4U71A

Hsmetap(f309m) in complex with 1- amino(cyclohexyl)methy)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u71A00
2GU5A 1C22A 2B3HA 3IG4A 4RZYA 4IU6A 3TAVA 1C21A 5D6EA 4FKCA 4IKUA 2MATA 5CNXA 3BIPA 1QXYA 4U6EA 1YW8A 4IKTA 1XGNA 3MR1A 2BWYA 4U6CA 2NQ6A 1WLRA 4S2TP 2GG7A 5JI6A 4IPAA 2V6CA 3FMRA 1WL6A 2BHDA 3L7GA 2BN7A 4PV4A 1W2MA 2EVOA 5CLSA 1XGOA 5D6FA 5CDVA 2EA2A 2Q95A 2BHBA 2GG2A 3IU9A 3L24A 4FUKA 4ZNGA 4ZWOA 2GG9A 4JUQA 4A6WA 4U1BA 5JFRA 3PKBA 2Q8KA 3RVAA 1MATA 1W7VA 4FO7A 4FO8A 3TB5A 2Q93A 4MATA 4U70A 5CDEA 4IKRA 1WL9A 1B6AA 2ADUA 2BWVA 2GA2A 1XNZA 1Y1NA 5CIKA 1BOAA 4S00A 1C24A 1M35A 1A16A 1YVMA 2OKNA 3IU7A 4HXXA 1YJ3A 1C23A 2GG8A 4U6ZA 2HOWA 2ZSGA 2NQ7A 2GG0A 3PKDA 4FLIA 4RZZA 1N51A 1WBQA 4S01A 2B3LA 4A6VA 1WKMA 2Q96A 1XGSA 4U73A 1WY2A 5E5BA 3FMQA 2IW2A 4FLJA 2EVMA 2GZ5A 4IKSA 2EVCA 5FCFA 4Z7MA 2BWSA 2DFIA 3FM3A 1QZYA 1QXZA 4FLKA 3CB5A 4U76A 4OOKA 2G6PA 4EGEA 4FLLA 4B28A 5CE6A 3BITA 4U71A 1R5GA 2GGCA 2B3KA 2BHCA 2Q94A 1JAWA 1B59A 2EA4A 2P98A 2P9AA 3MATA 1WN1A 4U69A 5FCHA 1YW7A 4R60A 4IF7A 1O0XA 1R5HA 2BH3A 2GU4A 3BIQA 3CTZA 4U6JA 4U75A 1XGMA 3PKAA 2BWUA 1QXWA 2GU7A 1PV9A 2V3YA 4IECA 2BHAA 4IDYA 4PNCA 1KQ9A 4QR8A 2BWTA 4ZWUA 2Q92A 3PKEA 2V3ZA 3CB6A 3MX6A 5JHUA 1KQ0A 3S6BA 2OAZA 4RGZ1 2BWXA 3PKCA 2GG3A 3IU8A 1CHMA 1KP0A 2V3XA 2GGBA 4U6WA 2P99A 3RORA 5CDLA 2GU6A 4S2RP 4ZWPA 1R58A 1YW9A 2BWWA 2GG5A 4KM3A 1C27A 2BB7A 3Q6DA 2GTXA 3D27A 1BN5A
chains in the Genus database with same CATH superfamily
2GU5A 1C22A 2B3HA 3IG4A 4RZYA 4IU6A 3TAVA 1C21A 5D6EA 4FKCA 4IKUA 2MATA 5CNXA 3BIPA 1QXYA 4U6EA 1YW8A 4IKTA 1XGNA 3MR1A 2BWYA 4U6CA 2NQ6A 1WLRA 4S2TP 2GG7A 5JI6A 4IPAA 2V6CA 3FMRA 1WL6A 2BHDA 3L7GA 2BN7A 4PV4A 1W2MA 2EVOA 5CLSA 1XGOA 5D6FA 5CDVA 2EA2A 2Q95A 2BHBA 2GG2A 3IU9A 3L24A 4FUKA 4ZNGA 4ZWOA 2GG9A 4JUQA 4A6WA 4U1BA 5JFRA 3PKBA 2Q8KA 3RVAA 1MATA 1W7VA 4FO7A 4FO8A 3TB5A 2Q93A 4MATA 4U70A 5CDEA 4IKRA 1WL9A 1B6AA 2ADUA 2BWVA 2GA2A 1XNZA 1Y1NA 5CIKA 1BOAA 4S00A 1C24A 1M35A 1A16A 1YVMA 2OKNA 3IU7A 4HXXA 1YJ3A 1C23A 2GG8A 4U6ZA 