2B3HA

Crystal structure of human methionine aminopeptidase type i with a third cobalt in the active site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 103
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3hA00
3RVAA 2BH3A 4U1BA 3PKCA 1XGNA 1WBQA 4RZZA 2EVMA 2BWTA 2GG9A 3PKBA 4IDYA 4S01A 3RORA 5CDVA 1R5GA 4ZWOA 2IW2A 2BWYA 2EA4A 3CB6A 2BHCA 4A6WA 1C24A 3BIPA 3L7GA 4FLLA 4PNCA 4U71A 3PKEA 1BN5A 4JUQA 1XNZA 4U69A 1XGSA 4U6EA 4PV4A 1W7VA 1XGMA 2GU7A 4IKUA 1QXWA 2Q8KA 4U75A 3TAVA 2GU6A 1CHMA 4OOKA 1M35A 5JI6A 2P9AA 2GGCA 1C21A 2OAZA 4MATA 1W2MA 4U6CA 1KQ0A 2B3HA 4U6ZA 1Y1NA 5JFRA 3BITA 3MATA 5CE6A 2MATA 5CDLA 1WLRA 2BHBA 2G6PA 2ADUA 4FKCA 2GU5A 3L24A 1YW9A 2V6CA 3FM3A 4IF7A 4IKRA 3MX6A 5CNXA 4FO7A 4U6WA 2Q93A 2BWSA 1C23A 1O0XA 1B59A 1XGOA 1KQ9A 4S00A 4RZYA 4IU6A 2V3YA 2BN7A 4U6JA 1WL6A 2B3LA 4IECA 1C22A 2BWWA 2EVCA 4ZWUA 4ZNGA 2GU4A 5JHUA 3IU7A 4FUKA 2OKNA 2GZ5A 1YW8A 2DFIA 5E5BA 1WN1A 5CIKA 1QXYA 2GGBA 4B28A 3CTZA 2NQ6A 2BWUA 4U70A 1PV9A 3MR1A 2GG3A 4R60A 2BWVA 4FLIA 4EGEA 1YW7A 1WKMA 2NQ7A 3TB5A 3D27A 4HXXA 3FMRA 4IKTA 2EA2A 3IU9A 5D6FA 4FO8A 2B3KA 2P98A 4U73A 5CLSA 4FLKA 3IU8A 1QZYA 2GTXA 2P99A 1WL9A 2GG7A 2Q94A 2GG5A 4Z7MA 1BOAA 2GG0A 4IKSA 1KP0A 2Q96A 2Q95A 2GA2A 2EVOA 2HOWA 3FMQA 5CDEA 1QXZA 1JAWA 5FCHA 2BHDA 4KM3A 4ZWPA 1R5HA 4FLJA 2V3XA 4S2RP 2GG2A 4U76A 1YVMA 3PKDA 3IG4A 2ZSGA 4RGZ1 2BHAA 1WY2A 3BIQA 3CB5A 4IPAA 2Q92A 3S6BA 4QR8A 1B6AA 3PKAA 1A16A 1MATA 2GG8A 4S2TP 1N51A 2BB7A 5D6EA 1R58A 2BWXA 5FCFA 1YJ3A 3Q6DA 1C27A 4A6VA 2V3ZA
chains in the Genus database with same CATH superfamily
3RVAA 2BH3A 4U1BA 3PKCA 1XGNA 1WBQA 4RZZA 2EVMA 2BWTA 2GG9A 3PKBA 4IDYA 4S01A 3RORA 5CDVA 1R5GA 4ZWOA 2IW2A 2BWYA 2EA4A 3CB6A 2BHCA 4A6WA 1C24A 3BIPA 3L7GA 4FLLA 4PNCA 4U71A 3PKEA 1BN5A 4JUQA 1XNZA 4U69A 1XGSA 4U6EA 4PV4A 1W7VA 1XGMA 2GU7A 4IKUA 1QXWA 2Q8KA 4U75A 3TAVA 2GU6A 1CHMA 4OOKA 1M35A 5JI6A 2P9AA 2GGCA 1C21A 2OAZA 4MATA 1W2MA 4U6CA 1KQ0A 2B3HA 4U6ZA 1Y1NA 5JFRA 3BITA 3MATA 5CE6A 2MATA 5CDLA 1WLRA 2BHBA 2G6PA 2ADUA 4FKCA 2GU5A 3L24A 1YW9A 2V6CA 3FM3A 4IF7A 4IKRA 3MX6A 5CNXA 4FO7A 4U6WA 2Q93A 2BWSA 1C23A 1O0XA 1B59A 1XGOA 1KQ9A 4S00A 4RZYA 4IU6A 2V3YA 2BN7A 4U6JA 1WL6A 2B3LA 4IECA 1C22A 2BWWA 2EVCA 4ZWUA 4ZNGA 2GU4A 5JHUA 3IU7A 4FUKA 2OKNA 2GZ5A 1YW8A 2DFIA 5E5BA 1WN1A 5CIKA 1QXYA 2GGBA 4B28A 3CTZA 2NQ6A 2BWUA 4U70A 1PV9A 3MR1A 2GG3A 4R60A 2BWVA 4FLIA 4EGEA 