4FLJA

Human metap1 with bengamide analog y08, in mn form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fljA00
2BHBA 2BN7A 2GU7A 3FM3A 2GTXA 4S2RP 5CIKA 1QXZA 5CDVA 2Q95A 4IPAA 2V3ZA 2BHDA 4FO8A 4EGEA 3CTZA 4ZWUA 1KP0A 5CDEA 3MR1A 1C24A 1C27A 2IW2A 2GG2A 1QXWA 2BB7A 1XGNA 4U73A 2B3LA 5CE6A 2V6CA 3IG4A 1KQ9A 4Z7MA 2EA2A 1KQ0A 4U6WA 5JFRA 2GA2A 4U70A 4QR8A 4U6EA 5JI6A 5D6EA 1CHMA 1WL9A 2MATA 4IKUA 2B3KA 1YJ3A 1A16A 2ZSGA 3MX6A 3BIQA 4ZNGA 2BHCA 2Q92A 4U6CA 3PKBA 4OOKA 3RORA 4PNCA 4FLIA 2GG5A 4FO7A 4S2TP 1B6AA 1YW9A 1BN5A 4R60A 4S01A 2P99A 1O0XA 1XGSA 5D6FA 3RVAA 2EVOA 5JHUA 4FUKA 2BWWA 4RGZ1 5CLSA 4IF7A 4RZZA 2P9AA 1Y1NA 5CNXA 3CB6A 4S00A 1XGMA 4KM3A 2BWSA 2GU4A 4IDYA 2GG0A 1BOAA 1WY2A 1WLRA 1PV9A 4U69A 2EVMA 2EA4A 2BH3A 2Q94A 4U71A 1WL6A 1R5HA 1W2MA 3PKEA 1QZYA 5FCFA 3IU7A 4A6WA 3S6BA 2GGBA 4IECA 3FMRA 2BWXA 3FMQA 3D27A 3TB5A 1YVMA 4U1BA 3IU9A 1R58A 2Q93A 2GU5A 1R5GA 5FCHA 2GG3A 2GU6A 2BWYA 1XGOA 4FLJA 5E5BA 4ZWOA 1WBQA 2DFIA 4U75A 4A6VA 4IKSA 1WKMA 4PV4A 2NQ7A 1QXYA 2GZ5A 2BHAA 3PKCA 4IKRA 2GG7A 1XNZA 2HOWA 2GG8A 2GG9A 3L24A 1N51A 2V3YA 2Q96A 3BIPA 1C23A 3PKDA 4HXXA 1B59A 4IU6A 2ADUA 1C21A 2OAZA 4RZYA 4B28A 4JUQA 4IKTA 3MATA 4U76A 2GGCA 3IU8A 3PKAA 4FLKA 4ZWPA 2B3HA 1MATA 2G6PA 1JAWA 2EVCA 4U6ZA 2P98A 1C22A 2OKNA 3L7GA 2BWVA 3TAVA 4FLLA 2V3XA 2Q8KA 1WN1A 5CDLA 3Q6DA 1YW7A 3BITA 3CB5A 4FKCA 2NQ6A 2BWTA 1YW8A 2BWUA 4MATA 4U6JA 1M35A 1W7VA
chains in the Genus database with same CATH superfamily
2BHBA 2BN7A 2GU7A 3FM3A 2GTXA 4S2RP 5CIKA 1QXZA 5CDVA 2Q95A 4IPAA 2V3ZA 2BHDA 4FO8A 4EGEA 3CTZA 4ZWUA 1KP0A 5CDEA 3MR1A 1C24A 1C27A 2IW2A 2GG2A 1QXWA 2BB7A 1XGNA 4U73A 2B3LA 5CE6A 2V6CA 3IG4A 1KQ9A 4Z7MA 2EA2A 1KQ0A 4U6WA 5JFRA 2GA2A 4U70A 4QR8A 4U6EA 5JI6A 5D6EA 1CHMA 1WL9A 2MATA 4IKUA 2B3KA 1YJ3A 1A16A 2ZSGA 3MX6A 3BIQA 4ZNGA 2BHCA 2Q92A 4U6CA 3PKBA 4OOKA 3RORA 4PNCA 4FLIA 2GG5A 4FO7A 4S2TP 1B6AA 1YW9A 1BN5A 4R60A 4S01A 2P99A 1O0XA 1XGSA 5D6FA 3RVAA 2EVOA 5JHUA 4FUKA 2BWWA 4RGZ1 5CLSA 4IF7A 4RZZA 2P9AA 1Y1NA 5CNXA 3CB6A 4S00A 1XGMA 