2HOWA 2ZSGA 2NQ7A 2GG0A 3PKDA 4FLIA 4RZZA 1N51A 1WBQA 4S01A 2B3LA 4A6VA 1WKMA 2Q96A 1XGSA 4U73A 1WY2A 5E5BA 3FMQA 2IW2A 4FLJA 2EVMA 2GZ5A 4IKSA 2EVCA 5FCFA 4Z7MA 2BWSA 2DFIA 3FM3A 1QZYA 1QXZA 4FLKA 3CB5A 4U76A 4OOKA 2G6PA 4EGEA 4FLLA 4B28A 5CE6A 3BITA 4U71A 1R5GA 2GGCA 2B3KA 2BHCA 2Q94A 1JAWA 1B59A 2EA4A 2P98A 2P9AA 3MATA 1WN1A 4U69A 5FCHA 1YW7A 4R60A 4IF7A 1O0XA 1R5HA 2BH3A 2GU4A 3BIQA 3CTZA 4U6JA 4U75A 1XGMA 3PKAA 2BWUA 1QXWA 2GU7A 1PV9A 2V3YA 4IECA 2BHAA 4IDYA 4PNCA 1KQ9A 4QR8A 2BWTA 4ZWUA 2Q92A 3PKEA 2V3ZA 3CB6A 3MX6A 5JHUA 1KQ0A 3S6BA 2OAZA 4RGZ1 2BWXA 3PKCA 2GG3A 3IU8A 1CHMA 1KP0A 2V3XA 2GGBA 4U6WA 2P99A 3RORA 5CDLA 2GU6A 4S2RP 4ZWPA 1R58A 1YW9A 2BWWA 2GG5A 4KM3A 1C27A 2BB7A 3Q6DA 2GTXA 3D27A 1BN5A
chains in the Genus database with same CATH topology
2GU5A 1C22A 2B3HA 3IG4A 4RZYA 4IU6A 3TAVA 1C21A 5D6EA 4FKCA 4IKUA 2MATA 5CNXA 3BIPA 1QXYA 4U6EA 1YW8A 4IKTA 1XGNA 3MR1A 2BWYA 4U6CA 2NQ6A 1WLRA 4S2TP 2GG7A 5JI6A 4IPAA 2V6CA 3FMRA 1WL6A 2BHDA 3L7GA 2BN7A 4PV4A 1W2MA 2EVOA 5CLSA 1XGOA 5D6FA 5CDVA 2EA2A 2Q95A 2BHBA 2GG2A 3IU9A 3L24A 4FUKA 4ZNGA 4ZWOA 2GG9A 4JUQA 4A6WA 4U1BA 5JFRA 3PKBA 2Q8KA 3RVAA 1MATA 1W7VA 4FO7A 4FO8A 3TB5A 2Q93A 4MATA 4U70A 5CDEA 4IKRA 1WL9A 1B6AA 2ADUA 2BWVA 2GA2A 1XNZA 1Y1NA 5CIKA 1BOAA 4S00A 1C24A 1M35A 1A16A 1YVMA 2OKNA 3IU7A 4HXXA 1YJ3A 1C23A 2GG8A 4U6ZA 2HOWA 2ZSGA 2NQ7A 2GG0A 3PKDA 4FLIA 4RZZA 1N51A 1WBQA 4S01A 2B3LA 4A6VA 1WKMA 2Q96A 1XGSA 4U73A 1WY2A 5E5BA 3FMQA 2IW2A 4FLJA 2EVMA 2GZ5A 4IKSA 2EVCA 5FCFA 4Z7MA 2BWSA 2DFIA 3FM3A 1QZYA 1QXZA 4FLKA 3CB5A 4U76A 4OOKA 2G6PA 4EGEA 4FLLA 4B28A 5CE6A 3BITA 4U71A 1R5GA 2GGCA 2B3KA 2BHCA 2Q94A 1JAWA 1B59A 2EA4A 2P98A 2P9AA 3MATA 1WN1A 4U69A 5FCHA 1YW7A 4R60A 4IF7A 1O0XA 1R5HA 2BH3A 2GU4A 3BIQA 3CTZA 4U6JA 4U75A 1XGMA 3PKAA 2BWUA 1QXWA 2GU7A 1PV9A 2V3YA 4IECA 2BHAA 4IDYA 4PNCA 1KQ9A 4QR8A 2BWTA 4ZWUA 2Q92A 3PKEA 2V3ZA 3CB6A 3MX6A 5JHUA 1KQ0A 3S6BA 2OAZA 4RGZ1 2BWXA 3PKCA 2GG3A 3IU8A 1CHMA 1KP0A 2V3XA 2GGBA 4U6WA 2P99A 3RORA 5CDLA 2GU6A 4S2RP 4ZWPA 1R58A 1YW9A 