2B3HA

Crystal structure of human methionine aminopeptidase type i with a third cobalt in the active site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3hA00
1WN1A 4S2TP 5CDEA 3PKEA 2EA4A 2GG9A 4PV4A 2GA2A 4FUKA 3MR1A 1C23A 1B6AA 4U6CA 4S00A 4U6WA 5CIKA 5CNXA 4R60A 1N51A 5CE6A 1R5GA 3L24A 1W2MA 2GGCA 3PKAA 2BWUA 1YW9A 4RZYA 4KM3A 1XGMA 1XNZA 3PKDA 1YW8A 2IW2A 4IU6A 2B3LA 4RGZ1 4RZZA 3PKCA 3Q6DA 4U73A 3FMRA 5FCFA 1A16A 4ZWPA 2BHAA 2Q94A 2GU6A 3CB5A 2P99A 4U76A 2GU5A 4IKRA 1QXYA 4U1BA 4FO7A 1XGNA 1WL9A 1QXZA 2P98A 3IU9A 1QZYA 1B59A 2EVOA 2V3XA 4A6WA 3FMQA 2BHBA 2NQ6A 3TB5A 2V3YA 2GG0A 3CB6A 4U6EA 4IPAA 2V6CA 2BHDA 4FO8A 5FCHA 4IKTA 4U69A 4IECA 2DFIA 1BN5A 4U71A 4Z7MA 2BWXA 1KQ0A 4U70A 2GZ5A 2P9AA 4FLKA 4IKSA 5E5BA 4HXXA 1C24A 3IU7A 5JI6A 1M35A 4ZWOA 1Y1NA 2BB7A 2V3ZA 4MATA 2EVCA 4FLLA 2Q95A 1C21A 2GG8A 4S01A 2Q93A 1C22A 4FLIA 1WY2A 1QXWA 3MX6A 3D27A 3S6BA 2B3HA 2G6PA 4IF7A 4OOKA 1C27A 2BWWA 1MATA 2GGBA 1R5HA 2ADUA 2EVMA 2GG2A 3BIQA 2NQ7A 3TAVA 4FKCA 3BIPA 4A6VA 4U6ZA 1YJ3A 1KP0A 4U6JA 2BN7A 3L7GA 2GG5A 2HOWA 5CDLA 3PKBA 1O0XA 2GG7A 1WBQA 4FLJA 4EGEA 4U75A 2MATA 3FM3A 4ZWUA 2GU7A 1YVMA 3IG4A 5CLSA 3IU8A 2EA2A 3RVAA 1YW7A 2GG3A 5CDVA 2OAZA 4ZNGA 4B28A 2BH3A 1XGOA 2Q8KA 1CHMA 4JUQA 1KQ9A 2ZSGA 2BWTA 2GU4A 1PV9A 1WKMA 2BWSA 1WL6A 1XGSA 2OKNA 5JFRA 4S2RP 2B3KA 4IKUA 5D6EA 3BITA 1BOAA 2BWYA 2Q96A 1JAWA 2Q92A 2GTXA 1WLRA 4IDYA 2BWVA 5D6FA 1W7VA 3CTZA 3MATA 5JHUA 4PNCA 4QR8A 3RORA 1R58A 2BHCA
chains in the Genus database with same CATH superfamily
1WN1A 4S2TP 5CDEA 3PKEA 2EA4A 2GG9A 4PV4A 2GA2A 4FUKA 3MR1A 1C23A 1B6AA 4U6CA 4S00A 4U6WA 5CIKA 5CNXA 4R60A 1N51A 5CE6A 1R5GA 3L24A 1W2MA 2GGCA 3PKAA 2BWUA 1YW9A 4RZYA 4KM3A 1XGMA 1XNZA 3PKDA 1YW8A 2IW2A 4IU6A 2B3LA 4RGZ1 4RZZA 3PKCA 3Q6DA 4U73A 3FMRA 5FCFA 1A16A 4ZWPA 2BHAA 2Q94A 2GU6A 3CB5A 2P99A 4U76A 2GU5A 4IKRA 1QXYA 4U1BA 4FO7A 1XGNA 1WL9A 1QXZA 2P98A 3IU9A 1QZYA 1B59A 2EVOA 2V3XA 4A6WA 3FMQA 2BHBA 2NQ6A 3TB5A 2V3YA 2GG0A 3CB6A 4U6EA 4IPAA 2V6CA 2BHDA 4FO8A 5FCHA 4IKTA 4U69A 4IECA 2DFIA 