4U71A

Hsmetap(f309m) in complex with 1- amino(cyclohexyl)methy)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u71A00
4MATA 3BITA 3MATA 2NQ7A 4IKTA 4A6WA 4PV4A 1WKMA 4R60A 4OOKA 5CIKA 4U1BA 4IDYA 2GU5A 1QXWA 3FM3A 1BN5A 1KP0A 2Q93A 4KM3A 4ZWOA 2B3KA 2GU6A 1KQ0A 4PNCA 2GG8A 4U76A 1PV9A 1MATA 3IU9A 2GGCA 1WL9A 4RGZ1 4S2RP 3CTZA 4U6JA 3RORA 2EVOA 2GZ5A 1XGNA 1CHMA 5D6EA 2B3HA 5FCFA 1N51A 2Q95A 1XNZA 4S01A 2EA4A 1O0XA 2V6CA 2BWUA 2GA2A 4U75A 4Z7MA 5JHUA 1BOAA 2GG9A 1C23A 1YW7A 5E5BA 2P98A 5FCHA 1C27A 2ZSGA 2BWVA 1W2MA 2BN7A 5CNXA 3PKBA 2BHDA 1M35A 3BIQA 1QXZA 1B6AA 1Y1NA 4FO8A 4U73A 3FMRA 2BWYA 4U6WA 4U70A 2OAZA 1QZYA 4FUKA 4IKSA 4QR8A 5D6FA 3S6BA 2GG3A 1XGMA 1W7VA 1YW8A 3IU8A 1YVMA 4HXXA 3TAVA 2GG0A 1C24A 5CDEA 3TB5A 2GG5A 3D27A 2BHCA 2GG7A 2ADUA 2GU7A 2V3ZA 3PKDA 4RZYA 2IW2A 2V3XA 3CB5A 4S2TP 2BWWA 2Q92A 1A16A 2EA2A 3L7GA 3PKEA 4FLKA 3RVAA 4FO7A 1YJ3A 4IPAA 4IECA 1XGSA 2BB7A 4ZNGA 4IKRA 2GU4A 4U6ZA 3PKAA 5CDVA 4A6VA 1C22A 1R58A 4FLJA 3MX6A 2P9AA 2B3LA 1YW9A 2EVMA 1KQ9A 4FLIA 2Q96A 1WL6A 1XGOA 2HOWA 4U71A 1WLRA 2GTXA 2BWXA 2DFIA 4IU6A 2BHBA 4B28A 1B59A 1R5HA 3IU7A 5CLSA 3PKCA 4U6EA 2Q8KA 2BHAA 4RZZA 5JFRA 2BWSA 5CE6A 5JI6A 1WN1A 2NQ6A 4IF7A 4U6CA 4IKUA 1WBQA 2P99A 3MR1A 2GG2A 3BIPA 4FKCA 2BWTA 1QXYA 1R5GA 1WY2A 3IG4A 4JUQA 3FMQA 2MATA 2OKNA 4ZWUA 4S00A 4ZWPA 3L24A 2BH3A 2Q94A 4FLLA 5CDLA 2G6PA 3Q6DA 3CB6A 4EGEA 2EVCA 2V3YA 1C21A 2GGBA 1JAWA 4U69A
chains in the Genus database with same CATH superfamily
4MATA 3BITA 3MATA 2NQ7A 4IKTA 4A6WA 4PV4A 1WKMA 4R60A 4OOKA 5CIKA 4U1BA 4IDYA 2GU5A 1QXWA 3FM3A 1BN5A 1KP0A 2Q93A 4KM3A 4ZWOA 2B3KA 2GU6A 1KQ0A 4PNCA 2GG8A 4U76A 1PV9A 1MATA 3IU9A 2GGCA 1WL9A 4RGZ1 4S2RP 3CTZA 4U6JA 3RORA 2EVOA 2GZ5A 1XGNA 1CHMA 5D6EA 2B3HA 5FCFA 1N51A 2Q95A 1XNZA 4S01A 2EA4A 1O0XA 2V6CA 2BWUA 2GA2A 4U75A 4Z7MA 5JHUA 1BOAA 2GG9A 1C23A 1YW7A 5E5BA 2P98A 5FCHA 1C27A 2ZSGA 2BWVA 1W2MA 2BN7A 5CNXA 3PKBA 2BHDA 1M35A 3BIQA 1QXZA 1B6AA 1Y1NA 4FO8A 4U73A 3FMRA 2BWYA 4U6WA 4U70A 2OAZA 1QZYA 4FUKA 4IKSA 4QR8A 5D6FA 3S6BA 