4KM3A 2BWSA 2GU4A 4IDYA 2GG0A 1BOAA 1WY2A 1WLRA 1PV9A 4U69A 2EVMA 2EA4A 2BH3A 2Q94A 4U71A 1WL6A 1R5HA 1W2MA 3PKEA 1QZYA 5FCFA 3IU7A 4A6WA 3S6BA 2GGBA 4IECA 3FMRA 2BWXA 3FMQA 3D27A 3TB5A 1YVMA 4U1BA 3IU9A 1R58A 2Q93A 2GU5A 1R5GA 5FCHA 2GG3A 2GU6A 2BWYA 1XGOA 4FLJA 5E5BA 4ZWOA 1WBQA 2DFIA 4U75A 4A6VA 4IKSA 1WKMA 4PV4A 2NQ7A 1QXYA 2GZ5A 2BHAA 3PKCA 4IKRA 2GG7A 1XNZA 2HOWA 2GG8A 2GG9A 3L24A 1N51A 2V3YA 2Q96A 3BIPA 1C23A 3PKDA 4HXXA 1B59A 4IU6A 2ADUA 1C21A 2OAZA 4RZYA 4B28A 4JUQA 4IKTA 3MATA 4U76A 2GGCA 3IU8A 3PKAA 4FLKA 4ZWPA 2B3HA 1MATA 2G6PA 1JAWA 2EVCA 4U6ZA 2P98A 1C22A 2OKNA 3L7GA 2BWVA 3TAVA 4FLLA 2V3XA 2Q8KA 1WN1A 5CDLA 3Q6DA 1YW7A 3BITA 3CB5A 4FKCA 2NQ6A 2BWTA 1YW8A 2BWUA 4MATA 4U6JA 1M35A 1W7VA
chains in the Genus database with same CATH topology
2BHBA 2BN7A 2GU7A 3FM3A 2GTXA 4S2RP 5CIKA 1QXZA 5CDVA 2Q95A 4IPAA 2V3ZA 2BHDA 4FO8A 4EGEA 3CTZA 4ZWUA 1KP0A 5CDEA 3MR1A 1C24A 1C27A 2IW2A 2GG2A 1QXWA 2BB7A 1XGNA 4U73A 2B3LA 5CE6A 2V6CA 3IG4A 1KQ9A 4Z7MA 2EA2A 1KQ0A 4U6WA 5JFRA 2GA2A 4U70A 4QR8A 4U6EA 5JI6A 5D6EA 1CHMA 1WL9A 2MATA 4IKUA 2B3KA 1YJ3A 1A16A 2ZSGA 3MX6A 3BIQA 4ZNGA 2BHCA 2Q92A 4U6CA 3PKBA 4OOKA 3RORA 4PNCA 4FLIA 2GG5A 4FO7A 4S2TP 1B6AA 1YW9A 1BN5A 4R60A 4S01A 2P99A 1O0XA 1XGSA 5D6FA 3RVAA 2EVOA 5JHUA 4FUKA 2BWWA 4RGZ1 5CLSA 4IF7A 4RZZA 2P9AA 1Y1NA 5CNXA 3CB6A 4S00A 1XGMA 4KM3A 2BWSA 2GU4A 4IDYA 2GG0A 1BOAA 1WY2A 1WLRA 1PV9A 4U69A 2EVMA 2EA4A 2BH3A 2Q94A 4U71A 1WL6A 1R5HA 1W2MA 3PKEA 1QZYA 5FCFA 3IU7A 4A6WA 3S6BA 2GGBA 4IECA 3FMRA 2BWXA 3FMQA 3D27A 3TB5A 1YVMA 4U1BA 3IU9A 1R58A 2Q93A 2GU5A 1R5GA 5FCHA 2GG3A 2GU6A 2BWYA 1XGOA 4FLJA 5E5BA 4ZWOA 1WBQA 2DFIA 4U75A 4A6VA 4IKSA 1WKMA 4PV4A 2NQ7A 1QXYA 2GZ5A 2BHAA 3PKCA 4IKRA 2GG7A 1XNZA 2HOWA 2GG8A 2GG9A 3L24A 1N51A 2V3YA 2Q96A 3BIPA 1C23A 3PKDA 4HXXA 1B59A 4IU6A 2ADUA 1C21A 2OAZA 4RZYA 4B28A 4JUQA 4IKTA 3MATA 4U76A 2GGCA 3IU8A 3PKAA 4FLKA 4ZWPA 2B3HA 1MATA 2G6PA 1JAWA 2EVCA 4U6ZA 2P98A 1C22A 2OKNA 3L7GA 2BWVA 3TAVA 4FLLA 2V3XA 2Q8KA 1WN1A 5CDLA 3Q6DA 1YW7A 3BITA 3CB5A 