1BN5A 4U71A 4Z7MA 2BWXA 1KQ0A 4U70A 2GZ5A 2P9AA 4FLKA 4IKSA 5E5BA 4HXXA 1C24A 3IU7A 5JI6A 1M35A 4ZWOA 1Y1NA 2BB7A 2V3ZA 4MATA 2EVCA 4FLLA 2Q95A 1C21A 2GG8A 4S01A 2Q93A 1C22A 4FLIA 1WY2A 1QXWA 3MX6A 3D27A 3S6BA 2B3HA 2G6PA 4IF7A 4OOKA 1C27A 2BWWA 1MATA 2GGBA 1R5HA 2ADUA 2EVMA 2GG2A 3BIQA 2NQ7A 3TAVA 4FKCA 3BIPA 4A6VA 4U6ZA 1YJ3A 1KP0A 4U6JA 2BN7A 3L7GA 2GG5A 2HOWA 5CDLA 3PKBA 1O0XA 2GG7A 1WBQA 4FLJA 4EGEA 4U75A 2MATA 3FM3A 4ZWUA 2GU7A 1YVMA 3IG4A 5CLSA 3IU8A 2EA2A 3RVAA 1YW7A 2GG3A 5CDVA 2OAZA 4ZNGA 4B28A 2BH3A 1XGOA 2Q8KA 1CHMA 4JUQA 1KQ9A 2ZSGA 2BWTA 2GU4A 1PV9A 1WKMA 2BWSA 1WL6A 1XGSA 2OKNA 5JFRA 4S2RP 2B3KA 4IKUA 5D6EA 3BITA 1BOAA 2BWYA 2Q96A 1JAWA 2Q92A 2GTXA 1WLRA 4IDYA 2BWVA 5D6FA 1W7VA 3CTZA 3MATA 5JHUA 4PNCA 4QR8A 3RORA 1R58A 2BHCA
chains in the Genus database with same CATH topology
1WN1A 4S2TP 5CDEA 3PKEA 2EA4A 2GG9A 4PV4A 2GA2A 4FUKA 3MR1A 1C23A 1B6AA 4U6CA 4S00A 4U6WA 5CIKA 5CNXA 4R60A 1N51A 5CE6A 1R5GA 3L24A 1W2MA 2GGCA 3PKAA 2BWUA 1YW9A 4RZYA 4KM3A 1XGMA 1XNZA 3PKDA 1YW8A 2IW2A 4IU6A 2B3LA 4RGZ1 4RZZA 3PKCA 3Q6DA 4U73A 3FMRA 5FCFA 1A16A 4ZWPA 2BHAA 2Q94A 2GU6A 3CB5A 2P99A 4U76A 2GU5A 4IKRA 1QXYA 4U1BA 4FO7A 1XGNA 1WL9A 1QXZA 2P98A 3IU9A 1QZYA 1B59A 2EVOA 2V3XA 4A6WA 3FMQA 2BHBA 2NQ6A 3TB5A 2V3YA 2GG0A 3CB6A 4U6EA 4IPAA 2V6CA 2BHDA 4FO8A 5FCHA 4IKTA 4U69A 4IECA 2DFIA 1BN5A 4U71A 4Z7MA 2BWXA 1KQ0A 4U70A 2GZ5A 2P9AA 4FLKA 4IKSA 5E5BA 4HXXA 1C24A 3IU7A 5JI6A 1M35A 4ZWOA 1Y1NA 2BB7A 2V3ZA 4MATA 2EVCA 4FLLA 2Q95A 1C21A 2GG8A 4S01A 2Q93A 1C22A 4FLIA 1WY2A 1QXWA 3MX6A 3D27A 3S6BA 2B3HA 2G6PA 4IF7A 4OOKA 1C27A 2BWWA 1MATA 2GGBA 1R5HA 2ADUA 2EVMA 2GG2A 3BIQA 2NQ7A 3TAVA 4FKCA 3BIPA 4A6VA 4U6ZA 1YJ3A 1KP0A 4U6JA 2BN7A 3L7GA 2GG5A 2HOWA 5CDLA 3PKBA 1O0XA 2GG7A 1WBQA 4FLJA 4EGEA 4U75A 2MATA 3FM3A 4ZWUA 2GU7A 1YVMA 3IG4A 5CLSA 3IU8A 2EA2A 3RVAA 1YW7A 2GG3A 5CDVA 2OAZA 4ZNGA 4B28A 2BH3A 1XGOA 2Q8KA 1CHMA 4JUQA 1KQ9A 2ZSGA 2BWTA 2GU4A 1PV9A 1WKMA 2BWSA 1WL6A 1XGSA 2OKNA 5JFRA 4S2RP 2B3KA 4IKUA 5D6EA 3BITA 1BOAA 2BWYA 2Q96A 1JAWA 2Q92A 2GTXA 