2GG3A 1XGMA 1W7VA 1YW8A 3IU8A 1YVMA 4HXXA 3TAVA 2GG0A 1C24A 5CDEA 3TB5A 2GG5A 3D27A 2BHCA 2GG7A 2ADUA 2GU7A 2V3ZA 3PKDA 4RZYA 2IW2A 2V3XA 3CB5A 4S2TP 2BWWA 2Q92A 1A16A 2EA2A 3L7GA 3PKEA 4FLKA 3RVAA 4FO7A 1YJ3A 4IPAA 4IECA 1XGSA 2BB7A 4ZNGA 4IKRA 2GU4A 4U6ZA 3PKAA 5CDVA 4A6VA 1C22A 1R58A 4FLJA 3MX6A 2P9AA 2B3LA 1YW9A 2EVMA 1KQ9A 4FLIA 2Q96A 1WL6A 1XGOA 2HOWA 4U71A 1WLRA 2GTXA 2BWXA 2DFIA 4IU6A 2BHBA 4B28A 1B59A 1R5HA 3IU7A 5CLSA 3PKCA 4U6EA 2Q8KA 2BHAA 4RZZA 5JFRA 2BWSA 5CE6A 5JI6A 1WN1A 2NQ6A 4IF7A 4U6CA 4IKUA 1WBQA 2P99A 3MR1A 2GG2A 3BIPA 4FKCA 2BWTA 1QXYA 1R5GA 1WY2A 3IG4A 4JUQA 3FMQA 2MATA 2OKNA 4ZWUA 4S00A 4ZWPA 3L24A 2BH3A 2Q94A 4FLLA 5CDLA 2G6PA 3Q6DA 3CB6A 4EGEA 2EVCA 2V3YA 1C21A 2GGBA 1JAWA 4U69A
chains in the Genus database with same CATH topology
4MATA 3BITA 3MATA 2NQ7A 4IKTA 4A6WA 4PV4A 1WKMA 4R60A 4OOKA 5CIKA 4U1BA 4IDYA 2GU5A 1QXWA 3FM3A 1BN5A 1KP0A 2Q93A 4KM3A 4ZWOA 2B3KA 2GU6A 1KQ0A 4PNCA 2GG8A 4U76A 1PV9A 1MATA 3IU9A 2GGCA 1WL9A 4RGZ1 4S2RP 3CTZA 4U6JA 3RORA 2EVOA 2GZ5A 1XGNA 1CHMA 5D6EA 2B3HA 5FCFA 1N51A 2Q95A 1XNZA 4S01A 2EA4A 1O0XA 2V6CA 2BWUA 2GA2A 4U75A 4Z7MA 5JHUA 1BOAA 2GG9A 1C23A 1YW7A 5E5BA 2P98A 5FCHA 1C27A 2ZSGA 2BWVA 1W2MA 2BN7A 5CNXA 3PKBA 2BHDA 1M35A 3BIQA 1QXZA 1B6AA 1Y1NA 4FO8A 4U73A 3FMRA 2BWYA 4U6WA 4U70A 2OAZA 1QZYA 4FUKA 4IKSA 4QR8A 5D6FA 3S6BA 2GG3A 1XGMA 1W7VA 1YW8A 3IU8A 1YVMA 4HXXA 3TAVA 2GG0A 1C24A 5CDEA 3TB5A 2GG5A 3D27A 2BHCA 2GG7A 2ADUA 2GU7A 2V3ZA 3PKDA 4RZYA 2IW2A 2V3XA 3CB5A 4S2TP 2BWWA 2Q92A 1A16A 2EA2A 3L7GA 3PKEA 4FLKA 3RVAA 4FO7A 1YJ3A 4IPAA 4IECA 1XGSA 2BB7A 4ZNGA 4IKRA 2GU4A 4U6ZA 3PKAA 5CDVA 4A6VA 1C22A 1R58A 4FLJA 3MX6A 2P9AA 2B3LA 1YW9A 2EVMA 1KQ9A 4FLIA 2Q96A 1WL6A 1XGOA 2HOWA 4U71A 1WLRA 2GTXA 2BWXA 2DFIA 4IU6A 2BHBA 4B28A 1B59A 1R5HA 3IU7A 5CLSA 3PKCA 4U6EA 2Q8KA 2BHAA 4RZZA 5JFRA 2BWSA 5CE6A 5JI6A 1WN1A 2NQ6A 4IF7A 4U6CA 4IKUA 1WBQA 2P99A 3MR1A 2GG2A 3BIPA 4FKCA 2BWTA 1QXYA 1R5GA 1WY2A 3IG4A 4JUQA 3FMQA 2MATA 2OKNA 4ZWUA 4S00A 4ZWPA 3L24A 2BH3A 2Q94A 4FLLA 5CDLA 2G6PA 