4FKCA 2NQ6A 2BWTA 1YW8A 2BWUA 4MATA 4U6JA 1M35A 1W7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHB A;  2BN7 A;  2GU7 A;  3FM3 A;  2GTX A;  4S2R P;  5CIK A;  1QXZ A;  5CDV A;  2Q95 A;  4IPA A;  2V3Z A;  2BHD A;  4FO8 A;  4EGE A;  3CTZ A;  4ZWU A;  1KP0 A;  5CDE A;  3MR1 A;  1C24 A;  1C27 A;  2IW2 A;  2GG2 A;  1QXW A;  2BB7 A;  1XGN A;  4U73 A;  2B3L A;  5CE6 A;  2V6C A;  3IG4 A;  1KQ9 A;  4Z7M A;  2EA2 A;  1KQ0 A;  4U6W A;  5JFR A;  2GA2 A;  4U70 A;  4QR8 A;  4U6E A;  5JI6 A;  5D6E A;  1CHM A;  1WL9 A;  2MAT A;  4IKU A;  2B3K A;  1YJ3 A;  1A16 A;  2ZSG A;  3MX6 A;  3BIQ A;  4ZNG A;  2BHC A;  2Q92 A;  4U6C A;  3PKB A;  4OOK A;  3ROR A;  4PNC A;  4FLI A;  2GG5 A;  4FO7 A;  4S2T P;  1B6A A;  1YW9 A;  1BN5 A;  4R60 A;  4S01 A;  2P99 A;  1O0X A;  1XGS A;  5D6F A;  3RVA A;  2EVO A;  5JHU A;  4FUK A;  2BWW A;  4RGZ 1;  5CLS A;  4IF7 A;  4RZZ A;  2P9A A;  1Y1N A;  5CNX A;  3CB6 A;  4S00 A;  1XGM A;  4KM3 A;  2BWS A;  2GU4 A;  4IDY A;  2GG0 A;  1BOA A;  1WY2 A;  1WLR A;  1PV9 A;  4U69 A;  2EVM A;  2EA4 A;  2BH3 A;  2Q94 A;  4U71 A;  1WL6 A;  1R5H A;  1W2M A;  3PKE A;  1QZY A;  5FCF A;  3IU7 A;  4A6W A;  3S6B A;  2GGB A;  4IEC A;  3FMR A;  2BWX A;  3FMQ A;  3D27 A;  3TB5 A;  1YVM A;  4U1B A;  3IU9 A;  1R58 A;  2Q93 A;  2GU5 A;  1R5G A;  5FCH A;  2GG3 A;  2GU6 A;  2BWY A;  1XGO A;  4FLJ A;  5E5B A;  4ZWO A;  1WBQ A;  2DFI A;  4U75 A;  4A6V A;  4IKS A;  1WKM A;  4PV4 A;  2NQ7 A;  1QXY A;  2GZ5 A;  2BHA A;  3PKC A;  4IKR A;  2GG7 A;  1XNZ A;  2HOW A;  2GG8 A;  2GG9 A;  3L24 A;  1N51 A;  2V3Y A;  2Q96 A;  3BIP A;  1C23 A;  3PKD A;  4HXX A;  1B59 A;  4IU6 A;  2ADU A;  1C21 A;  2OAZ A;  4RZY A;  4B28 A;  4JUQ A;  4IKT A;  3MAT A;  4U76 A;  2GGC A;  3IU8 A;  3PKA A;  4FLK A;  4ZWP A;  2B3H A;  1MAT A;  2G6P A;  1JAW A;  2EVC A;  4U6Z A;  2P98 A;  1C22 A;  2OKN A;  3L7G A;  2BWV A;  3TAV A;  4FLL A;  2V3X A;  2Q8K A;  1WN1 A;  5CDL A;  3Q6D A;  1YW7 A;  3BIT A;  3CB5 A;  4FKC A;  2NQ6 A;  2BWT A;  1YW8 A;  2BWU A;  4MAT A;  4U6J A;  1M35 A;  1W7V A; 