1WLRA 4IDYA 2BWVA 5D6FA 1W7VA 3CTZA 3MATA 5JHUA 4PNCA 4QR8A 3RORA 1R58A 2BHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WN1 A;  4S2T P;  5CDE A;  3PKE A;  2EA4 A;  2GG9 A;  4PV4 A;  2GA2 A;  4FUK A;  3MR1 A;  1C23 A;  1B6A A;  4U6C A;  4S00 A;  4U6W A;  5CIK A;  5CNX A;  4R60 A;  1N51 A;  5CE6 A;  1R5G A;  3L24 A;  1W2M A;  2GGC A;  3PKA A;  2BWU A;  1YW9 A;  4RZY A;  4KM3 A;  1XGM A;  1XNZ A;  3PKD A;  1YW8 A;  2IW2 A;  4IU6 A;  2B3L A;  4RGZ 1;  4RZZ A;  3PKC A;  3Q6D A;  4U73 A;  3FMR A;  5FCF A;  1A16 A;  4ZWP A;  2BHA A;  2Q94 A;  2GU6 A;  3CB5 A;  2P99 A;  4U76 A;  2GU5 A;  4IKR A;  1QXY A;  4U1B A;  4FO7 A;  1XGN A;  1WL9 A;  1QXZ A;  2P98 A;  3IU9 A;  1QZY A;  1B59 A;  2EVO A;  2V3X A;  4A6W A;  3FMQ A;  2BHB A;  2NQ6 A;  3TB5 A;  2V3Y A;  2GG0 A;  3CB6 A;  4U6E A;  4IPA A;  2V6C A;  2BHD A;  4FO8 A;  5FCH A;  4IKT A;  4U69 A;  4IEC A;  2DFI A;  1BN5 A;  4U71 A;  4Z7M A;  2BWX A;  1KQ0 A;  4U70 A;  2GZ5 A;  2P9A A;  4FLK A;  4IKS A;  5E5B A;  4HXX A;  1C24 A;  3IU7 A;  5JI6 A;  1M35 A;  4ZWO A;  1Y1N A;  2BB7 A;  2V3Z A;  4MAT A;  2EVC A;  4FLL A;  2Q95 A;  1C21 A;  2GG8 A;  4S01 A;  2Q93 A;  1C22 A;  4FLI A;  1WY2 A;  1QXW A;  3MX6 A;  3D27 A;  3S6B A;  2B3H A;  2G6P A;  4IF7 A;  4OOK A;  1C27 A;  2BWW A;  1MAT A;  2GGB A;  1R5H A;  2ADU A;  2EVM A;  2GG2 A;  3BIQ A;  2NQ7 A;  3TAV A;  4FKC A;  3BIP A;  4A6V A;  4U6Z A;  1YJ3 A;  1KP0 A;  4U6J A;  2BN7 A;  3L7G A;  2GG5 A;  2HOW A;  5CDL A;  3PKB A;  1O0X A;  2GG7 A;  1WBQ A;  4FLJ A;  4EGE A;  4U75 A;  2MAT A;  3FM3 A;  4ZWU A;  2GU7 A;  1YVM A;  3IG4 A;  5CLS A;  3IU8 A;  2EA2 A;  3RVA A;  1YW7 A;  2GG3 A;  5CDV A;  2OAZ A;  4ZNG A;  4B28 A;  2BH3 A;  1XGO A;  2Q8K A;  1CHM A;  4JUQ A;  1KQ9 A;  2ZSG A;  2BWT A;  2GU4 A;  1PV9 A;  1WKM A;  2BWS A;  1WL6 A;  1XGS A;  2OKN A;  5JFR A;  4S2R P;  2B3K A;  4IKU A;  5D6E A;  3BIT A;  1BOA A;  2BWY A;  2Q96 A;  1JAW A;  2Q92 A;  2GTX A;  1WLR A;  4IDY A;  2BWV A;  5D6F A;  1W7V A;  3CTZ A;  3MAT A;  5JHU A;  4PNC A;  4QR8 A;  3ROR A;  1R58 A;  2BHC A; 