3Q6DA 3CB6A 4EGEA 2EVCA 2V3YA 1C21A 2GGBA 1JAWA 4U69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAT A;  3BIT A;  3MAT A;  2NQ7 A;  4IKT A;  4A6W A;  4PV4 A;  1WKM A;  4R60 A;  4OOK A;  5CIK A;  4U1B A;  4IDY A;  2GU5 A;  1QXW A;  3FM3 A;  1BN5 A;  1KP0 A;  2Q93 A;  4KM3 A;  4ZWO A;  2B3K A;  2GU6 A;  1KQ0 A;  4PNC A;  2GG8 A;  4U76 A;  1PV9 A;  1MAT A;  3IU9 A;  2GGC A;  1WL9 A;  4RGZ 1;  4S2R P;  3CTZ A;  4U6J A;  3ROR A;  2EVO A;  2GZ5 A;  1XGN A;  1CHM A;  5D6E A;  2B3H A;  5FCF A;  1N51 A;  2Q95 A;  1XNZ A;  4S01 A;  2EA4 A;  1O0X A;  2V6C A;  2BWU A;  2GA2 A;  4U75 A;  4Z7M A;  5JHU A;  1BOA A;  2GG9 A;  1C23 A;  1YW7 A;  5E5B A;  2P98 A;  5FCH A;  1C27 A;  2ZSG A;  2BWV A;  1W2M A;  2BN7 A;  5CNX A;  3PKB A;  2BHD A;  1M35 A;  3BIQ A;  1QXZ A;  1B6A A;  1Y1N A;  4FO8 A;  4U73 A;  3FMR A;  2BWY A;  4U6W A;  4U70 A;  2OAZ A;  1QZY A;  4FUK A;  4IKS A;  4QR8 A;  5D6F A;  3S6B A;  2GG3 A;  1XGM A;  1W7V A;  1YW8 A;  3IU8 A;  1YVM A;  4HXX A;  3TAV A;  2GG0 A;  1C24 A;  5CDE A;  3TB5 A;  2GG5 A;  3D27 A;  2BHC A;  2GG7 A;  2ADU A;  2GU7 A;  2V3Z A;  3PKD A;  4RZY A;  2IW2 A;  2V3X A;  3CB5 A;  4S2T P;  2BWW A;  2Q92 A;  1A16 A;  2EA2 A;  3L7G A;  3PKE A;  4FLK A;  3RVA A;  4FO7 A;  1YJ3 A;  4IPA A;  4IEC A;  1XGS A;  2BB7 A;  4ZNG A;  4IKR A;  2GU4 A;  4U6Z A;  3PKA A;  5CDV A;  4A6V A;  1C22 A;  1R58 A;  4FLJ A;  3MX6 A;  2P9A A;  2B3L A;  1YW9 A;  2EVM A;  1KQ9 A;  4FLI A;  2Q96 A;  1WL6 A;  1XGO A;  2HOW A;  4U71 A;  1WLR A;  2GTX A;  2BWX A;  2DFI A;  4IU6 A;  2BHB A;  4B28 A;  1B59 A;  1R5H A;  3IU7 A;  5CLS A;  3PKC A;  4U6E A;  2Q8K A;  2BHA A;  4RZZ A;  5JFR A;  2BWS A;  5CE6 A;  5JI6 A;  1WN1 A;  2NQ6 A;  4IF7 A;  4U6C A;  4IKU A;  1WBQ A;  2P99 A;  3MR1 A;  2GG2 A;  3BIP A;  4FKC A;  2BWT A;  1QXY A;  1R5G A;  1WY2 A;  3IG4 A;  4JUQ A;  3FMQ A;  2MAT A;  2OKN A;  4ZWU A;  4S00 A;  4ZWP A;  3L24 A;  2BH3 A;  2Q94 A;  4FLL A;  5CDL A;  2G6P A;  3Q6D A;  3CB6 A;  4EGE A;  2EVC A;  2V3Y A;  1C21 A;  2GGB A;  1JAW A;  4U69 A; 