#chains in the Genus database with same CATH topology
 2BHB A;  2BN7 A;  2GU7 A;  3FM3 A;  2GTX A;  4S2R P;  5CIK A;  1QXZ A;  5CDV A;  2Q95 A;  4IPA A;  2V3Z A;  2BHD A;  4FO8 A;  4EGE A;  3CTZ A;  4ZWU A;  1KP0 A;  5CDE A;  3MR1 A;  1C24 A;  1C27 A;  2IW2 A;  2GG2 A;  1QXW A;  2BB7 A;  1XGN A;  4U73 A;  2B3L A;  5CE6 A;  2V6C A;  3IG4 A;  1KQ9 A;  4Z7M A;  2EA2 A;  1KQ0 A;  4U6W A;  5JFR A;  2GA2 A;  4U70 A;  4QR8 A;  4U6E A;  5JI6 A;  5D6E A;  1CHM A;  1WL9 A;  2MAT A;  4IKU A;  2B3K A;  1YJ3 A;  1A16 A;  2ZSG A;  3MX6 A;  3BIQ A;  4ZNG A;  2BHC A;  2Q92 A;  4U6C A;  3PKB A;  4OOK A;  3ROR A;  4PNC A;  4FLI A;  2GG5 A;  4FO7 A;  4S2T P;  1B6A A;  1YW9 A;  1BN5 A;  4R60 A;  4S01 A;  2P99 A;  1O0X A;  1XGS A;  5D6F A;  3RVA A;  2EVO A;  5JHU A;  4FUK A;  2BWW A;  4RGZ 1;  5CLS A;  4IF7 A;  4RZZ A;  2P9A A;  1Y1N A;  5CNX A;  3CB6 A;  4S00 A;  1XGM A;  4KM3 A;  2BWS A;  2GU4 A;  4IDY A;  2GG0 A;  1BOA A;  1WY2 A;  1WLR A;  1PV9 A;  4U69 A;  2EVM A;  2EA4 A;  2BH3 A;  2Q94 A;  4U71 A;  1WL6 A;  1R5H A;  1W2M A;  3PKE A;  1QZY A;  5FCF A;  3IU7 A;  4A6W A;  3S6B A;  2GGB A;  4IEC A;  3FMR A;  2BWX A;  3FMQ A;  3D27 A;  3TB5 A;  1YVM A;  4U1B A;  3IU9 A;  1R58 A;  2Q93 A;  2GU5 A;  1R5G A;  5FCH A;  2GG3 A;  2GU6 A;  2BWY A;  1XGO A;  4FLJ A;  5E5B A;  4ZWO A;  1WBQ A;  2DFI A;  4U75 A;  4A6V A;  4IKS A;  1WKM A;  4PV4 A;  2NQ7 A;  1QXY A;  2GZ5 A;  2BHA A;  3PKC A;  4IKR A;  2GG7 A;  1XNZ A;  2HOW A;  2GG8 A;  2GG9 A;  3L24 A;  1N51 A;  2V3Y A;  2Q96 A;  3BIP A;  1C23 A;  3PKD A;  4HXX A;  1B59 A;  4IU6 A;  2ADU A;  1C21 A;  2OAZ A;  4RZY A;  4B28 A;  4JUQ A;  4IKT A;  3MAT A;  4U76 A;  2GGC A;  3IU8 A;  3PKA A;  4FLK A;  4ZWP A;  2B3H A;  1MAT A;  2G6P A;  1JAW A;  2EVC A;  4U6Z A;  2P98 A;  1C22 A;  2OKN A;  3L7G A;  2BWV A;  3TAV A;  4FLL A;  2V3X A;  2Q8K A;  1WN1 A;  5CDL A;  3Q6D A;  1YW7 A;  3BIT A;  3CB5 A;  4FKC A;  2NQ6 A;  2BWT A;  1YW8 A;  2BWU A;  4MAT A;  4U6J A;  1M35 A;  1W7V A; 