#chains in the Genus database with same CATH topology
 1WN1 A;  4S2T P;  5CDE A;  3PKE A;  2EA4 A;  2GG9 A;  4PV4 A;  2GA2 A;  4FUK A;  3MR1 A;  1C23 A;  1B6A A;  4U6C A;  4S00 A;  4U6W A;  5CIK A;  5CNX A;  4R60 A;  1N51 A;  5CE6 A;  1R5G A;  3L24 A;  1W2M A;  2GGC A;  3PKA A;  2BWU A;  1YW9 A;  4RZY A;  4KM3 A;  1XGM A;  1XNZ A;  3PKD A;  1YW8 A;  2IW2 A;  4IU6 A;  2B3L A;  4RGZ 1;  4RZZ A;  3PKC A;  3Q6D A;  4U73 A;  3FMR A;  5FCF A;  1A16 A;  4ZWP A;  2BHA A;  2Q94 A;  2GU6 A;  3CB5 A;  2P99 A;  4U76 A;  2GU5 A;  4IKR A;  1QXY A;  4U1B A;  4FO7 A;  1XGN A;  1WL9 A;  1QXZ A;  2P98 A;  3IU9 A;  1QZY A;  1B59 A;  2EVO A;  2V3X A;  4A6W A;  3FMQ A;  2BHB A;  2NQ6 A;  3TB5 A;  2V3Y A;  2GG0 A;  3CB6 A;  4U6E A;  4IPA A;  2V6C A;  2BHD A;  4FO8 A;  5FCH A;  4IKT A;  4U69 A;  4IEC A;  2DFI A;  1BN5 A;  4U71 A;  4Z7M A;  2BWX A;  1KQ0 A;  4U70 A;  2GZ5 A;  2P9A A;  4FLK A;  4IKS A;  5E5B A;  4HXX A;  1C24 A;  3IU7 A;  5JI6 A;  1M35 A;  4ZWO A;  1Y1N A;  2BB7 A;  2V3Z A;  4MAT A;  2EVC A;  4FLL A;  2Q95 A;  1C21 A;  2GG8 A;  4S01 A;  2Q93 A;  1C22 A;  4FLI A;  1WY2 A;  1QXW A;  3MX6 A;  3D27 A;  3S6B A;  2B3H A;  2G6P A;  4IF7 A;  4OOK A;  1C27 A;  2BWW A;  1MAT A;  2GGB A;  1R5H A;  2ADU A;  2EVM A;  2GG2 A;  3BIQ A;  2NQ7 A;  3TAV A;  4FKC A;  3BIP A;  4A6V A;  4U6Z A;  1YJ3 A;  1KP0 A;  4U6J A;  2BN7 A;  3L7G A;  2GG5 A;  2HOW A;  5CDL A;  3PKB A;  1O0X A;  2GG7 A;  1WBQ A;  4FLJ A;  4EGE A;  4U75 A;  2MAT A;  3FM3 A;  4ZWU A;  2GU7 A;  1YVM A;  3IG4 A;  5CLS A;  3IU8 A;  2EA2 A;  3RVA A;  1YW7 A;  2GG3 A;  5CDV A;  2OAZ A;  4ZNG A;  4B28 A;  2BH3 A;  1XGO A;  2Q8K A;  1CHM A;  4JUQ A;  1KQ9 A;  2ZSG A;  2BWT A;  2GU4 A;  1PV9 A;  1WKM A;  2BWS A;  1WL6 A;  1XGS A;  2OKN A;  5JFR A;  4S2R P;  2B3K A;  4IKU A;  5D6E A;  3BIT A;  1BOA A;  2BWY A;  2Q96 A;  1JAW A;  2Q92 A;  2GTX A;  1WLR A;  4IDY A;  2BWV A;  5D6F A;  1W7V A;  3CTZ A;  3MAT A;  5JHU A;  4PNC A;  4QR8 A;  3ROR A;  1R58 A;  2BHC A; 
