4FLJA

Human metap1 with bengamide analog y08, in mn form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fljA00
3RORA 3PKEA 1A16A 1BOAA 4A6WA 1YW7A 2EA4A 1W2MA 2BWSA 2BWWA 2GG0A 2BWTA 1XGNA 1B6AA 1R5GA 4R60A 4U6CA 5CDVA 2Q92A 2GGCA 3IU9A 5JI6A 4IKRA 2GA2A 4A6VA 1QXWA 1KQ0A 4U76A 4PNCA 2P99A 4U69A 4U6ZA 5CLSA 2V3ZA 5JHUA 4KM3A 1YVMA 1WLRA 2HOWA 1PV9A 1YW9A 3MATA 2BN7A 2B3HA 1JAWA 1QZYA 5CIKA 2DFIA 5D6FA 2GG3A 1XGSA 3RVAA 4U75A 2B3KA 4B28A 1N51A 1BN5A 3D27A 1C23A 1Y1NA 2MATA 1KP0A 1WN1A 4OOKA 4S2RP 2V3YA 5CDLA 3MR1A 1C21A 5CNXA 2BH3A 3IU7A 4RGZ1 5CE6A 4ZNGA 3TAVA 2EVMA 2GZ5A 4IKTA 2Q95A 2GU7A 2OAZA 3IU8A 3CB6A 3L24A 2EA2A 4IDYA 2GG5A 4S01A 4U6EA 3S6BA 4IECA 2G6PA 2EVOA 2IW2A 1W7VA 3PKCA 1O0XA 1YW8A 4FLIA 4IKUA 3FMQA 4FUKA 2BHAA 3IG4A 4ZWPA 2GU6A 4FKCA 4IKSA 1CHMA 3BIPA 2B3LA 3TB5A 3L7GA 1WY2A 1QXZA 1XNZA 4IF7A 3CB5A 2V6CA 2BWVA 2GG2A 1WKMA 1M35A 2GG9A 4EGEA 4RZYA 4U6WA 2BB7A 2BWUA 2EVCA 3Q6DA 2NQ6A 1C24A 2Q8KA 2BHBA 2NQ7A 4PV4A 1XGOA 2GU5A 1QXYA 4S2TP 3FM3A 4Z7MA 2V3XA 2BHDA 2GTXA 1C22A 3CTZA 5JFRA 4U6JA 4U1BA 4IU6A 2BHCA 2Q94A 2ZSGA 3FMRA 3PKDA 4FLKA 4ZWOA 2Q93A 2GG8A 2OKNA 3PKBA 2BWXA 1B59A 1XGMA 2GG7A 4FLLA 4JUQA 1WL9A 4U71A 3BIQA 1C27A 4FLJA 1MATA 4RZZA 5E5BA 3PKAA 4MATA 1WBQA 2Q96A 4HXXA 3BITA 2GGBA 5FCFA 5FCHA 1YJ3A 4IPAA 2ADUA 4QR8A 4U70A 1KQ9A 4ZWUA 1R5HA 2BWYA 2P98A 1R58A 4U73A 3MX6A 5D6EA 2GU4A 4FO7A 5CDEA 2P9AA 4S00A 1WL6A 4FO8A
chains in the Genus database with same CATH superfamily
3RORA 3PKEA 1A16A 1BOAA 4A6WA 1YW7A 2EA4A 1W2MA 2BWSA 2BWWA 2GG0A 2BWTA 1XGNA 1B6AA 1R5GA 4R60A 4U6CA 5CDVA 2Q92A 2GGCA 3IU9A 5JI6A 4IKRA 2GA2A 4A6VA 1QXWA 1KQ0A 4U76A 4PNCA 2P99A 4U69A 4U6ZA 5CLSA 2V3ZA 5JHUA 4KM3A 1YVMA 1WLRA 2HOWA 1PV9A 1YW9A 3MATA 2BN7A 2B3HA 1JAWA 1QZYA 5CIKA 2DFIA 5D6FA 2GG3A 1XGSA 3RVAA 4U75A 2B3KA 4B28A 1N51A 1BN5A 3D27A 1C23A 1Y1NA 2MATA 1KP0A 1WN1A 4OOKA 4S2RP 2V3YA 5CDLA 3MR1A 1C21A 5CNXA 2BH3A 3IU7A 4RGZ1 5CE6A 4ZNGA 3TAVA 2EVMA 2GZ5A 4IKTA 2Q95A 2GU7A 2OAZA 3IU8A 3CB6A 3L24A 2EA2A 4IDYA 2GG5A 4S01A 4U6EA 