2B3HA

Crystal structure of human methionine aminopeptidase type i with a third cobalt in the active site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3hA00
4IF7A 4IU6A 2B3KA 1BOAA 1JAWA 2GG9A 2BWYA 3S6BA 3RVAA 1KQ0A 1A16A 2BHDA 4FO8A 2GU7A 3PKEA 2Q8KA 1B59A 4IKSA 2GZ5A 4FO7A 3CTZA 3TB5A 5CDEA 4ZNGA 2Q93A 2P9AA 5E5BA 4U6EA 4IECA 2GG7A 2V3XA 4HXXA 2ZSGA 2ADUA 2OKNA 1WBQA 4KM3A 4U76A 4RZYA 4U1BA 4IKTA 2GTXA 1XGNA 4U71A 2V6CA 1R5GA 3FMRA 3IU7A 4FLKA 4A6VA 4S2RP 4S01A 2BHAA 5CDVA 2Q94A 1BN5A 4RZZA 3FMQA 1W7VA 4ZWPA 1WY2A 2V3YA 2BWTA 1MATA 1YW9A 2IW2A 5JI6A 3TAVA 2GG0A 4S00A 1N51A 1QXYA 2BWWA 2GU5A 5D6EA 1QXWA 2GG8A 1C23A 2GG5A 1QZYA 2GU4A 2BHBA 2Q96A 3MR1A 3CB6A 4U73A 4ZWOA 3PKDA 1WKMA 2EA4A 4U70A 2GGCA 4U6WA 5FCFA 4QR8A 5FCHA 1KQ9A 3PKCA 2BWUA 3D27A 3MX6A 4JUQA 5JHUA 4IDYA 1R5HA 1PV9A 2EVMA 3PKAA 3Q6DA 3BITA 1B6AA 4ZWUA 1C27A 5D6FA 1C21A 1W2MA 1C22A 2EVCA 4OOKA 4PV4A 5CIKA 4FKCA 1YVMA 2GG3A 1YW7A 2Q95A 2BH3A 2BN7A 3BIPA 4FUKA 5CLSA 3MATA 5CNXA 3FM3A 1XGOA 4Z7MA 3IU9A 2GGBA 2EVOA 2G6PA 3L24A 1WLRA 5CDLA 2B3LA 4B28A 4U6ZA 1WL9A 1Y1NA 2GA2A 3CB5A 1XNZA 1XGMA 1YJ3A 2Q92A 1WN1A 4U6JA 1C24A 1O0XA 4EGEA 1M35A 2EA2A 4IPAA 4U6CA 2B3HA 2GG2A 1WL6A 2GU6A 4IKRA 3IG4A 3L7GA 1CHMA 1KP0A 2V3ZA 2BB7A 3IU8A 3RORA 4R60A 4MATA 3PKBA 4FLLA 4A6WA 2BHCA 2P98A 2NQ7A 2NQ6A 2DFIA 2BWSA 2P99A 1R58A 2BWVA 2MATA 4U69A 4FLIA 1QXZA 1XGSA 2BWXA 4PNCA 4IKUA 4S2TP 4RGZ1 2OAZA 2HOWA 5JFRA 5CE6A 1YW8A 3BIQA 4U75A 4FLJA
chains in the Genus database with same CATH superfamily
4IF7A 4IU6A 2B3KA 1BOAA 1JAWA 2GG9A 2BWYA 3S6BA 3RVAA 1KQ0A 1A16A 2BHDA 4FO8A 2GU7A 3PKEA 2Q8KA 1B59A 4IKSA 2GZ5A 4FO7A 3CTZA 3TB5A 5CDEA 4ZNGA 2Q93A 2P9AA 5E5BA 4U6EA 4IECA 2GG7A 2V3XA 4HXXA 2ZSGA 2ADUA 2OKNA 1WBQA 4KM3A 4U76A 4RZYA 4U1BA 4IKTA 2GTXA 1XGNA 4U71A 2V6CA 1R5GA 3FMRA 3IU7A 4FLKA 4A6VA 4S2RP 4S01A 2BHAA 5CDVA 2Q94A 1BN5A 4RZZA 3FMQA 1W7VA 4ZWPA 1WY2A 2V3YA 2BWTA 1MATA 1YW9A 2IW2A 5JI6A 3TAVA 2GG0A 4S00A 1N51A 1QXYA 2BWWA 2GU5A 5D6EA 1QXWA 2GG8A 1C23A 2GG5A 1QZYA 2GU4A 2BHBA 2Q96A 