#chains in the Genus database with same CATH homology
 1WN1 A;  4S2T P;  5CDE A;  3PKE A;  2EA4 A;  2GG9 A;  4PV4 A;  2GA2 A;  4FUK A;  3MR1 A;  1C23 A;  1B6A A;  4U6C A;  4S00 A;  4U6W A;  5CIK A;  5CNX A;  4R60 A;  1N51 A;  5CE6 A;  1R5G A;  3L24 A;  1W2M A;  2GGC A;  3PKA A;  2BWU A;  1YW9 A;  4RZY A;  4KM3 A;  1XGM A;  1XNZ A;  3PKD A;  1YW8 A;  2IW2 A;  4IU6 A;  2B3L A;  4RGZ 1;  4RZZ A;  3PKC A;  3Q6D A;  4U73 A;  3FMR A;  5FCF A;  1A16 A;  4ZWP A;  2BHA A;  2Q94 A;  2GU6 A;  3CB5 A;  2P99 A;  4U76 A;  2GU5 A;  4IKR A;  1QXY A;  4U1B A;  4FO7 A;  1XGN A;  1WL9 A;  1QXZ A;  2P98 A;  3IU9 A;  1QZY A;  1B59 A;  2EVO A;  2V3X A;  4A6W A;  3FMQ A;  2BHB A;  2NQ6 A;  3TB5 A;  2V3Y A;  2GG0 A;  3CB6 A;  4U6E A;  4IPA A;  2V6C A;  2BHD A;  4FO8 A;  5FCH A;  4IKT A;  4U69 A;  4IEC A;  2DFI A;  1BN5 A;  4U71 A;  4Z7M A;  2BWX A;  1KQ0 A;  4U70 A;  2GZ5 A;  2P9A A;  4FLK A;  4IKS A;  5E5B A;  4HXX A;  1C24 A;  3IU7 A;  5JI6 A;  1M35 A;  4ZWO A;  1Y1N A;  2BB7 A;  2V3Z A;  4MAT A;  2EVC A;  4FLL A;  2Q95 A;  1C21 A;  2GG8 A;  4S01 A;  2Q93 A;  1C22 A;  4FLI A;  1WY2 A;  1QXW A;  3MX6 A;  3D27 A;  3S6B A;  2B3H A;  2G6P A;  4IF7 A;  4OOK A;  1C27 A;  2BWW A;  1MAT A;  2GGB A;  1R5H A;  2ADU A;  2EVM A;  2GG2 A;  3BIQ A;  2NQ7 A;  3TAV A;  4FKC A;  3BIP A;  4A6V A;  4U6Z A;  1YJ3 A;  1KP0 A;  4U6J A;  2BN7 A;  3L7G A;  2GG5 A;  2HOW A;  5CDL A;  3PKB A;  1O0X A;  2GG7 A;  1WBQ A;  4FLJ A;  4EGE A;  4U75 A;  2MAT A;  3FM3 A;  4ZWU A;  2GU7 A;  1YVM A;  3IG4 A;  5CLS A;  3IU8 A;  2EA2 A;  3RVA A;  1YW7 A;  2GG3 A;  5CDV A;  2OAZ A;  4ZNG A;  4B28 A;  2BH3 A;  1XGO A;  2Q8K A;  1CHM A;  4JUQ A;  1KQ9 A;  2ZSG A;  2BWT A;  2GU4 A;  1PV9 A;  1WKM A;  2BWS A;  1WL6 A;  1XGS A;  2OKN A;  5JFR A;  4S2R P;  2B3K A;  4IKU A;  5D6E A;  3BIT A;  1BOA A;  2BWY A;  2Q96 A;  1JAW A;  2Q92 A;  2GTX A;  1WLR A;  4IDY A;  2BWV A;  5D6F A;  1W7V A;  3CTZ A;  3MAT A;  5JHU A;  4PNC A;  4QR8 A;  3ROR A;  1R58 A;  2BHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...