4FLJA

Human metap1 with bengamide analog y08, in mn form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fljA00
3S6BA 5CIKA 1B6AA 4U75A 2EVOA 2BWWA 3FMRA 1R5HA 1WKMA 5CLSA 4FLIA 4IECA 1WL9A 4S00A 4S01A 1KQ9A 2NQ7A 1BOAA 4IKTA 2V3XA 4RZZA 2BWUA 1YJ3A 4U76A 4ZWOA 3IU8A 1WBQA 4IDYA 1BN5A 5JFRA 1R5GA 2B3HA 2GG3A 3MR1A 3PKDA 4IKSA 2GZ5A 3FMQA 3BITA 2EA4A 4QR8A 4PV4A 4OOKA 2BWXA 1C24A 1O0XA 5D6FA 1C23A 4FLLA 1N51A 2V3ZA 1XNZA 1M35A 5FCHA 2GU7A 1R58A 1MATA 2BHCA 2B3LA 2MATA 1XGOA 1CHMA 2BHDA 2GG0A 2V3YA 1XGSA 4S2TP 1YW7A 2EVMA 2OKNA 2OAZA 4U70A 4IKRA 1W2MA 4IU6A 4R60A 2GGBA 3IU9A 1B59A 4FUKA 2GA2A 4FLKA 3L7GA 2P98A 2GG2A 3RORA 5FCFA 3FM3A 1YW8A 2BB7A 5CNXA 2Q92A 1C22A 3PKBA 2B3KA 4FO7A 4RZYA 3Q6DA 4ZNGA 3BIQA 2NQ6A 4MATA 4FO8A 3IG4A 5CDEA 2Q8KA 2BH3A 2GG9A 2Q95A 2BHAA 4ZWPA 2EA2A 5CE6A 1QXZA 2BWVA 5CDVA 5CDLA 2G6PA 1KP0A 2GU4A 3IU7A 4B28A 2Q94A 1C21A 1JAWA 4JUQA 3CB6A 2IW2A 4ZWUA 2GU5A 4HXXA 4KM3A 4U73A 2GG7A 4U1BA 1YVMA 2ZSGA 4Z7MA 1QXYA 2P99A 3RVAA 1C27A 1QXWA 2GTXA 1YW9A 3D27A 4S2RP 3CTZA 3PKEA 2BWSA 3TAVA 4EGEA 3BIPA 4A6VA 3PKAA 1WLRA 1WL6A 4U6EA 2V6CA 2GG8A 1W7VA 4IF7A 1KQ0A 1QZYA 4U6CA 4FKCA 1XGNA 4IKUA 4U71A 5E5BA 3MX6A 4U69A 3CB5A 2DFIA 2EVCA 3PKCA 5D6EA 1A16A 1PV9A 2BWYA 2BHBA 4IPAA 4U6JA 5JI6A 2Q96A 4U6WA 1WN1A 2GG5A 5JHUA 2GGCA 1Y1NA 4FLJA 4U6ZA 2BN7A 4A6WA 1WY2A 2P9AA 3TB5A 2HOWA 3MATA 4RGZ1 4PNCA 2ADUA 2BWTA 1XGMA 2GU6A 3L24A 2Q93A
chains in the Genus database with same CATH superfamily
3S6BA 5CIKA 1B6AA 4U75A 2EVOA 2BWWA 3FMRA 1R5HA 1WKMA 5CLSA 4FLIA 4IECA 1WL9A 4S00A 4S01A 1KQ9A 2NQ7A 1BOAA 4IKTA 2V3XA 4RZZA 2BWUA 1YJ3A 4U76A 4ZWOA 3IU8A 1WBQA 4IDYA 1BN5A 5JFRA 1R5GA 2B3HA 2GG3A 3MR1A 3PKDA 4IKSA 2GZ5A 3FMQA 3BITA 2EA4A 4QR8A 4PV4A 4OOKA 2BWXA 1C24A 1O0XA 5D6FA 1C23A 4FLLA 1N51A 2V3ZA 1XNZA 1M35A 5FCHA 2GU7A 1R58A 1MATA 2BHCA 2B3LA 2MATA 1XGOA 1CHMA 2BHDA 2GG0A 2V3YA 1XGSA 4S2TP 1YW7A 2EVMA 2OKNA 2OAZA 4U70A 4IKRA 1W2MA 4IU6A 4R60A 2GGBA 3IU9A 1B59A 4FUKA 2GA2A 4FLKA 3L7GA 2P98A 2GG2A 3RORA 5FCFA 3FM3A 1YW8A 2BB7A 5CNXA 2Q92A 1C22A 3PKBA 2B3KA 4FO7A 4RZYA 3Q6DA 4ZNGA 3BIQA 2NQ6A 4MATA 4FO8A 3IG4A 5CDEA 2Q8KA 2BH3A 2GG9A 2Q95A 2BHAA 4ZWPA 2EA2A 5CE6A 1QXZA 2BWVA 5CDVA 5CDLA 2G6PA 1KP0A 2GU4A 3IU7A 4B28A 2Q94A 1C21A 1JAWA 4JUQA 3CB6A 2IW2A 4ZWUA 2GU5A 4HXXA 4KM3A 4U73A 2GG7A 4U1BA 1YVMA 2ZSGA 4Z7MA 1QXYA 2P99A 3RVAA 1C27A 1QXWA 2GTXA 1YW9A 3D27A 4S2RP 3CTZA 3PKEA 2BWSA 3TAVA 4EGEA 3BIPA 4A6VA 3PKAA 1WLRA 1WL6A 4U6EA 2V6CA 2GG8A 1W7VA 4IF7A 1KQ0A 1QZYA 4U6CA 4FKCA 1XGNA 4IKUA 4U71A 5E5BA 3MX6A 4U69A 3CB5A 2DFIA 2EVCA 3PKCA 5D6EA 1A16A 1PV9A 2BWYA 2BHBA 4IPAA 4U6JA 5JI6A 2Q96A 4U6WA 1WN1A 2GG5A 5JHUA 2GGCA 1Y1NA 4FLJA 4U6ZA 2BN7A 4A6WA 1WY2A 2P9AA 3TB5A 2HOWA 3MATA 4RGZ1 4PNCA 2ADUA 2BWTA 1XGMA 2GU6A 3L24A 2Q93A
chains in the Genus database with same CATH topology
3S6BA 5CIKA 1B6AA 4U75A 2EVOA 2BWWA 3FMRA 1R5HA 1WKMA 5CLSA 4FLIA 4IECA 1WL9A 4S00A 4S01A 1KQ9A 2NQ7A 1BOAA 4IKTA 2V3XA 4RZZA 2BWUA 1YJ3A 4U76A 4ZWOA 3IU8A 1WBQA 4IDYA 1BN5A 5JFRA 1R5GA 2B3HA 2GG3A 3MR1A 3PKDA 4IKSA 2GZ5A 3FMQA 3BITA 2EA4A 4QR8A 4PV4A 4OOKA 2BWXA 1C24A 1O0XA 5D6FA 1C23A 4FLLA 1N51A 2V3ZA 1XNZA 1M35A 5FCHA 2GU7A 1R58A 1MATA 2BHCA 2B3LA 2MATA 1XGOA 1CHMA 2BHDA 2GG0A 2V3YA 1XGSA 4S2TP 1YW7A 2EVMA 2OKNA 2OAZA 4U70A 4IKRA 1W2MA 4IU6A 4R60A 2GGBA 3IU9A 1B59A 4FUKA 2GA2A 4FLKA 3L7GA 2P98A 2GG2A 3RORA 5FCFA 3FM3A 1YW8A 2BB7A 5CNXA 2Q92A 1C22A 3PKBA 2B3KA 4FO7A 4RZYA 3Q6DA 4ZNGA 3BIQA 2NQ6A 4MATA 4FO8A 3IG4A 5CDEA 2Q8KA 2BH3A 2GG9A 2Q95A 2BHAA 4ZWPA 2EA2A 5CE6A 1QXZA 2BWVA 5CDVA 5CDLA 2G6PA 1KP0A 2GU4A 3IU7A 4B28A 2Q94A 1C21A 1JAWA 4JUQA 3CB6A 2IW2A 4ZWUA 2GU5A 4HXXA 4KM3A 4U73A 2GG7A 4U1BA 1YVMA 2ZSGA 4Z7MA 1QXYA 2P99A 3RVAA 1C27A 1QXWA 2GTXA 1YW9A 3D27A 4S2RP 3CTZA 3PKEA 2BWSA 3TAVA 4EGEA 3BIPA 4A6VA 3PKAA 1WLRA 1WL6A 4U6EA 2V6CA 2GG8A 1W7VA 4IF7A 1KQ0A 1QZYA 4U6CA 4FKCA 1XGNA 4IKUA 4U71A 5E5BA 3MX6A 4U69A 3CB5A 2DFIA 2EVCA 3PKCA 5D6EA 1A16A 1PV9A 2BWYA 2BHBA 4IPAA 4U6JA 5JI6A 2Q96A 4U6WA 1WN1A 2GG5A 5JHUA 2GGCA 1Y1NA 4FLJA 4U6ZA 2BN7A 4A6WA 1WY2A 2P9AA 3TB5A 2HOWA 