2BWWA 2GG5A 4KM3A 1C27A 2BB7A 3Q6DA 2GTXA 3D27A 1BN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU5 A;  1C22 A;  2B3H A;  3IG4 A;  4RZY A;  4IU6 A;  3TAV A;  1C21 A;  5D6E A;  4FKC A;  4IKU A;  2MAT A;  5CNX A;  3BIP A;  1QXY A;  4U6E A;  1YW8 A;  4IKT A;  1XGN A;  3MR1 A;  2BWY A;  4U6C A;  2NQ6 A;  1WLR A;  4S2T P;  2GG7 A;  5JI6 A;  4IPA A;  2V6C A;  3FMR A;  1WL6 A;  2BHD A;  3L7G A;  2BN7 A;  4PV4 A;  1W2M A;  2EVO A;  5CLS A;  1XGO A;  5D6F A;  5CDV A;  2EA2 A;  2Q95 A;  2BHB A;  2GG2 A;  3IU9 A;  3L24 A;  4FUK A;  4ZNG A;  4ZWO A;  2GG9 A;  4JUQ A;  4A6W A;  4U1B A;  5JFR A;  3PKB A;  2Q8K A;  3RVA A;  1MAT A;  1W7V A;  4FO7 A;  4FO8 A;  3TB5 A;  2Q93 A;  4MAT A;  4U70 A;  5CDE A;  4IKR A;  1WL9 A;  1B6A A;  2ADU A;  2BWV A;  2GA2 A;  1XNZ A;  1Y1N A;  5CIK A;  1BOA A;  4S00 A;  1C24 A;  1M35 A;  1A16 A;  1YVM A;  2OKN A;  3IU7 A;  4HXX A;  1YJ3 A;  1C23 A;  2GG8 A;  4U6Z A;  2HOW A;  2ZSG A;  2NQ7 A;  2GG0 A;  3PKD A;  4FLI A;  4RZZ A;  1N51 A;  1WBQ A;  4S01 A;  2B3L A;  4A6V A;  1WKM A;  2Q96 A;  1XGS A;  4U73 A;  1WY2 A;  5E5B A;  3FMQ A;  2IW2 A;  4FLJ A;  2EVM A;  2GZ5 A;  4IKS A;  2EVC A;  5FCF A;  4Z7M A;  2BWS A;  2DFI A;  3FM3 A;  1QZY A;  1QXZ A;  4FLK A;  3CB5 A;  4U76 A;  4OOK A;  2G6P A;  4EGE A;  4FLL A;  4B28 A;  5CE6 A;  3BIT A;  4U71 A;  1R5G A;  2GGC A;  2B3K A;  2BHC A;  2Q94 A;  1JAW A;  1B59 A;  2EA4 A;  2P98 A;  2P9A A;  3MAT A;  1WN1 A;  4U69 A;  5FCH A;  1YW7 A;  4R60 A;  4IF7 A;  1O0X A;  1R5H A;  2BH3 A;  2GU4 A;  3BIQ A;  3CTZ A;  4U6J A;  4U75 A;  1XGM A;  3PKA A;  2BWU A;  1QXW A;  2GU7 A;  1PV9 A;  2V3Y A;  4IEC A;  2BHA A;  4IDY A;  4PNC A;  1KQ9 A;  4QR8 A;  2BWT A;  4ZWU A;  2Q92 A;  3PKE A;  2V3Z A;  3CB6 A;  3MX6 A;  5JHU A;  1KQ0 A;  3S6B A;  2OAZ A;  4RGZ 1;  2BWX A;  3PKC A;  2GG3 A;  3IU8 A;  1CHM A;  1KP0 A;  2V3X A;  2GGB A;  4U6W A;  2P99 A;  3ROR A;  5CDL A;  2GU6 A;  4S2R P;  4ZWP A;  1R58 A;  1YW9 A;  2BWW A;  2GG5 A;  4KM3 A;  1C27 A;  2BB7 A;  3Q6D A;  2GTX A;  3D27 A;  1BN5 A; 
