GU4A 1YW9A 3TB5A 2GU7A 1R58A 3D27A 1BOAA 4RZYA 2MATA 2BHAA 2BWYA 2NQ6A 1QXZA 2EVOA 4FO7A 5CDLA 4FLJA 1R5GA 2BHDA 4U70A 2DFIA 2BWVA 3S6BA 5JI6A 2GU6A 4FUKA 1PV9A 2GGBA 2GG8A 2EVCA 4HXXA 2NQ7A 4U73A 4B28A 3RORA 1JAWA 3CTZA 4S2TP 5CE6A 4S01A 4PV4A 2OAZA 1WKMA 2P99A 2B3HA 1WN1A 2BN7A 2Q95A 3Q6DA 1C27A 2GGCA 4U6WA 4U6CA 1KQ0A 2HOWA 5JHUA 1XGNA 1QXYA 2EA4A 2Q96A 3L24A 4IPAA 4FLKA 3FMRA 4QR8A 1KQ9A 3BIQA 4PNCA 5CIKA 1WBQA 1QZYA 2GG3A 4KM3A 2GTXA 4ZNGA 4U69A 2V6CA 3IG4A 4RZZA 1Y1NA 4ZWOA 5CDVA 4IKSA 2BWWA 1R5HA 2P9AA 2V3YA 2EA2A 5CNXA 2GG7A 4A6WA 2IW2A 4IKTA 2BWTA 2ADUA 1MATA 2BHBA 1BN5A 3PKBA 3IU7A 1WL6A 2GA2A 3IU8A 2BHCA 2Q94A 1C22A 2GU5A 3PKAA 1XGOA 4IKRA 5D6EA 1N51A 1YW7A 4S00A 2GG9A 4U71A 2ZSGA 4ZWUA 2Q8KA 4IF7A 2OKNA 3MR1A 5CDEA 1QXWA 4U1BA 3IU9A 4U6EA 2BWXA 1XNZA 2P98A 2V3XA
chains in the Genus database with same CATH topology
3PKEA 4FLIA 4A6VA 3BIPA 3PKDA 1B6AA 1C21A 1KP0A 4RGZ1 1A16A 5D6FA 4U75A 4IKUA 3CB6A 1O0XA 3PKCA 4S2RP 1M35A 2Q92A 4FLLA 4Z7MA 2Q93A 5CLSA 5JFRA 3CB5A 4OOKA 2V3ZA 4FO8A 2BH3A 2BWUA 4IU6A 2GG0A 4U6JA 2BB7A 2BWSA 4U76A 1YVMA 1C23A 4IECA 1XGSA 4R60A 1B59A 2GZ5A 3FMQA 1WL9A 4JUQA 1C24A 5FCHA 1YJ3A 4FKCA 5FCFA 2G6PA 2GG5A 4ZWPA 1W2MA 4EGEA 4U6ZA 3FM3A 2B3LA 2EVMA 3L7GA 4MATA 1WY2A 2GG2A 4IDYA 3BITA 1W7VA 1YW8A 3RVAA 2B3KA 3MX6A 3TAVA 5E5BA 1WLRA 1CHMA 1XGMA 3MATA 2GU4A 1YW9A 3TB5A 2GU7A 1R58A 3D27A 1BOAA 4RZYA 2MATA 2BHAA 2BWYA 2NQ6A 1QXZA 2EVOA 4FO7A 5CDLA 4FLJA 1R5GA 2BHDA 4U70A 2DFIA 2BWVA 3S6BA 5JI6A 2GU6A 4FUKA 1PV9A 2GGBA 2GG8A 2EVCA 4HXXA 2NQ7A 4U73A 4B28A 3RORA 1JAWA 3CTZA 4S2TP 5CE6A 4S01A 4PV4A 2OAZA 1WKMA 2P99A 2B3HA 1WN1A 2BN7A 2Q95A 3Q6DA 1C27A 2GGCA 4U6WA 4U6CA 1KQ0A 2HOWA 5JHUA 1XGNA 1QXYA 2EA4A 2Q96A 3L24A 4IPAA 4FLKA 3FMRA 4QR8A 1KQ9A 3BIQA 4PNCA 5CIKA 1WBQA 1QZYA 2GG3A 4KM3A 2GTXA 4ZNGA 4U69A 2V6CA 3IG4A 4RZZA 1Y1NA 4ZWOA 5CDVA 4IKSA 2BWWA 1R5HA 2P9AA 2V3YA 2EA2A 5CNXA 2GG7A 4A6WA 2IW2A 4IKTA 2BWTA 2ADUA 1MATA 2BHBA 1BN5A 3PKBA 3IU7A 1WL6A 2GA2A 3IU8A 2BHCA 2Q94A 1C22A 2GU5A 3PKAA 1XGOA 4IKRA 5D6EA 1N51A 1YW7A 