#chains in the Genus database with same CATH topology
 4MAT A;  3BIT A;  3MAT A;  2NQ7 A;  4IKT A;  4A6W A;  4PV4 A;  1WKM A;  4R60 A;  4OOK A;  5CIK A;  4U1B A;  4IDY A;  2GU5 A;  1QXW A;  3FM3 A;  1BN5 A;  1KP0 A;  2Q93 A;  4KM3 A;  4ZWO A;  2B3K A;  2GU6 A;  1KQ0 A;  4PNC A;  2GG8 A;  4U76 A;  1PV9 A;  1MAT A;  3IU9 A;  2GGC A;  1WL9 A;  4RGZ 1;  4S2R P;  3CTZ A;  4U6J A;  3ROR A;  2EVO A;  2GZ5 A;  1XGN A;  1CHM A;  5D6E A;  2B3H A;  5FCF A;  1N51 A;  2Q95 A;  1XNZ A;  4S01 A;  2EA4 A;  1O0X A;  2V6C A;  2BWU A;  2GA2 A;  4U75 A;  4Z7M A;  5JHU A;  1BOA A;  2GG9 A;  1C23 A;  1YW7 A;  5E5B A;  2P98 A;  5FCH A;  1C27 A;  2ZSG A;  2BWV A;  1W2M A;  2BN7 A;  5CNX A;  3PKB A;  2BHD A;  1M35 A;  3BIQ A;  1QXZ A;  1B6A A;  1Y1N A;  4FO8 A;  4U73 A;  3FMR A;  2BWY A;  4U6W A;  4U70 A;  2OAZ A;  1QZY A;  4FUK A;  4IKS A;  4QR8 A;  5D6F A;  3S6B A;  2GG3 A;  1XGM A;  1W7V A;  1YW8 A;  3IU8 A;  1YVM A;  4HXX A;  3TAV A;  2GG0 A;  1C24 A;  5CDE A;  3TB5 A;  2GG5 A;  3D27 A;  2BHC A;  2GG7 A;  2ADU A;  2GU7 A;  2V3Z A;  3PKD A;  4RZY A;  2IW2 A;  2V3X A;  3CB5 A;  4S2T P;  2BWW A;  2Q92 A;  1A16 A;  2EA2 A;  3L7G A;  3PKE A;  4FLK A;  3RVA A;  4FO7 A;  1YJ3 A;  4IPA A;  4IEC A;  1XGS A;  2BB7 A;  4ZNG A;  4IKR A;  2GU4 A;  4U6Z A;  3PKA A;  5CDV A;  4A6V A;  1C22 A;  1R58 A;  4FLJ A;  3MX6 A;  2P9A A;  2B3L A;  1YW9 A;  2EVM A;  1KQ9 A;  4FLI A;  2Q96 A;  1WL6 A;  1XGO A;  2HOW A;  4U71 A;  1WLR A;  2GTX A;  2BWX A;  2DFI A;  4IU6 A;  2BHB A;  4B28 A;  1B59 A;  1R5H A;  3IU7 A;  5CLS A;  3PKC A;  4U6E A;  2Q8K A;  2BHA A;  4RZZ A;  5JFR A;  2BWS A;  5CE6 A;  5JI6 A;  1WN1 A;  2NQ6 A;  4IF7 A;  4U6C A;  4IKU A;  1WBQ A;  2P99 A;  3MR1 A;  2GG2 A;  3BIP A;  4FKC A;  2BWT A;  1QXY A;  1R5G A;  1WY2 A;  3IG4 A;  4JUQ A;  3FMQ A;  2MAT A;  2OKN A;  4ZWU A;  4S00 A;  4ZWP A;  3L24 A;  2BH3 A;  2Q94 A;  4FLL A;  5CDL A;  2G6P A;  3Q6D A;  3CB6 A;  4EGE A;  2EVC A;  2V3Y A;  1C21 A;  2GGB A;  1JAW A;  4U69 A; 