#chains in the Genus database with same CATH homology
 2BHB A;  2BN7 A;  2GU7 A;  3FM3 A;  2GTX A;  4S2R P;  5CIK A;  1QXZ A;  5CDV A;  2Q95 A;  4IPA A;  2V3Z A;  2BHD A;  4FO8 A;  4EGE A;  3CTZ A;  4ZWU A;  1KP0 A;  5CDE A;  3MR1 A;  1C24 A;  1C27 A;  2IW2 A;  2GG2 A;  1QXW A;  2BB7 A;  1XGN A;  4U73 A;  2B3L A;  5CE6 A;  2V6C A;  3IG4 A;  1KQ9 A;  4Z7M A;  2EA2 A;  1KQ0 A;  4U6W A;  5JFR A;  2GA2 A;  4U70 A;  4QR8 A;  4U6E A;  5JI6 A;  5D6E A;  1CHM A;  1WL9 A;  2MAT A;  4IKU A;  2B3K A;  1YJ3 A;  1A16 A;  2ZSG A;  3MX6 A;  3BIQ A;  4ZNG A;  2BHC A;  2Q92 A;  4U6C A;  3PKB A;  4OOK A;  3ROR A;  4PNC A;  4FLI A;  2GG5 A;  4FO7 A;  4S2T P;  1B6A A;  1YW9 A;  1BN5 A;  4R60 A;  4S01 A;  2P99 A;  1O0X A;  1XGS A;  5D6F A;  3RVA A;  2EVO A;  5JHU A;  4FUK A;  2BWW A;  4RGZ 1;  5CLS A;  4IF7 A;  4RZZ A;  2P9A A;  1Y1N A;  5CNX A;  3CB6 A;  4S00 A;  1XGM A;  4KM3 A;  2BWS A;  2GU4 A;  4IDY A;  2GG0 A;  1BOA A;  1WY2 A;  1WLR A;  1PV9 A;  4U69 A;  2EVM A;  2EA4 A;  2BH3 A;  2Q94 A;  4U71 A;  1WL6 A;  1R5H A;  1W2M A;  3PKE A;  1QZY A;  5FCF A;  3IU7 A;  4A6W A;  3S6B A;  2GGB A;  4IEC A;  3FMR A;  2BWX A;  3FMQ A;  3D27 A;  3TB5 A;  1YVM A;  4U1B A;  3IU9 A;  1R58 A;  2Q93 A;  2GU5 A;  1R5G A;  5FCH A;  2GG3 A;  2GU6 A;  2BWY A;  1XGO A;  4FLJ A;  5E5B A;  4ZWO A;  1WBQ A;  2DFI A;  4U75 A;  4A6V A;  4IKS A;  1WKM A;  4PV4 A;  2NQ7 A;  1QXY A;  2GZ5 A;  2BHA A;  3PKC A;  4IKR A;  2GG7 A;  1XNZ A;  2HOW A;  2GG8 A;  2GG9 A;  3L24 A;  1N51 A;  2V3Y A;  2Q96 A;  3BIP A;  1C23 A;  3PKD A;  4HXX A;  1B59 A;  4IU6 A;  2ADU A;  1C21 A;  2OAZ A;  4RZY A;  4B28 A;  4JUQ A;  4IKT A;  3MAT A;  4U76 A;  2GGC A;  3IU8 A;  3PKA A;  4FLK A;  4ZWP A;  2B3H A;  1MAT A;  2G6P A;  1JAW A;  2EVC A;  4U6Z A;  2P98 A;  1C22 A;  2OKN A;  3L7G A;  2BWV A;  3TAV A;  4FLL A;  2V3X A;  2Q8K A;  1WN1 A;  5CDL A;  3Q6D A;  1YW7 A;  3BIT A;  3CB5 A;  4FKC A;  2NQ6 A;  2BWT A;  1YW8 A;  2BWU A;  4MAT A;  4U6J A;  1M35 A;  1W7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...