4S00A 2GG9A 4U71A 2ZSGA 4ZWUA 2Q8KA 4IF7A 2OKNA 3MR1A 5CDEA 1QXWA 4U1BA 3IU9A 4U6EA 2BWXA 1XNZA 2P98A 2V3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKE A;  4FLI A;  4A6V A;  3BIP A;  3PKD A;  1B6A A;  1C21 A;  1KP0 A;  4RGZ 1;  1A16 A;  5D6F A;  4U75 A;  4IKU A;  3CB6 A;  1O0X A;  3PKC A;  4S2R P;  1M35 A;  2Q92 A;  4FLL A;  4Z7M A;  2Q93 A;  5CLS A;  5JFR A;  3CB5 A;  4OOK A;  2V3Z A;  4FO8 A;  2BH3 A;  2BWU A;  4IU6 A;  2GG0 A;  4U6J A;  2BB7 A;  2BWS A;  4U76 A;  1YVM A;  1C23 A;  4IEC A;  1XGS A;  4R60 A;  1B59 A;  2GZ5 A;  3FMQ A;  1WL9 A;  4JUQ A;  1C24 A;  5FCH A;  1YJ3 A;  4FKC A;  5FCF A;  2G6P A;  2GG5 A;  4ZWP A;  1W2M A;  4EGE A;  4U6Z A;  3FM3 A;  2B3L A;  2EVM A;  3L7G A;  4MAT A;  1WY2 A;  2GG2 A;  4IDY A;  3BIT A;  1W7V A;  1YW8 A;  3RVA A;  2B3K A;  3MX6 A;  3TAV A;  5E5B A;  1WLR A;  1CHM A;  1XGM A;  3MAT A;  2GU4 A;  1YW9 A;  3TB5 A;  2GU7 A;  1R58 A;  3D27 A;  1BOA A;  4RZY A;  2MAT A;  2BHA A;  2BWY A;  2NQ6 A;  1QXZ A;  2EVO A;  4FO7 A;  5CDL A;  4FLJ A;  1R5G A;  2BHD A;  4U70 A;  2DFI A;  2BWV A;  3S6B A;  5JI6 A;  2GU6 A;  4FUK A;  1PV9 A;  2GGB A;  2GG8 A;  2EVC A;  4HXX A;  2NQ7 A;  4U73 A;  4B28 A;  3ROR A;  1JAW A;  3CTZ A;  4S2T P;  5CE6 A;  4S01 A;  4PV4 A;  2OAZ A;  1WKM A;  2P99 A;  2B3H A;  1WN1 A;  2BN7 A;  2Q95 A;  3Q6D A;  1C27 A;  2GGC A;  4U6W A;  4U6C A;  1KQ0 A;  2HOW A;  5JHU A;  1XGN A;  1QXY A;  2EA4 A;  2Q96 A;  3L24 A;  4IPA A;  4FLK A;  3FMR A;  4QR8 A;  1KQ9 A;  3BIQ A;  4PNC A;  5CIK A;  1WBQ A;  1QZY A;  2GG3 A;  4KM3 A;  2GTX A;  4ZNG A;  4U69 A;  2V6C A;  3IG4 A;  4RZZ A;  1Y1N A;  4ZWO A;  5CDV A;  4IKS A;  2BWW A;  1R5H A;  2P9A A;  2V3Y A;  2EA2 A;  5CNX A;  2GG7 A;  4A6W A;  2IW2 A;  4IKT A;  2BWT A;  2ADU A;  1MAT A;  2BHB A;  1BN5 A;  3PKB A;  3IU7 A;  1WL6 A;  2GA2 A;  3IU8 A;  2BHC A;  2Q94 A;  1C22 A;  2GU5 A;  3PKA A;  1XGO A;  4IKR A;  5D6E A;  1N51 A;  1YW7 A;  4S00 A;  2GG9 A;  4U71 A;  2ZSG A;  4ZWU A;  2Q8K A;  4IF7 A;  2OKN A;  3MR1 A;  5CDE A;  1QXW A;  4U1B A;  3IU9 A;  4U6E A;  2BWX A;  1XNZ A;  2P98 A;  2V3X A; 
