4FLJA

Human metap1 with bengamide analog y08, in mn form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fljA00
2BWSA 5CE6A 2BWTA 4ZWOA 2BB7A 4U6ZA 4FLJA 1KQ0A 4QR8A 5JHUA 2BWXA 4IDYA 1B6AA 4U6WA 5D6FA 2V6CA 1WL9A 2V3YA 2V3XA 1WKMA 1WBQA 4RZZA 4RZYA 4S2RP 3IG4A 1XGOA 2BN7A 4ZWUA 1BOAA 1XNZA 4IKRA 4Z7MA 2Q96A 4S2TP 1MATA 2NQ7A 3CTZA 1QZYA 1YW9A 2Q92A 4HXXA 4U1BA 2Q8KA 5JI6A 5CNXA 2GG2A 4U71A 1WY2A 2Q94A 2GU5A 2OAZA 1CHMA 4IKSA 1Y1NA 3PKBA 2EA2A 4A6VA 2BHAA 1W2MA 4IKUA 2GU4A 1C24A 1N51A 1XGMA 2GTXA 2P99A 2Q93A 4A6WA 1JAWA 3IU9A 3RVAA 3Q6DA 4IPAA 5E5BA 4FKCA 5JFRA 4FLKA 3D27A 5CIKA 2P98A 1WL6A 2BHBA 4MATA 2MATA 4IF7A 3RORA 5D6EA 2GU7A 1XGSA 4FO8A 3IU7A 3MATA 3PKEA 4KM3A 3FMRA 2IW2A 2OKNA 3CB6A 4OOKA 2EVOA 4U75A 3BITA 4FLLA 4U6EA 2GG7A 3FMQA 3TB5A 4IECA 1BN5A 1C27A 3L7GA 4IU6A 5CLSA 5CDLA 4B28A 2EVCA 1B59A 1YVMA 1A16A 4ZWPA 1KQ9A 4U70A 2BHDA 5FCHA 5FCFA 1R58A 1QXZA 1QXYA 3CB5A 4RGZ1 2Q95A 1QXWA 2BHCA 3FM3A 2EA4A 4PV4A 3PKCA 3PKAA 4FLIA 4U69A 2P9AA 2B3LA 2GG9A 5CDVA 2GG3A 1M35A 4S01A 3MX6A 4R60A 1YW7A 2DFIA 2BWVA 3L24A 3MR1A 2BWUA 2GGCA 2V3ZA 3S6BA 4EGEA 2GGBA 2B3KA 4FUKA 4JUQA 1R5HA 3PKDA 2GZ5A 1WLRA 2ADUA 5CDEA 1C22A 1YW8A 2BH3A 1C23A 2G6PA 3IU8A 1KP0A 2GA2A 2GG8A 2B3HA 2ZSGA 1WN1A 2GG5A 1XGNA 2BWYA 4S00A 4U76A 2HOWA 4PNCA 4FO7A 2EVMA 4U73A 2GG0A 4U6JA 4U6CA 1YJ3A 2GU6A 1W7VA 3TAVA 4ZNGA 3BIQA 1O0XA 1C21A 1R5GA 4IKTA 2NQ6A 3BIPA 2BWWA 1PV9A
chains in the Genus database with same CATH superfamily
2BWSA 5CE6A 2BWTA 4ZWOA 2BB7A 4U6ZA 4FLJA 1KQ0A 4QR8A 5JHUA 2BWXA 4IDYA 1B6AA 4U6WA 5D6FA 2V6CA 1WL9A 2V3YA 2V3XA 1WKMA 1WBQA 4RZZA 4RZYA 4S2RP 3IG4A 1XGOA 2BN7A 4ZWUA 1BOAA 1XNZA 4IKRA 4Z7MA 2Q96A 4S2TP 1MATA 2NQ7A 3CTZA 1QZYA 1YW9A 2Q92A 4HXXA 4U1BA 2Q8KA 5JI6A 5CNXA 2GG2A 4U71A 1WY2A 2Q94A 2GU5A 2OAZA 1CHMA 4IKSA 1Y1NA 3PKBA 2EA2A 4A6VA 2BHAA 1W2MA 4IKUA 2GU4A 1C24A 1N51A 1XGMA 2GTXA 2P99A 2Q93A 4A6WA 1JAWA 3IU9A 3RVAA 3Q6DA 4IPAA 5E5BA 4FKCA 5JFRA 4FLKA 3D27A 5CIKA 2P98A 1WL6A 2BHBA 4MATA 2MATA 4IF7A 3RORA 5D6EA 2GU7A 1XGSA 4FO8A 