3MATA 4RGZ1 4PNCA 2ADUA 2BWTA 1XGMA 2GU6A 3L24A 2Q93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6B A;  5CIK A;  1B6A A;  4U75 A;  2EVO A;  2BWW A;  3FMR A;  1R5H A;  1WKM A;  5CLS A;  4FLI A;  4IEC A;  1WL9 A;  4S00 A;  4S01 A;  1KQ9 A;  2NQ7 A;  1BOA A;  4IKT A;  2V3X A;  4RZZ A;  2BWU A;  1YJ3 A;  4U76 A;  4ZWO A;  3IU8 A;  1WBQ A;  4IDY A;  1BN5 A;  5JFR A;  1R5G A;  2B3H A;  2GG3 A;  3MR1 A;  3PKD A;  4IKS A;  2GZ5 A;  3FMQ A;  3BIT A;  2EA4 A;  4QR8 A;  4PV4 A;  4OOK A;  2BWX A;  1C24 A;  1O0X A;  5D6F A;  1C23 A;  4FLL A;  1N51 A;  2V3Z A;  1XNZ A;  1M35 A;  5FCH A;  2GU7 A;  1R58 A;  1MAT A;  2BHC A;  2B3L A;  2MAT A;  1XGO A;  1CHM A;  2BHD A;  2GG0 A;  2V3Y A;  1XGS A;  4S2T P;  1YW7 A;  2EVM A;  2OKN A;  2OAZ A;  4U70 A;  4IKR A;  1W2M A;  4IU6 A;  4R60 A;  2GGB A;  3IU9 A;  1B59 A;  4FUK A;  2GA2 A;  4FLK A;  3L7G A;  2P98 A;  2GG2 A;  3ROR A;  5FCF A;  3FM3 A;  1YW8 A;  2BB7 A;  5CNX A;  2Q92 A;  1C22 A;  3PKB A;  2B3K A;  4FO7 A;  4RZY A;  3Q6D A;  4ZNG A;  3BIQ A;  2NQ6 A;  4MAT A;  4FO8 A;  3IG4 A;  5CDE A;  2Q8K A;  2BH3 A;  2GG9 A;  2Q95 A;  2BHA A;  4ZWP A;  2EA2 A;  5CE6 A;  1QXZ A;  2BWV A;  5CDV A;  5CDL A;  2G6P A;  1KP0 A;  2GU4 A;  3IU7 A;  4B28 A;  2Q94 A;  1C21 A;  1JAW A;  4JUQ A;  3CB6 A;  2IW2 A;  4ZWU A;  2GU5 A;  4HXX A;  4KM3 A;  4U73 A;  2GG7 A;  4U1B A;  1YVM A;  2ZSG A;  4Z7M A;  1QXY A;  2P99 A;  3RVA A;  1C27 A;  1QXW A;  2GTX A;  1YW9 A;  3D27 A;  4S2R P;  3CTZ A;  3PKE A;  2BWS A;  3TAV A;  4EGE A;  3BIP A;  4A6V A;  3PKA A;  1WLR A;  1WL6 A;  4U6E A;  2V6C A;  2GG8 A;  1W7V A;  4IF7 A;  1KQ0 A;  1QZY A;  4U6C A;  4FKC A;  1XGN A;  4IKU A;  4U71 A;  5E5B A;  3MX6 A;  4U69 A;  3CB5 A;  2DFI A;  2EVC A;  3PKC A;  5D6E A;  1A16 A;  1PV9 A;  2BWY A;  2BHB A;  4IPA A;  4U6J A;  5JI6 A;  2Q96 A;  4U6W A;  1WN1 A;  2GG5 A;  5JHU A;  2GGC A;  1Y1N A;  4FLJ A;  4U6Z A;  2BN7 A;  4A6W A;  1WY2 A;  2P9A A;  3TB5 A;  2HOW A;  3MAT A;  4RGZ 1;  4PNC A;  2ADU A;  2BWT A;  1XGM A;  2GU6 A;  3L24 A;  2Q93 A; 