#chains in the Genus database with same CATH homology
 4MAT A;  3BIT A;  3MAT A;  2NQ7 A;  4IKT A;  4A6W A;  4PV4 A;  1WKM A;  4R60 A;  4OOK A;  5CIK A;  4U1B A;  4IDY A;  2GU5 A;  1QXW A;  3FM3 A;  1BN5 A;  1KP0 A;  2Q93 A;  4KM3 A;  4ZWO A;  2B3K A;  2GU6 A;  1KQ0 A;  4PNC A;  2GG8 A;  4U76 A;  1PV9 A;  1MAT A;  3IU9 A;  2GGC A;  1WL9 A;  4RGZ 1;  4S2R P;  3CTZ A;  4U6J A;  3ROR A;  2EVO A;  2GZ5 A;  1XGN A;  1CHM A;  5D6E A;  2B3H A;  5FCF A;  1N51 A;  2Q95 A;  1XNZ A;  4S01 A;  2EA4 A;  1O0X A;  2V6C A;  2BWU A;  2GA2 A;  4U75 A;  4Z7M A;  5JHU A;  1BOA A;  2GG9 A;  1C23 A;  1YW7 A;  5E5B A;  2P98 A;  5FCH A;  1C27 A;  2ZSG A;  2BWV A;  1W2M A;  2BN7 A;  5CNX A;  3PKB A;  2BHD A;  1M35 A;  3BIQ A;  1QXZ A;  1B6A A;  1Y1N A;  4FO8 A;  4U73 A;  3FMR A;  2BWY A;  4U6W A;  4U70 A;  2OAZ A;  1QZY A;  4FUK A;  4IKS A;  4QR8 A;  5D6F A;  3S6B A;  2GG3 A;  1XGM A;  1W7V A;  1YW8 A;  3IU8 A;  1YVM A;  4HXX A;  3TAV A;  2GG0 A;  1C24 A;  5CDE A;  3TB5 A;  2GG5 A;  3D27 A;  2BHC A;  2GG7 A;  2ADU A;  2GU7 A;  2V3Z A;  3PKD A;  4RZY A;  2IW2 A;  2V3X A;  3CB5 A;  4S2T P;  2BWW A;  2Q92 A;  1A16 A;  2EA2 A;  3L7G A;  3PKE A;  4FLK A;  3RVA A;  4FO7 A;  1YJ3 A;  4IPA A;  4IEC A;  1XGS A;  2BB7 A;  4ZNG A;  4IKR A;  2GU4 A;  4U6Z A;  3PKA A;  5CDV A;  4A6V A;  1C22 A;  1R58 A;  4FLJ A;  3MX6 A;  2P9A A;  2B3L A;  1YW9 A;  2EVM A;  1KQ9 A;  4FLI A;  2Q96 A;  1WL6 A;  1XGO A;  2HOW A;  4U71 A;  1WLR A;  2GTX A;  2BWX A;  2DFI A;  4IU6 A;  2BHB A;  4B28 A;  1B59 A;  1R5H A;  3IU7 A;  5CLS A;  3PKC A;  4U6E A;  2Q8K A;  2BHA A;  4RZZ A;  5JFR A;  2BWS A;  5CE6 A;  5JI6 A;  1WN1 A;  2NQ6 A;  4IF7 A;  4U6C A;  4IKU A;  1WBQ A;  2P99 A;  3MR1 A;  2GG2 A;  3BIP A;  4FKC A;  2BWT A;  1QXY A;  1R5G A;  1WY2 A;  3IG4 A;  4JUQ A;  3FMQ A;  2MAT A;  2OKN A;  4ZWU A;  4S00 A;  4ZWP A;  3L24 A;  2BH3 A;  2Q94 A;  4FLL A;  5CDL A;  2G6P A;  3Q6D A;  3CB6 A;  4EGE A;  2EVC A;  2V3Y A;  1C21 A;  2GGB A;  1JAW A;  4U69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...