3IU7A 3MATA 3PKEA 4KM3A 3FMRA 2IW2A 2OKNA 3CB6A 4OOKA 2EVOA 4U75A 3BITA 4FLLA 4U6EA 2GG7A 3FMQA 3TB5A 4IECA 1BN5A 1C27A 3L7GA 4IU6A 5CLSA 5CDLA 4B28A 2EVCA 1B59A 1YVMA 1A16A 4ZWPA 1KQ9A 4U70A 2BHDA 5FCHA 5FCFA 1R58A 1QXZA 1QXYA 3CB5A 4RGZ1 2Q95A 1QXWA 2BHCA 3FM3A 2EA4A 4PV4A 3PKCA 3PKAA 4FLIA 4U69A 2P9AA 2B3LA 2GG9A 5CDVA 2GG3A 1M35A 4S01A 3MX6A 4R60A 1YW7A 2DFIA 2BWVA 3L24A 3MR1A 2BWUA 2GGCA 2V3ZA 3S6BA 4EGEA 2GGBA 2B3KA 4FUKA 4JUQA 1R5HA 3PKDA 2GZ5A 1WLRA 2ADUA 5CDEA 1C22A 1YW8A 2BH3A 1C23A 2G6PA 3IU8A 1KP0A 2GA2A 2GG8A 2B3HA 2ZSGA 1WN1A 2GG5A 1XGNA 2BWYA 4S00A 4U76A 2HOWA 4PNCA 4FO7A 2EVMA 4U73A 2GG0A 4U6JA 4U6CA 1YJ3A 2GU6A 1W7VA 3TAVA 4ZNGA 3BIQA 1O0XA 1C21A 1R5GA 4IKTA 2NQ6A 3BIPA 2BWWA 1PV9A
chains in the Genus database with same CATH topology
2BWSA 5CE6A 2BWTA 4ZWOA 2BB7A 4U6ZA 4FLJA 1KQ0A 4QR8A 5JHUA 2BWXA 4IDYA 1B6AA 4U6WA 5D6FA 2V6CA 1WL9A 2V3YA 2V3XA 1WKMA 1WBQA 4RZZA 4RZYA 4S2RP 3IG4A 1XGOA 2BN7A 4ZWUA 1BOAA 1XNZA 4IKRA 4Z7MA 2Q96A 4S2TP 1MATA 2NQ7A 3CTZA 1QZYA 1YW9A 2Q92A 4HXXA 4U1BA 2Q8KA 5JI6A 5CNXA 2GG2A 4U71A 1WY2A 2Q94A 2GU5A 2OAZA 1CHMA 4IKSA 1Y1NA 3PKBA 2EA2A 4A6VA 2BHAA 1W2MA 4IKUA 2GU4A 1C24A 1N51A 1XGMA 2GTXA 2P99A 2Q93A 4A6WA 1JAWA 3IU9A 3RVAA 3Q6DA 4IPAA 5E5BA 4FKCA 5JFRA 4FLKA 3D27A 5CIKA 2P98A 1WL6A 2BHBA 4MATA 2MATA 4IF7A 3RORA 5D6EA 2GU7A 1XGSA 4FO8A 3IU7A 3MATA 3PKEA 4KM3A 3FMRA 2IW2A 2OKNA 3CB6A 4OOKA 2EVOA 4U75A 3BITA 4FLLA 4U6EA 2GG7A 3FMQA 3TB5A 4IECA 1BN5A 1C27A 3L7GA 4IU6A 5CLSA 5CDLA 4B28A 2EVCA 1B59A 1YVMA 1A16A 4ZWPA 1KQ9A 4U70A 2BHDA 5FCHA 5FCFA 1R58A 1QXZA 1QXYA 3CB5A 4RGZ1 2Q95A 1QXWA 2BHCA 3FM3A 2EA4A 4PV4A 3PKCA 3PKAA 4FLIA 4U69A 2P9AA 2B3LA 2GG9A 5CDVA 2GG3A 1M35A 4S01A 3MX6A 4R60A 1YW7A 2DFIA 2BWVA 3L24A 3MR1A 2BWUA 2GGCA 2V3ZA 3S6BA 4EGEA 2GGBA 2B3KA 4FUKA 4JUQA 1R5HA 3PKDA 2GZ5A 1WLRA 2ADUA 5CDEA 1C22A 1YW8A 2BH3A 1C23A 2G6PA 3IU8A 1KP0A 2GA2A 2GG8A 2B3HA 2ZSGA 1WN1A 2GG5A 1XGNA 2BWYA 4S00A 4U76A 2HOWA 4PNCA 4FO7A 2EVMA 4U73A 2GG0A 4U6JA 4U6CA 1YJ3A 2GU6A 1W7VA 3TAVA 4ZNGA 