4FLJA

Human metap1 with bengamide analog y08, in mn form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fljA00
4U71A 1O0XA 1W7VA 4U73A 2IW2A 5E5BA 2BWTA 4IKUA 3TAVA 5D6EA 4A6WA 1Y1NA 3FMRA 2G6PA 2BN7A 1WY2A 2P99A 3PKDA 5D6FA 5JHUA 2V3ZA 2GG9A 2GU5A 1KP0A 3Q6DA 2V6CA 1BN5A 2GGCA 2GG3A 2GG0A 1QZYA 2P98A 2BHAA 1B59A 2DFIA 5CLSA 4ZWUA 2GG8A 2EVMA 2GG7A 3L24A 3CB5A 1C23A 4U6JA 4U6WA 4IPAA 4PV4A 5CE6A 1WL9A 4Z7MA 2EA4A 2GGBA 2MATA 3BIQA 4QR8A 4OOKA 1W2MA 2BWSA 3PKCA 1C24A 1XGOA 3RVAA 2GU6A 2BWXA 2GG5A 2GU4A 5CDEA 4S00A 4FO7A 4KM3A 1QXYA 4IKRA 1WN1A 3IU7A 3FM3A 1BOAA 3MATA 4IDYA 3D27A 4IU6A 2BWWA 4HXXA 2BWYA 2BHBA 2Q96A 2GTXA 3FMQA 3CTZA 3MR1A 1XGNA 1PV9A 3PKBA 4FO8A 5CNXA 2B3LA 2Q95A 2Q93A 2BB7A 4MATA 5CIKA 4IF7A 3L7GA 1WLRA 1MATA 1YVMA 2Q92A 2BWUA 2V3YA 3IU9A 4RZZA 2GA2A 1C27A 1WKMA 4FLJA 4U6EA 1R5HA 5CDLA 2B3KA 2NQ6A 1C21A 2Q94A 1JAWA 4FLLA 1CHMA 4FLIA 2ADUA 1YJ3A 4PNCA 4FLKA 2V3XA 2EA2A 4B28A 3RORA 3PKAA 4S2RP 5FCFA 4U6CA 4ZWOA 2EVCA 1A16A 1YW7A 2GG2A 2HOWA 1YW9A 2BHDA 3IG4A 4U70A 4JUQA 4FUKA 4RZYA 3CB6A 2OKNA 5CDVA 5JI6A 4IKSA 2P9AA 5FCHA 1KQ9A 2BWVA 1WBQA 4R60A 4U69A 4RGZ1 2BHCA 4S01A 1WL6A 2NQ7A 4ZNGA 2EVOA 4FKCA 1N51A 4A6VA 4U6ZA 3PKEA 1R5GA 2B3HA 2OAZA 1YW8A 3BITA 1M35A 3BIPA 1QXWA 4IECA 4EGEA 4U75A 3IU8A 4U76A 2GZ5A 3S6BA 1B6AA 4IKTA 2ZSGA 1XNZA 4S2TP 4U1BA 3TB5A 2Q8KA 1XGMA 1XGSA 2BH3A 4ZWPA 1QXZA 1KQ0A 1R58A 5JFRA 3MX6A 2GU7A 1C22A
chains in the Genus database with same CATH superfamily
4U71A 1O0XA 1W7VA 4U73A 2IW2A 5E5BA 2BWTA 4IKUA 3TAVA 5D6EA 4A6WA 1Y1NA 3FMRA 2G6PA 2BN7A 1WY2A 2P99A 3PKDA 5D6FA 5JHUA 2V3ZA 2GG9A 2GU5A 1KP0A 3Q6DA 2V6CA 1BN5A 2GGCA 2GG3A 2GG0A 1QZYA 2P98A 2BHAA 1B59A 2DFIA 5CLSA 4ZWUA 2GG8A 2EVMA 2GG7A 3L24A 3CB5A 1C23A 4U6JA 4U6WA 4IPAA 4PV4A 5CE6A 1WL9A 4Z7MA 2EA4A 2GGBA 2MATA 3BIQA 4QR8A 4OOKA 1W2MA 2BWSA 3PKCA 1C24A 1XGOA 3RVAA 2GU6A 2BWXA 2GG5A 2GU4A 5CDEA 4S00A 4FO7A 4KM3A 1QXYA 4IKRA 1WN1A 3IU7A 3FM3A 1BOAA 3MATA 4IDYA 3D27A 4IU6A 2BWWA 4HXXA 2BWYA 2BHBA 2Q96A 2GTXA 3FMQA 3CTZA 3MR1A 1XGNA 