3MR1A 3CB6A 4U73A 4ZWOA 3PKDA 1WKMA 2EA4A 4U70A 2GGCA 4U6WA 5FCFA 4QR8A 5FCHA 1KQ9A 3PKCA 2BWUA 3D27A 3MX6A 4JUQA 5JHUA 4IDYA 1R5HA 1PV9A 2EVMA 3PKAA 3Q6DA 3BITA 1B6AA 4ZWUA 1C27A 5D6FA 1C21A 1W2MA 1C22A 2EVCA 4OOKA 4PV4A 5CIKA 4FKCA 1YVMA 2GG3A 1YW7A 2Q95A 2BH3A 2BN7A 3BIPA 4FUKA 5CLSA 3MATA 5CNXA 3FM3A 1XGOA 4Z7MA 3IU9A 2GGBA 2EVOA 2G6PA 3L24A 1WLRA 5CDLA 2B3LA 4B28A 4U6ZA 1WL9A 1Y1NA 2GA2A 3CB5A 1XNZA 1XGMA 1YJ3A 2Q92A 1WN1A 4U6JA 1C24A 1O0XA 4EGEA 1M35A 2EA2A 4IPAA 4U6CA 2B3HA 2GG2A 1WL6A 2GU6A 4IKRA 3IG4A 3L7GA 1CHMA 1KP0A 2V3ZA 2BB7A 3IU8A 3RORA 4R60A 4MATA 3PKBA 4FLLA 4A6WA 2BHCA 2P98A 2NQ7A 2NQ6A 2DFIA 2BWSA 2P99A 1R58A 2BWVA 2MATA 4U69A 4FLIA 1QXZA 1XGSA 2BWXA 4PNCA 4IKUA 4S2TP 4RGZ1 2OAZA 2HOWA 5JFRA 5CE6A 1YW8A 3BIQA 4U75A 4FLJA
chains in the Genus database with same CATH topology
4IF7A 4IU6A 2B3KA 1BOAA 1JAWA 2GG9A 2BWYA 3S6BA 3RVAA 1KQ0A 1A16A 2BHDA 4FO8A 2GU7A 3PKEA 2Q8KA 1B59A 4IKSA 2GZ5A 4FO7A 3CTZA 3TB5A 5CDEA 4ZNGA 2Q93A 2P9AA 5E5BA 4U6EA 4IECA 2GG7A 2V3XA 4HXXA 2ZSGA 2ADUA 2OKNA 1WBQA 4KM3A 4U76A 4RZYA 4U1BA 4IKTA 2GTXA 1XGNA 4U71A 2V6CA 1R5GA 3FMRA 3IU7A 4FLKA 4A6VA 4S2RP 4S01A 2BHAA 5CDVA 2Q94A 1BN5A 4RZZA 3FMQA 1W7VA 4ZWPA 1WY2A 2V3YA 2BWTA 1MATA 1YW9A 2IW2A 5JI6A 3TAVA 2GG0A 4S00A 1N51A 1QXYA 2BWWA 2GU5A 5D6EA 1QXWA 2GG8A 1C23A 2GG5A 1QZYA 2GU4A 2BHBA 2Q96A 3MR1A 3CB6A 4U73A 4ZWOA 3PKDA 1WKMA 2EA4A 4U70A 2GGCA 4U6WA 5FCFA 4QR8A 5FCHA 1KQ9A 3PKCA 2BWUA 3D27A 3MX6A 4JUQA 5JHUA 4IDYA 1R5HA 1PV9A 2EVMA 3PKAA 3Q6DA 3BITA 1B6AA 4ZWUA 1C27A 5D6FA 1C21A 1W2MA 1C22A 2EVCA 4OOKA 4PV4A 5CIKA 4FKCA 1YVMA 2GG3A 1YW7A 2Q95A 2BH3A 2BN7A 3BIPA 4FUKA 5CLSA 3MATA 5CNXA 3FM3A 1XGOA 4Z7MA 3IU9A 2GGBA 2EVOA 2G6PA 3L24A 1WLRA 5CDLA 2B3LA 4B28A 4U6ZA 1WL9A 1Y1NA 2GA2A 3CB5A 1XNZA 1XGMA 1YJ3A 2Q92A 1WN1A 4U6JA 1C24A 1O0XA 4EGEA 1M35A 2EA2A 4IPAA 4U6CA 2B3HA 2GG2A 1WL6A 2GU6A 4IKRA 3IG4A 3L7GA 1CHMA 1KP0A 2V3ZA 2BB7A 3IU8A 3RORA 4R60A 4MATA 3PKBA 4FLLA 4A6WA 2BHCA 2P98A 2NQ7A 2NQ6A 2DFIA 2BWSA 2P99A 1R58A 2BWVA 2MATA 4U69A 4FLIA 1QXZA 1XGSA 