#chains in the Genus database with same CATH topology
 2GU5 A;  1C22 A;  2B3H A;  3IG4 A;  4RZY A;  4IU6 A;  3TAV A;  1C21 A;  5D6E A;  4FKC A;  4IKU A;  2MAT A;  5CNX A;  3BIP A;  1QXY A;  4U6E A;  1YW8 A;  4IKT A;  1XGN A;  3MR1 A;  2BWY A;  4U6C A;  2NQ6 A;  1WLR A;  4S2T P;  2GG7 A;  5JI6 A;  4IPA A;  2V6C A;  3FMR A;  1WL6 A;  2BHD A;  3L7G A;  2BN7 A;  4PV4 A;  1W2M A;  2EVO A;  5CLS A;  1XGO A;  5D6F A;  5CDV A;  2EA2 A;  2Q95 A;  2BHB A;  2GG2 A;  3IU9 A;  3L24 A;  4FUK A;  4ZNG A;  4ZWO A;  2GG9 A;  4JUQ A;  4A6W A;  4U1B A;  5JFR A;  3PKB A;  2Q8K A;  3RVA A;  1MAT A;  1W7V A;  4FO7 A;  4FO8 A;  3TB5 A;  2Q93 A;  4MAT A;  4U70 A;  5CDE A;  4IKR A;  1WL9 A;  1B6A A;  2ADU A;  2BWV A;  2GA2 A;  1XNZ A;  1Y1N A;  5CIK A;  1BOA A;  4S00 A;  1C24 A;  1M35 A;  1A16 A;  1YVM A;  2OKN A;  3IU7 A;  4HXX A;  1YJ3 A;  1C23 A;  2GG8 A;  4U6Z A;  2HOW A;  2ZSG A;  2NQ7 A;  2GG0 A;  3PKD A;  4FLI A;  4RZZ A;  1N51 A;  1WBQ A;  4S01 A;  2B3L A;  4A6V A;  1WKM A;  2Q96 A;  1XGS A;  4U73 A;  1WY2 A;  5E5B A;  3FMQ A;  2IW2 A;  4FLJ A;  2EVM A;  2GZ5 A;  4IKS A;  2EVC A;  5FCF A;  4Z7M A;  2BWS A;  2DFI A;  3FM3 A;  1QZY A;  1QXZ A;  4FLK A;  3CB5 A;  4U76 A;  4OOK A;  2G6P A;  4EGE A;  4FLL A;  4B28 A;  5CE6 A;  3BIT A;  4U71 A;  1R5G A;  2GGC A;  2B3K A;  2BHC A;  2Q94 A;  1JAW A;  1B59 A;  2EA4 A;  2P98 A;  2P9A A;  3MAT A;  1WN1 A;  4U69 A;  5FCH A;  1YW7 A;  4R60 A;  4IF7 A;  1O0X A;  1R5H A;  2BH3 A;  2GU4 A;  3BIQ A;  3CTZ A;  4U6J A;  4U75 A;  1XGM A;  3PKA A;  2BWU A;  1QXW A;  2GU7 A;  1PV9 A;  2V3Y A;  4IEC A;  2BHA A;  4IDY A;  4PNC A;  1KQ9 A;  4QR8 A;  2BWT A;  4ZWU A;  2Q92 A;  3PKE A;  2V3Z A;  3CB6 A;  3MX6 A;  5JHU A;  1KQ0 A;  3S6B A;  2OAZ A;  4RGZ 1;  2BWX A;  3PKC A;  2GG3 A;  3IU8 A;  1CHM A;  1KP0 A;  2V3X A;  2GGB A;  4U6W A;  2P99 A;  3ROR A;  5CDL A;  2GU6 A;  4S2R P;  4ZWP A;  1R58 A;  1YW9 A;  2BWW A;  2GG5 A;  4KM3 A;  1C27 A;  2BB7 A;  3Q6D A;  2GTX A;  3D27 A;  1BN5 A; 