#chains in the Genus database with same CATH topology
 3PKE A;  4FLI A;  4A6V A;  3BIP A;  3PKD A;  1B6A A;  1C21 A;  1KP0 A;  4RGZ 1;  1A16 A;  5D6F A;  4U75 A;  4IKU A;  3CB6 A;  1O0X A;  3PKC A;  4S2R P;  1M35 A;  2Q92 A;  4FLL A;  4Z7M A;  2Q93 A;  5CLS A;  5JFR A;  3CB5 A;  4OOK A;  2V3Z A;  4FO8 A;  2BH3 A;  2BWU A;  4IU6 A;  2GG0 A;  4U6J A;  2BB7 A;  2BWS A;  4U76 A;  1YVM A;  1C23 A;  4IEC A;  1XGS A;  4R60 A;  1B59 A;  2GZ5 A;  3FMQ A;  1WL9 A;  4JUQ A;  1C24 A;  5FCH A;  1YJ3 A;  4FKC A;  5FCF A;  2G6P A;  2GG5 A;  4ZWP A;  1W2M A;  4EGE A;  4U6Z A;  3FM3 A;  2B3L A;  2EVM A;  3L7G A;  4MAT A;  1WY2 A;  2GG2 A;  4IDY A;  3BIT A;  1W7V A;  1YW8 A;  3RVA A;  2B3K A;  3MX6 A;  3TAV A;  5E5B A;  1WLR A;  1CHM A;  1XGM A;  3MAT A;  2GU4 A;  1YW9 A;  3TB5 A;  2GU7 A;  1R58 A;  3D27 A;  1BOA A;  4RZY A;  2MAT A;  2BHA A;  2BWY A;  2NQ6 A;  1QXZ A;  2EVO A;  4FO7 A;  5CDL A;  4FLJ A;  1R5G A;  2BHD A;  4U70 A;  2DFI A;  2BWV A;  3S6B A;  5JI6 A;  2GU6 A;  4FUK A;  1PV9 A;  2GGB A;  2GG8 A;  2EVC A;  4HXX A;  2NQ7 A;  4U73 A;  4B28 A;  3ROR A;  1JAW A;  3CTZ A;  4S2T P;  5CE6 A;  4S01 A;  4PV4 A;  2OAZ A;  1WKM A;  2P99 A;  2B3H A;  1WN1 A;  2BN7 A;  2Q95 A;  3Q6D A;  1C27 A;  2GGC A;  4U6W A;  4U6C A;  1KQ0 A;  2HOW A;  5JHU A;  1XGN A;  1QXY A;  2EA4 A;  2Q96 A;  3L24 A;  4IPA A;  4FLK A;  3FMR A;  4QR8 A;  1KQ9 A;  3BIQ A;  4PNC A;  5CIK A;  1WBQ A;  1QZY A;  2GG3 A;  4KM3 A;  2GTX A;  4ZNG A;  4U69 A;  2V6C A;  3IG4 A;  4RZZ A;  1Y1N A;  4ZWO A;  5CDV A;  4IKS A;  2BWW A;  1R5H A;  2P9A A;  2V3Y A;  2EA2 A;  5CNX A;  2GG7 A;  4A6W A;  2IW2 A;  4IKT A;  2BWT A;  2ADU A;  1MAT A;  2BHB A;  1BN5 A;  3PKB A;  3IU7 A;  1WL6 A;  2GA2 A;  3IU8 A;  2BHC A;  2Q94 A;  1C22 A;  2GU5 A;  3PKA A;  1XGO A;  4IKR A;  5D6E A;  1N51 A;  1YW7 A;  4S00 A;  2GG9 A;  4U71 A;  2ZSG A;  4ZWU A;  2Q8K A;  4IF7 A;  2OKN A;  3MR1 A;  5CDE A;  1QXW A;  4U1B A;  3IU9 A;  4U6E A;  2BWX A;  1XNZ A;  2P98 A;  2V3X A; 