3S6BA 4IECA 2G6PA 2EVOA 2IW2A 1W7VA 3PKCA 1O0XA 1YW8A 4FLIA 4IKUA 3FMQA 4FUKA 2BHAA 3IG4A 4ZWPA 2GU6A 4FKCA 4IKSA 1CHMA 3BIPA 2B3LA 3TB5A 3L7GA 1WY2A 1QXZA 1XNZA 4IF7A 3CB5A 2V6CA 2BWVA 2GG2A 1WKMA 1M35A 2GG9A 4EGEA 4RZYA 4U6WA 2BB7A 2BWUA 2EVCA 3Q6DA 2NQ6A 1C24A 2Q8KA 2BHBA 2NQ7A 4PV4A 1XGOA 2GU5A 1QXYA 4S2TP 3FM3A 4Z7MA 2V3XA 2BHDA 2GTXA 1C22A 3CTZA 5JFRA 4U6JA 4U1BA 4IU6A 2BHCA 2Q94A 2ZSGA 3FMRA 3PKDA 4FLKA 4ZWOA 2Q93A 2GG8A 2OKNA 3PKBA 2BWXA 1B59A 1XGMA 2GG7A 4FLLA 4JUQA 1WL9A 4U71A 3BIQA 1C27A 4FLJA 1MATA 4RZZA 5E5BA 3PKAA 4MATA 1WBQA 2Q96A 4HXXA 3BITA 2GGBA 5FCFA 5FCHA 1YJ3A 4IPAA 2ADUA 4QR8A 4U70A 1KQ9A 4ZWUA 1R5HA 2BWYA 2P98A 1R58A 4U73A 3MX6A 5D6EA 2GU4A 4FO7A 5CDEA 2P9AA 4S00A 1WL6A 4FO8A
chains in the Genus database with same CATH topology
3RORA 3PKEA 1A16A 1BOAA 4A6WA 1YW7A 2EA4A 1W2MA 2BWSA 2BWWA 2GG0A 2BWTA 1XGNA 1B6AA 1R5GA 4R60A 4U6CA 5CDVA 2Q92A 2GGCA 3IU9A 5JI6A 4IKRA 2GA2A 4A6VA 1QXWA 1KQ0A 4U76A 4PNCA 2P99A 4U69A 4U6ZA 5CLSA 2V3ZA 5JHUA 4KM3A 1YVMA 1WLRA 2HOWA 1PV9A 1YW9A 3MATA 2BN7A 2B3HA 1JAWA 1QZYA 5CIKA 2DFIA 5D6FA 2GG3A 1XGSA 3RVAA 4U75A 2B3KA 4B28A 1N51A 1BN5A 3D27A 1C23A 1Y1NA 2MATA 1KP0A 1WN1A 4OOKA 4S2RP 2V3YA 5CDLA 3MR1A 1C21A 5CNXA 2BH3A 3IU7A 4RGZ1 5CE6A 4ZNGA 3TAVA 2EVMA 2GZ5A 4IKTA 2Q95A 2GU7A 2OAZA 3IU8A 3CB6A 3L24A 2EA2A 4IDYA 2GG5A 4S01A 4U6EA 3S6BA 4IECA 2G6PA 2EVOA 2IW2A 1W7VA 3PKCA 1O0XA 1YW8A 4FLIA 4IKUA 3FMQA 4FUKA 2BHAA 3IG4A 4ZWPA 2GU6A 4FKCA 4IKSA 1CHMA 3BIPA 2B3LA 3TB5A 3L7GA 1WY2A 1QXZA 1XNZA 4IF7A 3CB5A 2V6CA 2BWVA 2GG2A 1WKMA 1M35A 2GG9A 4EGEA 4RZYA 4U6WA 2BB7A 2BWUA 2EVCA 3Q6DA 2NQ6A 1C24A 2Q8KA 2BHBA 2NQ7A 4PV4A 1XGOA 2GU5A 1QXYA 4S2TP 3FM3A 4Z7MA 2V3XA 2BHDA 2GTXA 1C22A 3CTZA 5JFRA 4U6JA 4U1BA 4IU6A 2BHCA 2Q94A 2ZSGA 3FMRA 3PKDA 4FLKA 4ZWOA 2Q93A 2GG8A 2OKNA 3PKBA 2BWXA 1B59A 1XGMA 2GG7A 4FLLA 4JUQA 1WL9A 4U71A 3BIQA 1C27A 4FLJA 1MATA 4RZZA 5E5BA 3PKAA 4MATA 1WBQA 2Q96A 4HXXA 3BITA 2GGBA 5FCFA 5FCHA 1YJ3A 4IPAA 2ADUA 4QR8A 4U70A 1KQ9A 4ZWUA 1R5HA 2BWYA 2P98A 1R58A 4U73A 