1PV9A 3PKBA 4FO8A 5CNXA 2B3LA 2Q95A 2Q93A 2BB7A 4MATA 5CIKA 4IF7A 3L7GA 1WLRA 1MATA 1YVMA 2Q92A 2BWUA 2V3YA 3IU9A 4RZZA 2GA2A 1C27A 1WKMA 4FLJA 4U6EA 1R5HA 5CDLA 2B3KA 2NQ6A 1C21A 2Q94A 1JAWA 4FLLA 1CHMA 4FLIA 2ADUA 1YJ3A 4PNCA 4FLKA 2V3XA 2EA2A 4B28A 3RORA 3PKAA 4S2RP 5FCFA 4U6CA 4ZWOA 2EVCA 1A16A 1YW7A 2GG2A 2HOWA 1YW9A 2BHDA 3IG4A 4U70A 4JUQA 4FUKA 4RZYA 3CB6A 2OKNA 5CDVA 5JI6A 4IKSA 2P9AA 5FCHA 1KQ9A 2BWVA 1WBQA 4R60A 4U69A 4RGZ1 2BHCA 4S01A 1WL6A 2NQ7A 4ZNGA 2EVOA 4FKCA 1N51A 4A6VA 4U6ZA 3PKEA 1R5GA 2B3HA 2OAZA 1YW8A 3BITA 1M35A 3BIPA 1QXWA 4IECA 4EGEA 4U75A 3IU8A 4U76A 2GZ5A 3S6BA 1B6AA 4IKTA 2ZSGA 1XNZA 4S2TP 4U1BA 3TB5A 2Q8KA 1XGMA 1XGSA 2BH3A 4ZWPA 1QXZA 1KQ0A 1R58A 5JFRA 3MX6A 2GU7A 1C22A
chains in the Genus database with same CATH topology
4U71A 1O0XA 1W7VA 4U73A 2IW2A 5E5BA 2BWTA 4IKUA 3TAVA 5D6EA 4A6WA 1Y1NA 3FMRA 2G6PA 2BN7A 1WY2A 2P99A 3PKDA 5D6FA 5JHUA 2V3ZA 2GG9A 2GU5A 1KP0A 3Q6DA 2V6CA 1BN5A 2GGCA 2GG3A 2GG0A 1QZYA 2P98A 2BHAA 1B59A 2DFIA 5CLSA 4ZWUA 2GG8A 2EVMA 2GG7A 3L24A 3CB5A 1C23A 4U6JA 4U6WA 4IPAA 4PV4A 5CE6A 1WL9A 4Z7MA 2EA4A 2GGBA 2MATA 3BIQA 4QR8A 4OOKA 1W2MA 2BWSA 3PKCA 1C24A 1XGOA 3RVAA 2GU6A 2BWXA 2GG5A 2GU4A 5CDEA 4S00A 4FO7A 4KM3A 1QXYA 4IKRA 1WN1A 3IU7A 3FM3A 1BOAA 3MATA 4IDYA 3D27A 4IU6A 2BWWA 4HXXA 2BWYA 2BHBA 2Q96A 2GTXA 3FMQA 3CTZA 3MR1A 1XGNA 1PV9A 3PKBA 4FO8A 5CNXA 2B3LA 2Q95A 2Q93A 2BB7A 4MATA 5CIKA 4IF7A 3L7GA 1WLRA 1MATA 1YVMA 2Q92A 2BWUA 2V3YA 3IU9A 4RZZA 2GA2A 1C27A 1WKMA 4FLJA 4U6EA 1R5HA 5CDLA 2B3KA 2NQ6A 1C21A 2Q94A 1JAWA 4FLLA 1CHMA 4FLIA 2ADUA 1YJ3A 4PNCA 4FLKA 2V3XA 2EA2A 4B28A 3RORA 3PKAA 4S2RP 5FCFA 4U6CA 4ZWOA 2EVCA 1A16A 1YW7A 2GG2A 2HOWA 1YW9A 2BHDA 3IG4A 4U70A 4JUQA 4FUKA 4RZYA 3CB6A 2OKNA 5CDVA 5JI6A 4IKSA 2P9AA 5FCHA 1KQ9A 2BWVA 1WBQA 4R60A 4U69A 4RGZ1 2BHCA 4S01A 1WL6A 2NQ7A 4ZNGA 2EVOA 4FKCA 1N51A 4A6VA 4U6ZA 3PKEA 1R5GA 2B3HA 2OAZA 1YW8A 3BITA 1M35A 3BIPA 1QXWA 4IECA 4EGEA 4U75A 3IU8A 4U76A 2GZ5A 3S6BA 1B6AA 4IKTA 2ZSGA 1XNZA 4S2TP 4U1BA 3TB5A 2Q8KA 1XGMA 1XGSA 