3BIQA 1O0XA 1C21A 1R5GA 4IKTA 2NQ6A 3BIPA 2BWWA 1PV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWS A;  5CE6 A;  2BWT A;  4ZWO A;  2BB7 A;  4U6Z A;  4FLJ A;  1KQ0 A;  4QR8 A;  5JHU A;  2BWX A;  4IDY A;  1B6A A;  4U6W A;  5D6F A;  2V6C A;  1WL9 A;  2V3Y A;  2V3X A;  1WKM A;  1WBQ A;  4RZZ A;  4RZY A;  4S2R P;  3IG4 A;  1XGO A;  2BN7 A;  4ZWU A;  1BOA A;  1XNZ A;  4IKR A;  4Z7M A;  2Q96 A;  4S2T P;  1MAT A;  2NQ7 A;  3CTZ A;  1QZY A;  1YW9 A;  2Q92 A;  4HXX A;  4U1B A;  2Q8K A;  5JI6 A;  5CNX A;  2GG2 A;  4U71 A;  1WY2 A;  2Q94 A;  2GU5 A;  2OAZ A;  1CHM A;  4IKS A;  1Y1N A;  3PKB A;  2EA2 A;  4A6V A;  2BHA A;  1W2M A;  4IKU A;  2GU4 A;  1C24 A;  1N51 A;  1XGM A;  2GTX A;  2P99 A;  2Q93 A;  4A6W A;  1JAW A;  3IU9 A;  3RVA A;  3Q6D A;  4IPA A;  5E5B A;  4FKC A;  5JFR A;  4FLK A;  3D27 A;  5CIK A;  2P98 A;  1WL6 A;  2BHB A;  4MAT A;  2MAT A;  4IF7 A;  3ROR A;  5D6E A;  2GU7 A;  1XGS A;  4FO8 A;  3IU7 A;  3MAT A;  3PKE A;  4KM3 A;  3FMR A;  2IW2 A;  2OKN A;  3CB6 A;  4OOK A;  2EVO A;  4U75 A;  3BIT A;  4FLL A;  4U6E A;  2GG7 A;  3FMQ A;  3TB5 A;  4IEC A;  1BN5 A;  1C27 A;  3L7G A;  4IU6 A;  5CLS A;  5CDL A;  4B28 A;  2EVC A;  1B59 A;  1YVM A;  1A16 A;  4ZWP A;  1KQ9 A;  4U70 A;  2BHD A;  5FCH A;  5FCF A;  1R58 A;  1QXZ A;  1QXY A;  3CB5 A;  4RGZ 1;  2Q95 A;  1QXW A;  2BHC A;  3FM3 A;  2EA4 A;  4PV4 A;  3PKC A;  3PKA A;  4FLI A;  4U69 A;  2P9A A;  2B3L A;  2GG9 A;  5CDV A;  2GG3 A;  1M35 A;  4S01 A;  3MX6 A;  4R60 A;  1YW7 A;  2DFI A;  2BWV A;  3L24 A;  3MR1 A;  2BWU A;  2GGC A;  2V3Z A;  3S6B A;  4EGE A;  2GGB A;  2B3K A;  4FUK A;  4JUQ A;  1R5H A;  3PKD A;  2GZ5 A;  1WLR A;  2ADU A;  5CDE A;  1C22 A;  1YW8 A;  2BH3 A;  1C23 A;  2G6P A;  3IU8 A;  1KP0 A;  2GA2 A;  2GG8 A;  2B3H A;  2ZSG A;  1WN1 A;  2GG5 A;  1XGN A;  2BWY A;  4S00 A;  4U76 A;  2HOW A;  4PNC A;  4FO7 A;  2EVM A;  4U73 A;  2GG0 A;  4U6J A;  4U6C A;  1YJ3 A;  2GU6 A;  1W7V A;  3TAV A;  4ZNG A;  3BIQ A;  1O0X A;  1C21 A;  1R5G A;  4IKT A;  2NQ6 A;  3BIP A;  2BWW A;  1PV9 A; 