#chains in the Genus database with same CATH topology
 3S6B A;  5CIK A;  1B6A A;  4U75 A;  2EVO A;  2BWW A;  3FMR A;  1R5H A;  1WKM A;  5CLS A;  4FLI A;  4IEC A;  1WL9 A;  4S00 A;  4S01 A;  1KQ9 A;  2NQ7 A;  1BOA A;  4IKT A;  2V3X A;  4RZZ A;  2BWU A;  1YJ3 A;  4U76 A;  4ZWO A;  3IU8 A;  1WBQ A;  4IDY A;  1BN5 A;  5JFR A;  1R5G A;  2B3H A;  2GG3 A;  3MR1 A;  3PKD A;  4IKS A;  2GZ5 A;  3FMQ A;  3BIT A;  2EA4 A;  4QR8 A;  4PV4 A;  4OOK A;  2BWX A;  1C24 A;  1O0X A;  5D6F A;  1C23 A;  4FLL A;  1N51 A;  2V3Z A;  1XNZ A;  1M35 A;  5FCH A;  2GU7 A;  1R58 A;  1MAT A;  2BHC A;  2B3L A;  2MAT A;  1XGO A;  1CHM A;  2BHD A;  2GG0 A;  2V3Y A;  1XGS A;  4S2T P;  1YW7 A;  2EVM A;  2OKN A;  2OAZ A;  4U70 A;  4IKR A;  1W2M A;  4IU6 A;  4R60 A;  2GGB A;  3IU9 A;  1B59 A;  4FUK A;  2GA2 A;  4FLK A;  3L7G A;  2P98 A;  2GG2 A;  3ROR A;  5FCF A;  3FM3 A;  1YW8 A;  2BB7 A;  5CNX A;  2Q92 A;  1C22 A;  3PKB A;  2B3K A;  4FO7 A;  4RZY A;  3Q6D A;  4ZNG A;  3BIQ A;  2NQ6 A;  4MAT A;  4FO8 A;  3IG4 A;  5CDE A;  2Q8K A;  2BH3 A;  2GG9 A;  2Q95 A;  2BHA A;  4ZWP A;  2EA2 A;  5CE6 A;  1QXZ A;  2BWV A;  5CDV A;  5CDL A;  2G6P A;  1KP0 A;  2GU4 A;  3IU7 A;  4B28 A;  2Q94 A;  1C21 A;  1JAW A;  4JUQ A;  3CB6 A;  2IW2 A;  4ZWU A;  2GU5 A;  4HXX A;  4KM3 A;  4U73 A;  2GG7 A;  4U1B A;  1YVM A;  2ZSG A;  4Z7M A;  1QXY A;  2P99 A;  3RVA A;  1C27 A;  1QXW A;  2GTX A;  1YW9 A;  3D27 A;  4S2R P;  3CTZ A;  3PKE A;  2BWS A;  3TAV A;  4EGE A;  3BIP A;  4A6V A;  3PKA A;  1WLR A;  1WL6 A;  4U6E A;  2V6C A;  2GG8 A;  1W7V A;  4IF7 A;  1KQ0 A;  1QZY A;  4U6C A;  4FKC A;  1XGN A;  4IKU A;  4U71 A;  5E5B A;  3MX6 A;  4U69 A;  3CB5 A;  2DFI A;  2EVC A;  3PKC A;  5D6E A;  1A16 A;  1PV9 A;  2BWY A;  2BHB A;  4IPA A;  4U6J A;  5JI6 A;  2Q96 A;  4U6W A;  1WN1 A;  2GG5 A;  5JHU A;  2GGC A;  1Y1N A;  4FLJ A;  4U6Z A;  2BN7 A;  4A6W A;  1WY2 A;  2P9A A;  3TB5 A;  2HOW A;  3MAT A;  4RGZ 1;  4PNC A;  2ADU A;  2BWT A;  1XGM A;  2GU6 A;  3L24 A;  2Q93 A; 