2BH3A 4ZWPA 1QXZA 1KQ0A 1R58A 5JFRA 3MX6A 2GU7A 1C22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U71 A;  1O0X A;  1W7V A;  4U73 A;  2IW2 A;  5E5B A;  2BWT A;  4IKU A;  3TAV A;  5D6E A;  4A6W A;  1Y1N A;  3FMR A;  2G6P A;  2BN7 A;  1WY2 A;  2P99 A;  3PKD A;  5D6F A;  5JHU A;  2V3Z A;  2GG9 A;  2GU5 A;  1KP0 A;  3Q6D A;  2V6C A;  1BN5 A;  2GGC A;  2GG3 A;  2GG0 A;  1QZY A;  2P98 A;  2BHA A;  1B59 A;  2DFI A;  5CLS A;  4ZWU A;  2GG8 A;  2EVM A;  2GG7 A;  3L24 A;  3CB5 A;  1C23 A;  4U6J A;  4U6W A;  4IPA A;  4PV4 A;  5CE6 A;  1WL9 A;  4Z7M A;  2EA4 A;  2GGB A;  2MAT A;  3BIQ A;  4QR8 A;  4OOK A;  1W2M A;  2BWS A;  3PKC A;  1C24 A;  1XGO A;  3RVA A;  2GU6 A;  2BWX A;  2GG5 A;  2GU4 A;  5CDE A;  4S00 A;  4FO7 A;  4KM3 A;  1QXY A;  4IKR A;  1WN1 A;  3IU7 A;  3FM3 A;  1BOA A;  3MAT A;  4IDY A;  3D27 A;  4IU6 A;  2BWW A;  4HXX A;  2BWY A;  2BHB A;  2Q96 A;  2GTX A;  3FMQ A;  3CTZ A;  3MR1 A;  1XGN A;  1PV9 A;  3PKB A;  4FO8 A;  5CNX A;  2B3L A;  2Q95 A;  2Q93 A;  2BB7 A;  4MAT A;  5CIK A;  4IF7 A;  3L7G A;  1WLR A;  1MAT A;  1YVM A;  2Q92 A;  2BWU A;  2V3Y A;  3IU9 A;  4RZZ A;  2GA2 A;  1C27 A;  1WKM A;  4FLJ A;  4U6E A;  1R5H A;  5CDL A;  2B3K A;  2NQ6 A;  1C21 A;  2Q94 A;  1JAW A;  4FLL A;  1CHM A;  4FLI A;  2ADU A;  1YJ3 A;  4PNC A;  4FLK A;  2V3X A;  2EA2 A;  4B28 A;  3ROR A;  3PKA A;  4S2R P;  5FCF A;  4U6C A;  4ZWO A;  2EVC A;  1A16 A;  1YW7 A;  2GG2 A;  2HOW A;  1YW9 A;  2BHD A;  3IG4 A;  4U70 A;  4JUQ A;  4FUK A;  4RZY A;  3CB6 A;  2OKN A;  5CDV A;  5JI6 A;  4IKS A;  2P9A A;  5FCH A;  1KQ9 A;  2BWV A;  1WBQ A;  4R60 A;  4U69 A;  4RGZ 1;  2BHC A;  4S01 A;  1WL6 A;  2NQ7 A;  4ZNG A;  2EVO A;  4FKC A;  1N51 A;  4A6V A;  4U6Z A;  3PKE A;  1R5G A;  2B3H A;  2OAZ A;  1YW8 A;  3BIT A;  1M35 A;  3BIP A;  1QXW A;  4IEC A;  4EGE A;  4U75 A;  3IU8 A;  4U76 A;  2GZ5 A;  3S6B A;  1B6A A;  4IKT A;  2ZSG A;  1XNZ A;  4S2T P;  4U1B A;  3TB5 A;  2Q8K A;  1XGM A;  1XGS A;  2BH3 A;  4ZWP A;  1QXZ A;  1KQ0 A;  1R58 A;  5JFR A;  3MX6 A;  2GU7 A;  1C22 A; 