3MX6A 5D6EA 2GU4A 4FO7A 5CDEA 2P9AA 4S00A 1WL6A 4FO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ROR A;  3PKE A;  1A16 A;  1BOA A;  4A6W A;  1YW7 A;  2EA4 A;  1W2M A;  2BWS A;  2BWW A;  2GG0 A;  2BWT A;  1XGN A;  1B6A A;  1R5G A;  4R60 A;  4U6C A;  5CDV A;  2Q92 A;  2GGC A;  3IU9 A;  5JI6 A;  4IKR A;  2GA2 A;  4A6V A;  1QXW A;  1KQ0 A;  4U76 A;  4PNC A;  2P99 A;  4U69 A;  4U6Z A;  5CLS A;  2V3Z A;  5JHU A;  4KM3 A;  1YVM A;  1WLR A;  2HOW A;  1PV9 A;  1YW9 A;  3MAT A;  2BN7 A;  2B3H A;  1JAW A;  1QZY A;  5CIK A;  2DFI A;  5D6F A;  2GG3 A;  1XGS A;  3RVA A;  4U75 A;  2B3K A;  4B28 A;  1N51 A;  1BN5 A;  3D27 A;  1C23 A;  1Y1N A;  2MAT A;  1KP0 A;  1WN1 A;  4OOK A;  4S2R P;  2V3Y A;  5CDL A;  3MR1 A;  1C21 A;  5CNX A;  2BH3 A;  3IU7 A;  4RGZ 1;  5CE6 A;  4ZNG A;  3TAV A;  2EVM A;  2GZ5 A;  4IKT A;  2Q95 A;  2GU7 A;  2OAZ A;  3IU8 A;  3CB6 A;  3L24 A;  2EA2 A;  4IDY A;  2GG5 A;  4S01 A;  4U6E A;  3S6B A;  4IEC A;  2G6P A;  2EVO A;  2IW2 A;  1W7V A;  3PKC A;  1O0X A;  1YW8 A;  4FLI A;  4IKU A;  3FMQ A;  4FUK A;  2BHA A;  3IG4 A;  4ZWP A;  2GU6 A;  4FKC A;  4IKS A;  1CHM A;  3BIP A;  2B3L A;  3TB5 A;  3L7G A;  1WY2 A;  1QXZ A;  1XNZ A;  4IF7 A;  3CB5 A;  2V6C A;  2BWV A;  2GG2 A;  1WKM A;  1M35 A;  2GG9 A;  4EGE A;  4RZY A;  4U6W A;  2BB7 A;  2BWU A;  2EVC A;  3Q6D A;  2NQ6 A;  1C24 A;  2Q8K A;  2BHB A;  2NQ7 A;  4PV4 A;  1XGO A;  2GU5 A;  1QXY A;  4S2T P;  3FM3 A;  4Z7M A;  2V3X A;  2BHD A;  2GTX A;  1C22 A;  3CTZ A;  5JFR A;  4U6J A;  4U1B A;  4IU6 A;  2BHC A;  2Q94 A;  2ZSG A;  3FMR A;  3PKD A;  4FLK A;  4ZWO A;  2Q93 A;  2GG8 A;  2OKN A;  3PKB A;  2BWX A;  1B59 A;  1XGM A;  2GG7 A;  4FLL A;  4JUQ A;  1WL9 A;  4U71 A;  3BIQ A;  1C27 A;  4FLJ A;  1MAT A;  4RZZ A;  5E5B A;  3PKA A;  4MAT A;  1WBQ A;  2Q96 A;  4HXX A;  3BIT A;  2GGB A;  5FCF A;  5FCH A;  1YJ3 A;  4IPA A;  2ADU A;  4QR8 A;  4U70 A;  1KQ9 A;  4ZWU A;  1R5H A;  2BWY A;  2P98 A;  1R58 A;  4U73 A;  3MX6 A;  5D6E A;  2GU4 A;  4FO7 A;  5CDE A;  2P9A A;  4S00 A;  1WL6 A;  4FO8 A; 