#chains in the Genus database with same CATH homology
 2GU5 A;  1C22 A;  2B3H A;  3IG4 A;  4RZY A;  4IU6 A;  3TAV A;  1C21 A;  5D6E A;  4FKC A;  4IKU A;  2MAT A;  5CNX A;  3BIP A;  1QXY A;  4U6E A;  1YW8 A;  4IKT A;  1XGN A;  3MR1 A;  2BWY A;  4U6C A;  2NQ6 A;  1WLR A;  4S2T P;  2GG7 A;  5JI6 A;  4IPA A;  2V6C A;  3FMR A;  1WL6 A;  2BHD A;  3L7G A;  2BN7 A;  4PV4 A;  1W2M A;  2EVO A;  5CLS A;  1XGO A;  5D6F A;  5CDV A;  2EA2 A;  2Q95 A;  2BHB A;  2GG2 A;  3IU9 A;  3L24 A;  4FUK A;  4ZNG A;  4ZWO A;  2GG9 A;  4JUQ A;  4A6W A;  4U1B A;  5JFR A;  3PKB A;  2Q8K A;  3RVA A;  1MAT A;  1W7V A;  4FO7 A;  4FO8 A;  3TB5 A;  2Q93 A;  4MAT A;  4U70 A;  5CDE A;  4IKR A;  1WL9 A;  1B6A A;  2ADU A;  2BWV A;  2GA2 A;  1XNZ A;  1Y1N A;  5CIK A;  1BOA A;  4S00 A;  1C24 A;  1M35 A;  1A16 A;  1YVM A;  2OKN A;  3IU7 A;  4HXX A;  1YJ3 A;  1C23 A;  2GG8 A;  4U6Z A;  2HOW A;  2ZSG A;  2NQ7 A;  2GG0 A;  3PKD A;  4FLI A;  4RZZ A;  1N51 A;  1WBQ A;  4S01 A;  2B3L A;  4A6V A;  1WKM A;  2Q96 A;  1XGS A;  4U73 A;  1WY2 A;  5E5B A;  3FMQ A;  2IW2 A;  4FLJ A;  2EVM A;  2GZ5 A;  4IKS A;  2EVC A;  5FCF A;  4Z7M A;  2BWS A;  2DFI A;  3FM3 A;  1QZY A;  1QXZ A;  4FLK A;  3CB5 A;  4U76 A;  4OOK A;  2G6P A;  4EGE A;  4FLL A;  4B28 A;  5CE6 A;  3BIT A;  4U71 A;  1R5G A;  2GGC A;  2B3K A;  2BHC A;  2Q94 A;  1JAW A;  1B59 A;  2EA4 A;  2P98 A;  2P9A A;  3MAT A;  1WN1 A;  4U69 A;  5FCH A;  1YW7 A;  4R60 A;  4IF7 A;  1O0X A;  1R5H A;  2BH3 A;  2GU4 A;  3BIQ A;  3CTZ A;  4U6J A;  4U75 A;  1XGM A;  3PKA A;  2BWU A;  1QXW A;  2GU7 A;  1PV9 A;  2V3Y A;  4IEC A;  2BHA A;  4IDY A;  4PNC A;  1KQ9 A;  4QR8 A;  2BWT A;  4ZWU A;  2Q92 A;  3PKE A;  2V3Z A;  3CB6 A;  3MX6 A;  5JHU A;  1KQ0 A;  3S6B A;  2OAZ A;  4RGZ 1;  2BWX A;  3PKC A;  2GG3 A;  3IU8 A;  1CHM A;  1KP0 A;  2V3X A;  2GGB A;  4U6W A;  2P99 A;  3ROR A;  5CDL A;  2GU6 A;  4S2R P;  4ZWP A;  1R58 A;  1YW9 A;  2BWW A;  2GG5 A;  4KM3 A;  1C27 A;  2BB7 A;  3Q6D A;  2GTX A;  3D27 A;  1BN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...