#chains in the Genus database with same CATH topology
 4U71 A;  1O0X A;  1W7V A;  4U73 A;  2IW2 A;  5E5B A;  2BWT A;  4IKU A;  3TAV A;  5D6E A;  4A6W A;  1Y1N A;  3FMR A;  2G6P A;  2BN7 A;  1WY2 A;  2P99 A;  3PKD A;  5D6F A;  5JHU A;  2V3Z A;  2GG9 A;  2GU5 A;  1KP0 A;  3Q6D A;  2V6C A;  1BN5 A;  2GGC A;  2GG3 A;  2GG0 A;  1QZY A;  2P98 A;  2BHA A;  1B59 A;  2DFI A;  5CLS A;  4ZWU A;  2GG8 A;  2EVM A;  2GG7 A;  3L24 A;  3CB5 A;  1C23 A;  4U6J A;  4U6W A;  4IPA A;  4PV4 A;  5CE6 A;  1WL9 A;  4Z7M A;  2EA4 A;  2GGB A;  2MAT A;  3BIQ A;  4QR8 A;  4OOK A;  1W2M A;  2BWS A;  3PKC A;  1C24 A;  1XGO A;  3RVA A;  2GU6 A;  2BWX A;  2GG5 A;  2GU4 A;  5CDE A;  4S00 A;  4FO7 A;  4KM3 A;  1QXY A;  4IKR A;  1WN1 A;  3IU7 A;  3FM3 A;  1BOA A;  3MAT A;  4IDY A;  3D27 A;  4IU6 A;  2BWW A;  4HXX A;  2BWY A;  2BHB A;  2Q96 A;  2GTX A;  3FMQ A;  3CTZ A;  3MR1 A;  1XGN A;  1PV9 A;  3PKB A;  4FO8 A;  5CNX A;  2B3L A;  2Q95 A;  2Q93 A;  2BB7 A;  4MAT A;  5CIK A;  4IF7 A;  3L7G A;  1WLR A;  1MAT A;  1YVM A;  2Q92 A;  2BWU A;  2V3Y A;  3IU9 A;  4RZZ A;  2GA2 A;  1C27 A;  1WKM A;  4FLJ A;  4U6E A;  1R5H A;  5CDL A;  2B3K A;  2NQ6 A;  1C21 A;  2Q94 A;  1JAW A;  4FLL A;  1CHM A;  4FLI A;  2ADU A;  1YJ3 A;  4PNC A;  4FLK A;  2V3X A;  2EA2 A;  4B28 A;  3ROR A;  3PKA A;  4S2R P;  5FCF A;  4U6C A;  4ZWO A;  2EVC A;  1A16 A;  1YW7 A;  2GG2 A;  2HOW A;  1YW9 A;  2BHD A;  3IG4 A;  4U70 A;  4JUQ A;  4FUK A;  4RZY A;  3CB6 A;  2OKN A;  5CDV A;  5JI6 A;  4IKS A;  2P9A A;  5FCH A;  1KQ9 A;  2BWV A;  1WBQ A;  4R60 A;  4U69 A;  4RGZ 1;  2BHC A;  4S01 A;  1WL6 A;  2NQ7 A;  4ZNG A;  2EVO A;  4FKC A;  1N51 A;  4A6V A;  4U6Z A;  3PKE A;  1R5G A;  2B3H A;  2OAZ A;  1YW8 A;  3BIT A;  1M35 A;  3BIP A;  1QXW A;  4IEC A;  4EGE A;  4U75 A;  3IU8 A;  4U76 A;  2GZ5 A;  3S6B A;  1B6A A;  4IKT A;  2ZSG A;  1XNZ A;  4S2T P;  4U1B A;  3TB5 A;  2Q8K A;  1XGM A;  1XGS A;  2BH3 A;  4ZWP A;  1QXZ A;  1KQ0 A;  1R58 A;  5JFR A;  3MX6 A;  2GU7 A;  1C22 A; 