#chains in the Genus database with same CATH topology
 3ROR A;  3PKE A;  1A16 A;  1BOA A;  4A6W A;  1YW7 A;  2EA4 A;  1W2M A;  2BWS A;  2BWW A;  2GG0 A;  2BWT A;  1XGN A;  1B6A A;  1R5G A;  4R60 A;  4U6C A;  5CDV A;  2Q92 A;  2GGC A;  3IU9 A;  5JI6 A;  4IKR A;  2GA2 A;  4A6V A;  1QXW A;  1KQ0 A;  4U76 A;  4PNC A;  2P99 A;  4U69 A;  4U6Z A;  5CLS A;  2V3Z A;  5JHU A;  4KM3 A;  1YVM A;  1WLR A;  2HOW A;  1PV9 A;  1YW9 A;  3MAT A;  2BN7 A;  2B3H A;  1JAW A;  1QZY A;  5CIK A;  2DFI A;  5D6F A;  2GG3 A;  1XGS A;  3RVA A;  4U75 A;  2B3K A;  4B28 A;  1N51 A;  1BN5 A;  3D27 A;  1C23 A;  1Y1N A;  2MAT A;  1KP0 A;  1WN1 A;  4OOK A;  4S2R P;  2V3Y A;  5CDL A;  3MR1 A;  1C21 A;  5CNX A;  2BH3 A;  3IU7 A;  4RGZ 1;  5CE6 A;  4ZNG A;  3TAV A;  2EVM A;  2GZ5 A;  4IKT A;  2Q95 A;  2GU7 A;  2OAZ A;  3IU8 A;  3CB6 A;  3L24 A;  2EA2 A;  4IDY A;  2GG5 A;  4S01 A;  4U6E A;  3S6B A;  4IEC A;  2G6P A;  2EVO A;  2IW2 A;  1W7V A;  3PKC A;  1O0X A;  1YW8 A;  4FLI A;  4IKU A;  3FMQ A;  4FUK A;  2BHA A;  3IG4 A;  4ZWP A;  2GU6 A;  4FKC A;  4IKS A;  1CHM A;  3BIP A;  2B3L A;  3TB5 A;  3L7G A;  1WY2 A;  1QXZ A;  1XNZ A;  4IF7 A;  3CB5 A;  2V6C A;  2BWV A;  2GG2 A;  1WKM A;  1M35 A;  2GG9 A;  4EGE A;  4RZY A;  4U6W A;  2BB7 A;  2BWU A;  2EVC A;  3Q6D A;  2NQ6 A;  1C24 A;  2Q8K A;  2BHB A;  2NQ7 A;  4PV4 A;  1XGO A;  2GU5 A;  1QXY A;  4S2T P;  3FM3 A;  4Z7M A;  2V3X A;  2BHD A;  2GTX A;  1C22 A;  3CTZ A;  5JFR A;  4U6J A;  4U1B A;  4IU6 A;  2BHC A;  2Q94 A;  2ZSG A;  3FMR A;  3PKD A;  4FLK A;  4ZWO A;  2Q93 A;  2GG8 A;  2OKN A;  3PKB A;  2BWX A;  1B59 A;  1XGM A;  2GG7 A;  4FLL A;  4JUQ A;  1WL9 A;  4U71 A;  3BIQ A;  1C27 A;  4FLJ A;  1MAT A;  4RZZ A;  5E5B A;  3PKA A;  4MAT A;  1WBQ A;  2Q96 A;  4HXX A;  3BIT A;  2GGB A;  5FCF A;  5FCH A;  1YJ3 A;  4IPA A;  2ADU A;  4QR8 A;  4U70 A;  1KQ9 A;  4ZWU A;  1R5H A;  2BWY A;  2P98 A;  1R58 A;  4U73 A;  3MX6 A;  5D6E A;  2GU4 A;  4FO7 A;  5CDE A;  2P9A A;  4S00 A;  1WL6 A;  4FO8 A; 