#chains in the Genus database with same CATH homology
 3S6B A;  5CIK A;  1B6A A;  4U75 A;  2EVO A;  2BWW A;  3FMR A;  1R5H A;  1WKM A;  5CLS A;  4FLI A;  4IEC A;  1WL9 A;  4S00 A;  4S01 A;  1KQ9 A;  2NQ7 A;  1BOA A;  4IKT A;  2V3X A;  4RZZ A;  2BWU A;  1YJ3 A;  4U76 A;  4ZWO A;  3IU8 A;  1WBQ A;  4IDY A;  1BN5 A;  5JFR A;  1R5G A;  2B3H A;  2GG3 A;  3MR1 A;  3PKD A;  4IKS A;  2GZ5 A;  3FMQ A;  3BIT A;  2EA4 A;  4QR8 A;  4PV4 A;  4OOK A;  2BWX A;  1C24 A;  1O0X A;  5D6F A;  1C23 A;  4FLL A;  1N51 A;  2V3Z A;  1XNZ A;  1M35 A;  5FCH A;  2GU7 A;  1R58 A;  1MAT A;  2BHC A;  2B3L A;  2MAT A;  1XGO A;  1CHM A;  2BHD A;  2GG0 A;  2V3Y A;  1XGS A;  4S2T P;  1YW7 A;  2EVM A;  2OKN A;  2OAZ A;  4U70 A;  4IKR A;  1W2M A;  4IU6 A;  4R60 A;  2GGB A;  3IU9 A;  1B59 A;  4FUK A;  2GA2 A;  4FLK A;  3L7G A;  2P98 A;  2GG2 A;  3ROR A;  5FCF A;  3FM3 A;  1YW8 A;  2BB7 A;  5CNX A;  2Q92 A;  1C22 A;  3PKB A;  2B3K A;  4FO7 A;  4RZY A;  3Q6D A;  4ZNG A;  3BIQ A;  2NQ6 A;  4MAT A;  4FO8 A;  3IG4 A;  5CDE A;  2Q8K A;  2BH3 A;  2GG9 A;  2Q95 A;  2BHA A;  4ZWP A;  2EA2 A;  5CE6 A;  1QXZ A;  2BWV A;  5CDV A;  5CDL A;  2G6P A;  1KP0 A;  2GU4 A;  3IU7 A;  4B28 A;  2Q94 A;  1C21 A;  1JAW A;  4JUQ A;  3CB6 A;  2IW2 A;  4ZWU A;  2GU5 A;  4HXX A;  4KM3 A;  4U73 A;  2GG7 A;  4U1B A;  1YVM A;  2ZSG A;  4Z7M A;  1QXY A;  2P99 A;  3RVA A;  1C27 A;  1QXW A;  2GTX A;  1YW9 A;  3D27 A;  4S2R P;  3CTZ A;  3PKE A;  2BWS A;  3TAV A;  4EGE A;  3BIP A;  4A6V A;  3PKA A;  1WLR A;  1WL6 A;  4U6E A;  2V6C A;  2GG8 A;  1W7V A;  4IF7 A;  1KQ0 A;  1QZY A;  4U6C A;  4FKC A;  1XGN A;  4IKU A;  4U71 A;  5E5B A;  3MX6 A;  4U69 A;  3CB5 A;  2DFI A;  2EVC A;  3PKC A;  5D6E A;  1A16 A;  1PV9 A;  2BWY A;  2BHB A;  4IPA A;  4U6J A;  5JI6 A;  2Q96 A;  4U6W A;  1WN1 A;  2GG5 A;  5JHU A;  2GGC A;  1Y1N A;  4FLJ A;  4U6Z A;  2BN7 A;  4A6W A;  1WY2 A;  2P9A A;  3TB5 A;  2HOW A;  3MAT A;  4RGZ 1;  4PNC A;  2ADU A;  2BWT A;  1XGM A;  2GU6 A;  3L24 A;  2Q93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...