#chains in the Genus database with same CATH homology
 4U71 A;  1O0X A;  1W7V A;  4U73 A;  2IW2 A;  5E5B A;  2BWT A;  4IKU A;  3TAV A;  5D6E A;  4A6W A;  1Y1N A;  3FMR A;  2G6P A;  2BN7 A;  1WY2 A;  2P99 A;  3PKD A;  5D6F A;  5JHU A;  2V3Z A;  2GG9 A;  2GU5 A;  1KP0 A;  3Q6D A;  2V6C A;  1BN5 A;  2GGC A;  2GG3 A;  2GG0 A;  1QZY A;  2P98 A;  2BHA A;  1B59 A;  2DFI A;  5CLS A;  4ZWU A;  2GG8 A;  2EVM A;  2GG7 A;  3L24 A;  3CB5 A;  1C23 A;  4U6J A;  4U6W A;  4IPA A;  4PV4 A;  5CE6 A;  1WL9 A;  4Z7M A;  2EA4 A;  2GGB A;  2MAT A;  3BIQ A;  4QR8 A;  4OOK A;  1W2M A;  2BWS A;  3PKC A;  1C24 A;  1XGO A;  3RVA A;  2GU6 A;  2BWX A;  2GG5 A;  2GU4 A;  5CDE A;  4S00 A;  4FO7 A;  4KM3 A;  1QXY A;  4IKR A;  1WN1 A;  3IU7 A;  3FM3 A;  1BOA A;  3MAT A;  4IDY A;  3D27 A;  4IU6 A;  2BWW A;  4HXX A;  2BWY A;  2BHB A;  2Q96 A;  2GTX A;  3FMQ A;  3CTZ A;  3MR1 A;  1XGN A;  1PV9 A;  3PKB A;  4FO8 A;  5CNX A;  2B3L A;  2Q95 A;  2Q93 A;  2BB7 A;  4MAT A;  5CIK A;  4IF7 A;  3L7G A;  1WLR A;  1MAT A;  1YVM A;  2Q92 A;  2BWU A;  2V3Y A;  3IU9 A;  4RZZ A;  2GA2 A;  1C27 A;  1WKM A;  4FLJ A;  4U6E A;  1R5H A;  5CDL A;  2B3K A;  2NQ6 A;  1C21 A;  2Q94 A;  1JAW A;  4FLL A;  1CHM A;  4FLI A;  2ADU A;  1YJ3 A;  4PNC A;  4FLK A;  2V3X A;  2EA2 A;  4B28 A;  3ROR A;  3PKA A;  4S2R P;  5FCF A;  4U6C A;  4ZWO A;  2EVC A;  1A16 A;  1YW7 A;  2GG2 A;  2HOW A;  1YW9 A;  2BHD A;  3IG4 A;  4U70 A;  4JUQ A;  4FUK A;  4RZY A;  3CB6 A;  2OKN A;  5CDV A;  5JI6 A;  4IKS A;  2P9A A;  5FCH A;  1KQ9 A;  2BWV A;  1WBQ A;  4R60 A;  4U69 A;  4RGZ 1;  2BHC A;  4S01 A;  1WL6 A;  2NQ7 A;  4ZNG A;  2EVO A;  4FKC A;  1N51 A;  4A6V A;  4U6Z A;  3PKE A;  1R5G A;  2B3H A;  2OAZ A;  1YW8 A;  3BIT A;  1M35 A;  3BIP A;  1QXW A;  4IEC A;  4EGE A;  4U75 A;  3IU8 A;  4U76 A;  2GZ5 A;  3S6B A;  1B6A A;  4IKT A;  2ZSG A;  1XNZ A;  4S2T P;  4U1B A;  3TB5 A;  2Q8K A;  1XGM A;  1XGS A;  2BH3 A;  4ZWP A;  1QXZ A;  1KQ0 A;  1R58 A;  5JFR A;  3MX6 A;  2GU7 A;  1C22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...