#chains in the Genus database with same CATH homology
 3ROR A;  3PKE A;  1A16 A;  1BOA A;  4A6W A;  1YW7 A;  2EA4 A;  1W2M A;  2BWS A;  2BWW A;  2GG0 A;  2BWT A;  1XGN A;  1B6A A;  1R5G A;  4R60 A;  4U6C A;  5CDV A;  2Q92 A;  2GGC A;  3IU9 A;  5JI6 A;  4IKR A;  2GA2 A;  4A6V A;  1QXW A;  1KQ0 A;  4U76 A;  4PNC A;  2P99 A;  4U69 A;  4U6Z A;  5CLS A;  2V3Z A;  5JHU A;  4KM3 A;  1YVM A;  1WLR A;  2HOW A;  1PV9 A;  1YW9 A;  3MAT A;  2BN7 A;  2B3H A;  1JAW A;  1QZY A;  5CIK A;  2DFI A;  5D6F A;  2GG3 A;  1XGS A;  3RVA A;  4U75 A;  2B3K A;  4B28 A;  1N51 A;  1BN5 A;  3D27 A;  1C23 A;  1Y1N A;  2MAT A;  1KP0 A;  1WN1 A;  4OOK A;  4S2R P;  2V3Y A;  5CDL A;  3MR1 A;  1C21 A;  5CNX A;  2BH3 A;  3IU7 A;  4RGZ 1;  5CE6 A;  4ZNG A;  3TAV A;  2EVM A;  2GZ5 A;  4IKT A;  2Q95 A;  2GU7 A;  2OAZ A;  3IU8 A;  3CB6 A;  3L24 A;  2EA2 A;  4IDY A;  2GG5 A;  4S01 A;  4U6E A;  3S6B A;  4IEC A;  2G6P A;  2EVO A;  2IW2 A;  1W7V A;  3PKC A;  1O0X A;  1YW8 A;  4FLI A;  4IKU A;  3FMQ A;  4FUK A;  2BHA A;  3IG4 A;  4ZWP A;  2GU6 A;  4FKC A;  4IKS A;  1CHM A;  3BIP A;  2B3L A;  3TB5 A;  3L7G A;  1WY2 A;  1QXZ A;  1XNZ A;  4IF7 A;  3CB5 A;  2V6C A;  2BWV A;  2GG2 A;  1WKM A;  1M35 A;  2GG9 A;  4EGE A;  4RZY A;  4U6W A;  2BB7 A;  2BWU A;  2EVC A;  3Q6D A;  2NQ6 A;  1C24 A;  2Q8K A;  2BHB A;  2NQ7 A;  4PV4 A;  1XGO A;  2GU5 A;  1QXY A;  4S2T P;  3FM3 A;  4Z7M A;  2V3X A;  2BHD A;  2GTX A;  1C22 A;  3CTZ A;  5JFR A;  4U6J A;  4U1B A;  4IU6 A;  2BHC A;  2Q94 A;  2ZSG A;  3FMR A;  3PKD A;  4FLK A;  4ZWO A;  2Q93 A;  2GG8 A;  2OKN A;  3PKB A;  2BWX A;  1B59 A;  1XGM A;  2GG7 A;  4FLL A;  4JUQ A;  1WL9 A;  4U71 A;  3BIQ A;  1C27 A;  4FLJ A;  1MAT A;  4RZZ A;  5E5B A;  3PKA A;  4MAT A;  1WBQ A;  2Q96 A;  4HXX A;  3BIT A;  2GGB A;  5FCF A;  5FCH A;  1YJ3 A;  4IPA A;  2ADU A;  4QR8 A;  4U70 A;  1KQ9 A;  4ZWU A;  1R5H A;  2BWY A;  2P98 A;  1R58 A;  4U73 A;  3MX6 A;  5D6E A;  2GU4 A;  4FO7 A;  5CDE A;  2P9A A;  4S00 A;  1WL6 A;  4FO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...