#chains in the Genus database with same CATH homology
 3PKE A;  4FLI A;  4A6V A;  3BIP A;  3PKD A;  1B6A A;  1C21 A;  1KP0 A;  4RGZ 1;  1A16 A;  5D6F A;  4U75 A;  4IKU A;  3CB6 A;  1O0X A;  3PKC A;  4S2R P;  1M35 A;  2Q92 A;  4FLL A;  4Z7M A;  2Q93 A;  5CLS A;  5JFR A;  3CB5 A;  4OOK A;  2V3Z A;  4FO8 A;  2BH3 A;  2BWU A;  4IU6 A;  2GG0 A;  4U6J A;  2BB7 A;  2BWS A;  4U76 A;  1YVM A;  1C23 A;  4IEC A;  1XGS A;  4R60 A;  1B59 A;  2GZ5 A;  3FMQ A;  1WL9 A;  4JUQ A;  1C24 A;  5FCH A;  1YJ3 A;  4FKC A;  5FCF A;  2G6P A;  2GG5 A;  4ZWP A;  1W2M A;  4EGE A;  4U6Z A;  3FM3 A;  2B3L A;  2EVM A;  3L7G A;  4MAT A;  1WY2 A;  2GG2 A;  4IDY A;  3BIT A;  1W7V A;  1YW8 A;  3RVA A;  2B3K A;  3MX6 A;  3TAV A;  5E5B A;  1WLR A;  1CHM A;  1XGM A;  3MAT A;  2GU4 A;  1YW9 A;  3TB5 A;  2GU7 A;  1R58 A;  3D27 A;  1BOA A;  4RZY A;  2MAT A;  2BHA A;  2BWY A;  2NQ6 A;  1QXZ A;  2EVO A;  4FO7 A;  5CDL A;  4FLJ A;  1R5G A;  2BHD A;  4U70 A;  2DFI A;  2BWV A;  3S6B A;  5JI6 A;  2GU6 A;  4FUK A;  1PV9 A;  2GGB A;  2GG8 A;  2EVC A;  4HXX A;  2NQ7 A;  4U73 A;  4B28 A;  3ROR A;  1JAW A;  3CTZ A;  4S2T P;  5CE6 A;  4S01 A;  4PV4 A;  2OAZ A;  1WKM A;  2P99 A;  2B3H A;  1WN1 A;  2BN7 A;  2Q95 A;  3Q6D A;  1C27 A;  2GGC A;  4U6W A;  4U6C A;  1KQ0 A;  2HOW A;  5JHU A;  1XGN A;  1QXY A;  2EA4 A;  2Q96 A;  3L24 A;  4IPA A;  4FLK A;  3FMR A;  4QR8 A;  1KQ9 A;  3BIQ A;  4PNC A;  5CIK A;  1WBQ A;  1QZY A;  2GG3 A;  4KM3 A;  2GTX A;  4ZNG A;  4U69 A;  2V6C A;  3IG4 A;  4RZZ A;  1Y1N A;  4ZWO A;  5CDV A;  4IKS A;  2BWW A;  1R5H A;  2P9A A;  2V3Y A;  2EA2 A;  5CNX A;  2GG7 A;  4A6W A;  2IW2 A;  4IKT A;  2BWT A;  2ADU A;  1MAT A;  2BHB A;  1BN5 A;  3PKB A;  3IU7 A;  1WL6 A;  2GA2 A;  3IU8 A;  2BHC A;  2Q94 A;  1C22 A;  2GU5 A;  3PKA A;  1XGO A;  4IKR A;  5D6E A;  1N51 A;  1YW7 A;  4S00 A;  2GG9 A;  4U71 A;  2ZSG A;  4ZWU A;  2Q8K A;  4IF7 A;  2OKN A;  3MR1 A;  5CDE A;  1QXW A;  4U1B A;  3IU9 A;  4U6E A;  2BWX A;  1XNZ A;  2P98 A;  2V3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...