2BWXA 4PNCA 4IKUA 4S2TP 4RGZ1 2OAZA 2HOWA 5JFRA 5CE6A 1YW8A 3BIQA 4U75A 4FLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF7 A;  4IU6 A;  2B3K A;  1BOA A;  1JAW A;  2GG9 A;  2BWY A;  3S6B A;  3RVA A;  1KQ0 A;  1A16 A;  2BHD A;  4FO8 A;  2GU7 A;  3PKE A;  2Q8K A;  1B59 A;  4IKS A;  2GZ5 A;  4FO7 A;  3CTZ A;  3TB5 A;  5CDE A;  4ZNG A;  2Q93 A;  2P9A A;  5E5B A;  4U6E A;  4IEC A;  2GG7 A;  2V3X A;  4HXX A;  2ZSG A;  2ADU A;  2OKN A;  1WBQ A;  4KM3 A;  4U76 A;  4RZY A;  4U1B A;  4IKT A;  2GTX A;  1XGN A;  4U71 A;  2V6C A;  1R5G A;  3FMR A;  3IU7 A;  4FLK A;  4A6V A;  4S2R P;  4S01 A;  2BHA A;  5CDV A;  2Q94 A;  1BN5 A;  4RZZ A;  3FMQ A;  1W7V A;  4ZWP A;  1WY2 A;  2V3Y A;  2BWT A;  1MAT A;  1YW9 A;  2IW2 A;  5JI6 A;  3TAV A;  2GG0 A;  4S00 A;  1N51 A;  1QXY A;  2BWW A;  2GU5 A;  5D6E A;  1QXW A;  2GG8 A;  1C23 A;  2GG5 A;  1QZY A;  2GU4 A;  2BHB A;  2Q96 A;  3MR1 A;  3CB6 A;  4U73 A;  4ZWO A;  3PKD A;  1WKM A;  2EA4 A;  4U70 A;  2GGC A;  4U6W A;  5FCF A;  4QR8 A;  5FCH A;  1KQ9 A;  3PKC A;  2BWU A;  3D27 A;  3MX6 A;  4JUQ A;  5JHU A;  4IDY A;  1R5H A;  1PV9 A;  2EVM A;  3PKA A;  3Q6D A;  3BIT A;  1B6A A;  4ZWU A;  1C27 A;  5D6F A;  1C21 A;  1W2M A;  1C22 A;  2EVC A;  4OOK A;  4PV4 A;  5CIK A;  4FKC A;  1YVM A;  2GG3 A;  1YW7 A;  2Q95 A;  2BH3 A;  2BN7 A;  3BIP A;  4FUK A;  5CLS A;  3MAT A;  5CNX A;  3FM3 A;  1XGO A;  4Z7M A;  3IU9 A;  2GGB A;  2EVO A;  2G6P A;  3L24 A;  1WLR A;  5CDL A;  2B3L A;  4B28 A;  4U6Z A;  1WL9 A;  1Y1N A;  2GA2 A;  3CB5 A;  1XNZ A;  1XGM A;  1YJ3 A;  2Q92 A;  1WN1 A;  4U6J A;  1C24 A;  1O0X A;  4EGE A;  1M35 A;  2EA2 A;  4IPA A;  4U6C A;  2B3H A;  2GG2 A;  1WL6 A;  2GU6 A;  4IKR A;  3IG4 A;  3L7G A;  1CHM A;  1KP0 A;  2V3Z A;  2BB7 A;  3IU8 A;  3ROR A;  4R60 A;  4MAT A;  3PKB A;  4FLL A;  4A6W A;  2BHC A;  2P98 A;  2NQ7 A;  2NQ6 A;  2DFI A;  2BWS A;  2P99 A;  1R58 A;  2BWV A;  2MAT A;  4U69 A;  4FLI A;  1QXZ A;  1XGS A;  2BWX A;  4PNC A;  4IKU A;  4S2T P;  4RGZ 1;  2OAZ A;  2HOW A;  5JFR A;  5CE6 A;  1YW8 A;  3BIQ A;  4U75 A;  4FLJ A; 