#chains in the Genus database with same CATH topology
 2BWS A;  5CE6 A;  2BWT A;  4ZWO A;  2BB7 A;  4U6Z A;  4FLJ A;  1KQ0 A;  4QR8 A;  5JHU A;  2BWX A;  4IDY A;  1B6A A;  4U6W A;  5D6F A;  2V6C A;  1WL9 A;  2V3Y A;  2V3X A;  1WKM A;  1WBQ A;  4RZZ A;  4RZY A;  4S2R P;  3IG4 A;  1XGO A;  2BN7 A;  4ZWU A;  1BOA A;  1XNZ A;  4IKR A;  4Z7M A;  2Q96 A;  4S2T P;  1MAT A;  2NQ7 A;  3CTZ A;  1QZY A;  1YW9 A;  2Q92 A;  4HXX A;  4U1B A;  2Q8K A;  5JI6 A;  5CNX A;  2GG2 A;  4U71 A;  1WY2 A;  2Q94 A;  2GU5 A;  2OAZ A;  1CHM A;  4IKS A;  1Y1N A;  3PKB A;  2EA2 A;  4A6V A;  2BHA A;  1W2M A;  4IKU A;  2GU4 A;  1C24 A;  1N51 A;  1XGM A;  2GTX A;  2P99 A;  2Q93 A;  4A6W A;  1JAW A;  3IU9 A;  3RVA A;  3Q6D A;  4IPA A;  5E5B A;  4FKC A;  5JFR A;  4FLK A;  3D27 A;  5CIK A;  2P98 A;  1WL6 A;  2BHB A;  4MAT A;  2MAT A;  4IF7 A;  3ROR A;  5D6E A;  2GU7 A;  1XGS A;  4FO8 A;  3IU7 A;  3MAT A;  3PKE A;  4KM3 A;  3FMR A;  2IW2 A;  2OKN A;  3CB6 A;  4OOK A;  2EVO A;  4U75 A;  3BIT A;  4FLL A;  4U6E A;  2GG7 A;  3FMQ A;  3TB5 A;  4IEC A;  1BN5 A;  1C27 A;  3L7G A;  4IU6 A;  5CLS A;  5CDL A;  4B28 A;  2EVC A;  1B59 A;  1YVM A;  1A16 A;  4ZWP A;  1KQ9 A;  4U70 A;  2BHD A;  5FCH A;  5FCF A;  1R58 A;  1QXZ A;  1QXY A;  3CB5 A;  4RGZ 1;  2Q95 A;  1QXW A;  2BHC A;  3FM3 A;  2EA4 A;  4PV4 A;  3PKC A;  3PKA A;  4FLI A;  4U69 A;  2P9A A;  2B3L A;  2GG9 A;  5CDV A;  2GG3 A;  1M35 A;  4S01 A;  3MX6 A;  4R60 A;  1YW7 A;  2DFI A;  2BWV A;  3L24 A;  3MR1 A;  2BWU A;  2GGC A;  2V3Z A;  3S6B A;  4EGE A;  2GGB A;  2B3K A;  4FUK A;  4JUQ A;  1R5H A;  3PKD A;  2GZ5 A;  1WLR A;  2ADU A;  5CDE A;  1C22 A;  1YW8 A;  2BH3 A;  1C23 A;  2G6P A;  3IU8 A;  1KP0 A;  2GA2 A;  2GG8 A;  2B3H A;  2ZSG A;  1WN1 A;  2GG5 A;  1XGN A;  2BWY A;  4S00 A;  4U76 A;  2HOW A;  4PNC A;  4FO7 A;  2EVM A;  4U73 A;  2GG0 A;  4U6J A;  4U6C A;  1YJ3 A;  2GU6 A;  1W7V A;  3TAV A;  4ZNG A;  3BIQ A;  1O0X A;  1C21 A;  1R5G A;  4IKT A;  2NQ6 A;  3BIP A;  2BWW A;  1PV9 A; 