#chains in the Genus database with same CATH topology
 4IF7 A;  4IU6 A;  2B3K A;  1BOA A;  1JAW A;  2GG9 A;  2BWY A;  3S6B A;  3RVA A;  1KQ0 A;  1A16 A;  2BHD A;  4FO8 A;  2GU7 A;  3PKE A;  2Q8K A;  1B59 A;  4IKS A;  2GZ5 A;  4FO7 A;  3CTZ A;  3TB5 A;  5CDE A;  4ZNG A;  2Q93 A;  2P9A A;  5E5B A;  4U6E A;  4IEC A;  2GG7 A;  2V3X A;  4HXX A;  2ZSG A;  2ADU A;  2OKN A;  1WBQ A;  4KM3 A;  4U76 A;  4RZY A;  4U1B A;  4IKT A;  2GTX A;  1XGN A;  4U71 A;  2V6C A;  1R5G A;  3FMR A;  3IU7 A;  4FLK A;  4A6V A;  4S2R P;  4S01 A;  2BHA A;  5CDV A;  2Q94 A;  1BN5 A;  4RZZ A;  3FMQ A;  1W7V A;  4ZWP A;  1WY2 A;  2V3Y A;  2BWT A;  1MAT A;  1YW9 A;  2IW2 A;  5JI6 A;  3TAV A;  2GG0 A;  4S00 A;  1N51 A;  1QXY A;  2BWW A;  2GU5 A;  5D6E A;  1QXW A;  2GG8 A;  1C23 A;  2GG5 A;  1QZY A;  2GU4 A;  2BHB A;  2Q96 A;  3MR1 A;  3CB6 A;  4U73 A;  4ZWO A;  3PKD A;  1WKM A;  2EA4 A;  4U70 A;  2GGC A;  4U6W A;  5FCF A;  4QR8 A;  5FCH A;  1KQ9 A;  3PKC A;  2BWU A;  3D27 A;  3MX6 A;  4JUQ A;  5JHU A;  4IDY A;  1R5H A;  1PV9 A;  2EVM A;  3PKA A;  3Q6D A;  3BIT A;  1B6A A;  4ZWU A;  1C27 A;  5D6F A;  1C21 A;  1W2M A;  1C22 A;  2EVC A;  4OOK A;  4PV4 A;  5CIK A;  4FKC A;  1YVM A;  2GG3 A;  1YW7 A;  2Q95 A;  2BH3 A;  2BN7 A;  3BIP A;  4FUK A;  5CLS A;  3MAT A;  5CNX A;  3FM3 A;  1XGO A;  4Z7M A;  3IU9 A;  2GGB A;  2EVO A;  2G6P A;  3L24 A;  1WLR A;  5CDL A;  2B3L A;  4B28 A;  4U6Z A;  1WL9 A;  1Y1N A;  2GA2 A;  3CB5 A;  1XNZ A;  1XGM A;  1YJ3 A;  2Q92 A;  1WN1 A;  4U6J A;  1C24 A;  1O0X A;  4EGE A;  1M35 A;  2EA2 A;  4IPA A;  4U6C A;  2B3H A;  2GG2 A;  1WL6 A;  2GU6 A;  4IKR A;  3IG4 A;  3L7G A;  1CHM A;  1KP0 A;  2V3Z A;  2BB7 A;  3IU8 A;  3ROR A;  4R60 A;  4MAT A;  3PKB A;  4FLL A;  4A6W A;  2BHC A;  2P98 A;  2NQ7 A;  2NQ6 A;  2DFI A;  2BWS A;  2P99 A;  1R58 A;  2BWV A;  2MAT A;  4U69 A;  4FLI A;  1QXZ A;  1XGS A;  2BWX A;  4PNC A;  4IKU A;  4S2T P;  4RGZ 1;  2OAZ A;  2HOW A;  5JFR A;  5CE6 A;  1YW8 A;  3BIQ A;  4U75 A;  4FLJ A; 
#chains in the Genus database with same CATH homology
 4IF7 A;  4IU6 A;  2B3K A;  1BOA A;  1JAW A;  2GG9 A;  2BWY A;  3S6B A;  3RVA A;  1KQ0 A;  1A16 A;  2BHD A;  4FO8 A;  2GU7 A;  3PKE A;  2Q8K A;  1B59 A;  4IKS A;  2GZ5 A;  4FO7 A;  3CTZ A;  3TB5 A;  5CDE A;  4ZNG A;  2Q93 A;  2P9A A;  5E5B A;  4U6E A;  4IEC A;  2GG7 A;  2V3X A;  4HXX A;  2ZSG A;  2ADU A;  2OKN A;  1WBQ A;  4KM3 A;  4U76 A;  4RZY A;  4U1B A;  4IKT A;  2GTX A;  1XGN A;  4U71 A;  2V6C A;  1R5G A;  3FMR A;  3IU7 A;  4FLK A;  4A6V A;  4S2R P;  4S01 A;  2BHA A;  5CDV A;  2Q94 A;  1BN5 A;  4RZZ A;  3FMQ A;  1W7V A;  4ZWP A;  1WY2 A;  2V3Y A;  2BWT A;  1MAT A;  1YW9 A;  2IW2 A;  5JI6 A;  3TAV A;  2GG0 A;  4S00 A;  1N51 A;  1QXY A;  2BWW A;  2GU5 A;  5D6E A;  1QXW A;  2GG8 A;  1C23 A;  2GG5 A;  1QZY A;  2GU4 A;  2BHB A;  2Q96 A;  3MR1 A;  3CB6 A;  4U73 A;  4ZWO A;  3PKD A;  1WKM A;  2EA4 A;  4U70 A;  2GGC A;  4U6W A;  5FCF A;  4QR8 A;  5FCH A;  1KQ9 A;  3PKC A;  2BWU A;  3D27 A;  3MX6 A;  4JUQ A;  5JHU A;  4IDY A;  1R5H A;  1PV9 A;  2EVM A;  3PKA A;  3Q6D A;  3BIT A;  1B6A A;  4ZWU A;  1C27 A;  5D6F A;  1C21 A;  1W2M A;  1C22 A;  2EVC A;  4OOK A;  4PV4 A;  5CIK A;  4FKC A;  1YVM A;  2GG3 A;  1YW7 A;  2Q95 A;  2BH3 A;  2BN7 A;  3BIP A;  4FUK A;  5CLS A;  3MAT A;  5CNX A;  3FM3 A;  1XGO A;  4Z7M A;  3IU9 A;  2GGB A;  2EVO A;  2G6P A;  3L24 A;  1WLR A;  5CDL A;  2B3L A;  4B28 A;  4U6Z A;  1WL9 A;  1Y1N A;  2GA2 A;  3CB5 A;  1XNZ A;  1XGM A;  1YJ3 A;  2Q92 A;  1WN1 A;  4U6J A;  1C24 A;  1O0X A;  4EGE A;  1M35 A;  2EA2 A;  4IPA A;  4U6C A;  2B3H A;  2GG2 A;  1WL6 A;  2GU6 A;  4IKR A;  3IG4 A;  3L7G A;  1CHM A;  1KP0 A;  2V3Z A;  2BB7 A;  3IU8 A;  3ROR A;  4R60 A;  4MAT A;  3PKB A;  4FLL A;  4A6W A;  2BHC A;  2P98 A;  2NQ7 A;  2NQ6 A;  2DFI A;  2BWS A;  2P99 A;  1R58 A;  2BWV A;  2MAT A;  4U69 A;  4FLI A;  1QXZ A;  1XGS A;  2BWX A;  4PNC A;  4IKU A;  4S2T P;  4RGZ 1;  2OAZ A;  2HOW A;  5JFR A;  5CE6 A;  1YW8 A;  3BIQ A;  4U75 A;  4FLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...