#chains in the Genus database with same CATH homology
 2BWS A;  5CE6 A;  2BWT A;  4ZWO A;  2BB7 A;  4U6Z A;  4FLJ A;  1KQ0 A;  4QR8 A;  5JHU A;  2BWX A;  4IDY A;  1B6A A;  4U6W A;  5D6F A;  2V6C A;  1WL9 A;  2V3Y A;  2V3X A;  1WKM A;  1WBQ A;  4RZZ A;  4RZY A;  4S2R P;  3IG4 A;  1XGO A;  2BN7 A;  4ZWU A;  1BOA A;  1XNZ A;  4IKR A;  4Z7M A;  2Q96 A;  4S2T P;  1MAT A;  2NQ7 A;  3CTZ A;  1QZY A;  1YW9 A;  2Q92 A;  4HXX A;  4U1B A;  2Q8K A;  5JI6 A;  5CNX A;  2GG2 A;  4U71 A;  1WY2 A;  2Q94 A;  2GU5 A;  2OAZ A;  1CHM A;  4IKS A;  1Y1N A;  3PKB A;  2EA2 A;  4A6V A;  2BHA A;  1W2M A;  4IKU A;  2GU4 A;  1C24 A;  1N51 A;  1XGM A;  2GTX A;  2P99 A;  2Q93 A;  4A6W A;  1JAW A;  3IU9 A;  3RVA A;  3Q6D A;  4IPA A;  5E5B A;  4FKC A;  5JFR A;  4FLK A;  3D27 A;  5CIK A;  2P98 A;  1WL6 A;  2BHB A;  4MAT A;  2MAT A;  4IF7 A;  3ROR A;  5D6E A;  2GU7 A;  1XGS A;  4FO8 A;  3IU7 A;  3MAT A;  3PKE A;  4KM3 A;  3FMR A;  2IW2 A;  2OKN A;  3CB6 A;  4OOK A;  2EVO A;  4U75 A;  3BIT A;  4FLL A;  4U6E A;  2GG7 A;  3FMQ A;  3TB5 A;  4IEC A;  1BN5 A;  1C27 A;  3L7G A;  4IU6 A;  5CLS A;  5CDL A;  4B28 A;  2EVC A;  1B59 A;  1YVM A;  1A16 A;  4ZWP A;  1KQ9 A;  4U70 A;  2BHD A;  5FCH A;  5FCF A;  1R58 A;  1QXZ A;  1QXY A;  3CB5 A;  4RGZ 1;  2Q95 A;  1QXW A;  2BHC A;  3FM3 A;  2EA4 A;  4PV4 A;  3PKC A;  3PKA A;  4FLI A;  4U69 A;  2P9A A;  2B3L A;  2GG9 A;  5CDV A;  2GG3 A;  1M35 A;  4S01 A;  3MX6 A;  4R60 A;  1YW7 A;  2DFI A;  2BWV A;  3L24 A;  3MR1 A;  2BWU A;  2GGC A;  2V3Z A;  3S6B A;  4EGE A;  2GGB A;  2B3K A;  4FUK A;  4JUQ A;  1R5H A;  3PKD A;  2GZ5 A;  1WLR A;  2ADU A;  5CDE A;  1C22 A;  1YW8 A;  2BH3 A;  1C23 A;  2G6P A;  3IU8 A;  1KP0 A;  2GA2 A;  2GG8 A;  2B3H A;  2ZSG A;  1WN1 A;  2GG5 A;  1XGN A;  2BWY A;  4S00 A;  4U76 A;  2HOW A;  4PNC A;  4FO7 A;  2EVM A;  4U73 A;  2GG0 A;  4U6J A;  4U6C A;  1YJ3 A;  2GU6 A;  1W7V A;  3TAV A;  4ZNG A;  3BIQ A;  1O0X A;  1C21 A;  1R5G A;  4IKT A;  2NQ6 A;  3BIP A;  2BWW A;  1PV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...