1YW7A 1WKMA 2NQ7A 3TB5A 3D27A 4HXXA 3FMRA 4IKTA 2EA2A 3IU9A 5D6FA 4FO8A 2B3KA 2P98A 4U73A 5CLSA 4FLKA 3IU8A 1QZYA 2GTXA 2P99A 1WL9A 2GG7A 2Q94A 2GG5A 4Z7MA 1BOAA 2GG0A 4IKSA 1KP0A 2Q96A 2Q95A 2GA2A 2EVOA 2HOWA 3FMQA 5CDEA 1QXZA 1JAWA 5FCHA 2BHDA 4KM3A 4ZWPA 1R5HA 4FLJA 2V3XA 4S2RP 2GG2A 4U76A 1YVMA 3PKDA 3IG4A 2ZSGA 4RGZ1 2BHAA 1WY2A 3BIQA 3CB5A 4IPAA 2Q92A 3S6BA 4QR8A 1B6AA 3PKAA 1A16A 1MATA 2GG8A 4S2TP 1N51A 2BB7A 5D6EA 1R58A 2BWXA 5FCFA 1YJ3A 3Q6DA 1C27A 4A6VA 2V3ZA
chains in the Genus database with same CATH topology
3RVAA 2BH3A 4U1BA 3PKCA 1XGNA 1WBQA 4RZZA 2EVMA 2BWTA 2GG9A 3PKBA 4IDYA 4S01A 3RORA 5CDVA 1R5GA 4ZWOA 2IW2A 2BWYA 2EA4A 3CB6A 2BHCA 4A6WA 1C24A 3BIPA 3L7GA 4FLLA 4PNCA 4U71A 3PKEA 1BN5A 4JUQA 1XNZA 4U69A 1XGSA 4U6EA 4PV4A 1W7VA 1XGMA 2GU7A 4IKUA 1QXWA 2Q8KA 4U75A 3TAVA 2GU6A 1CHMA 4OOKA 1M35A 5JI6A 2P9AA 2GGCA 1C21A 2OAZA 4MATA 1W2MA 4U6CA 1KQ0A 2B3HA 4U6ZA 1Y1NA 5JFRA 3BITA 3MATA 5CE6A 2MATA 5CDLA 1WLRA 2BHBA 2G6PA 2ADUA 4FKCA 2GU5A 3L24A 1YW9A 2V6CA 3FM3A 4IF7A 4IKRA 3MX6A 5CNXA 4FO7A 4U6WA 2Q93A 2BWSA 1C23A 1O0XA 1B59A 1XGOA 1KQ9A 4S00A 4RZYA 4IU6A 2V3YA 2BN7A 4U6JA 1WL6A 2B3LA 4IECA 1C22A 2BWWA 2EVCA 4ZWUA 4ZNGA 2GU4A 5JHUA 3IU7A 4FUKA 2OKNA 2GZ5A 1YW8A 2DFIA 5E5BA 1WN1A 5CIKA 1QXYA 2GGBA 4B28A 3CTZA 2NQ6A 2BWUA 4U70A 1PV9A 3MR1A 2GG3A 4R60A 2BWVA 4FLIA 4EGEA 1YW7A 1WKMA 2NQ7A 3TB5A 3D27A 4HXXA 3FMRA 4IKTA 2EA2A 3IU9A 5D6FA 4FO8A 2B3KA 2P98A 4U73A 5CLSA 4FLKA 3IU8A 1QZYA 2GTXA 2P99A 1WL9A 2GG7A 2Q94A 2GG5A 4Z7MA 1BOAA 2GG0A 4IKSA 1KP0A 2Q96A 2Q95A 2GA2A 2EVOA 2HOWA 3FMQA 5CDEA 1QXZA 1JAWA 5FCHA 2BHDA 4KM3A 4ZWPA 1R5HA 4FLJA 2V3XA 4S2RP 2GG2A 4U76A 1YVMA 3PKDA 3IG4A 2ZSGA 4RGZ1 2BHAA 1WY2A 3BIQA 3CB5A 4IPAA 2Q92A 3S6BA 4QR8A 1B6AA 3PKAA 1A16A 1MATA 2GG8A 4S2TP 1N51A 2BB7A 5D6EA 1R58A 2BWXA 5FCFA 1YJ3A 3Q6DA 1C27A 4A6VA 2V3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVA A;  2BH3 A;  4U1B A;  3PKC A;  1XGN A;  1WBQ A;  4RZZ A;  2EVM A;  2BWT A;  2GG9 A;  3PKB A;  4IDY A;  4S01 A;  3ROR A;  5CDV A;  1R5G A;  4ZWO A;  2IW2 A;  2BWY A;  2EA4 A;  3CB6 A;  2BHC A;  4A6W A;  1C24 A;  3BIP A;  3L7G A;  4FLL A;  4PNC A;  4U71 A;  3PKE A;  1BN5 A;  4JUQ A;  1XNZ A;  4U69 A;  1XGS A;  4U6E A;  4PV4 A;  1W7V A;  1XGM A;  2GU7 A;  4IKU A;  1QXW A;  2Q8K A;  4U75 A;  3TAV A;  2GU6 A;  1CHM A;  4OOK A;  1M35 A;  5JI6 A;  2P9A A;  2GGC A;  1C21 A;  2OAZ A;  4MAT A;  1W2M A;  4U6C A;  1KQ0 A;  2B3H A;  4U6Z A;  1Y1N A;  5JFR A;  3BIT A;  3MAT A;  5CE6 A;  2MAT A;  5CDL A;  1WLR A;  2BHB A;  2G6P A;  2ADU A;  4FKC A;  2GU5 A;  3L24 A;  1YW9 A;  2V6C A;  3FM3 A;  4IF7 A;  4IKR A;  3MX6 A;  5CNX A;  4FO7 A;  4U6W A;  2Q93 A;  2BWS A;  1C23 A;  1O0X A;  1B59 A;  1XGO A;  1KQ9 A;  4S00 A;  4RZY A;  4IU6 A;  2V3Y A;  2BN7 A;  4U6J A;  1WL6 A;  2B3L A;  4IEC A;  1C22 A;  2BWW A;  2EVC A;  4ZWU A;  4ZNG A;  2GU4 A;  5JHU A;  3IU7 A;  4FUK A;  2OKN A;  2GZ5 A;  1YW8 A;  2DFI A;  5E5B A;  1WN1 A;  5CIK A;  1QXY A;  2GGB A;  4B28 A;  3CTZ A;  2NQ6 A;  2BWU A;  4U70 A;  1PV9 A;  3MR1 A;  2GG3 A;  4R60 A;  2BWV A;  4FLI A;  4EGE A;  1YW7 A;  1WKM A;  2NQ7 A;  3TB5 A;  3D27 A;  4HXX A;  3FMR A;  4IKT A;  2EA2 A;  3IU9 A;  5D6F A;  4FO8 A;  2B3K A;  2P98 A;  4U73 A;  5CLS A;  4FLK A;  3IU8 A;  1QZY A;  2GTX A;  2P99 A;  1WL9 A;  2GG7 A;  2Q94 A;  2GG5 A;  4Z7M A;  1BOA A;  2GG0 A;  4IKS A;  1KP0 A;  2Q96 A;  2Q95 A;  2GA2 A;  2EVO A;  2HOW A;  3FMQ A;  5CDE A;  1QXZ A;  1JAW A;  5FCH A;  2BHD A;  4KM3 A;  4ZWP A;  1R5H A;  4FLJ A;  2V3X A;  4S2R P;  2GG2 A;  4U76 A;  1YVM A;  3PKD A;  3IG4 A;  2ZSG A;  4RGZ 1;  2BHA A;  1WY2 A;  3BIQ A;  3CB5 A;  4IPA A;  2Q92 A;  3S6B A;  4QR8 A;  1B6A A;  3PKA A;  1A16 A;  1MAT A;  2GG8 A;  4S2T P;  1N51 A;  2BB7 A;  5D6E A;  1R58 A;  2BWX A;  5FCF A;  1YJ3 A;  3Q6D A;  1C27 A;  4A6V A;  2V3Z A; 
#chains in the Genus database with same CATH topology
 3RVA A;  2BH3 A;  4U1B A;  3PKC A;  1XGN A;  1WBQ A;  4RZZ A;  2EVM A;  2BWT A;  2GG9 A;  3PKB A;  4IDY A;  4S01 A;  3ROR A;  5CDV A;  1R5G A;  4ZWO A;  2IW2 A;  2BWY A;  2EA4 A;  3CB6 A;  2BHC A;  4A6W A;  1C24 A;  3BIP A;  3L7G A;  4FLL A;  4PNC A;  4U71 A;  3PKE A;  1BN5 A;  4JUQ A;  1XNZ A;  4U69 A;  1XGS A;  4U6E A;  4PV4 A;  1W7V A;  1XGM A;  2GU7 A;  4IKU A;  1QXW A;  2Q8K A;  4U75 A;  3TAV A;  2GU6 A;  1CHM A;  4OOK A;  1M35 A;  5JI6 A;  2P9A A;  2GGC A;  1C21 A;  2OAZ A;  4MAT A;  1W2M A;  4U6C A;  1KQ0 A;  2B3H A;  4U6Z A;  1Y1N A;  5JFR A;  3BIT A;  3MAT A;  5CE6 A;  2MAT A;  5CDL A;  1WLR A;  2BHB A;  2G6P A;  2ADU A;  4FKC A;  2GU5 A;  3L24 A;  1YW9 A;  2V6C A;  3FM3 A;  4IF7 A;  4IKR A;  3MX6 A;  5CNX A;  4FO7 A;  4U6W A;  2Q93 A;  2BWS A;  1C23 A;  1O0X A;  1B59 A;  1XGO A;  1KQ9 A;  4S00 A;  4RZY A;  4IU6 A;  2V3Y A;  2BN7 A;  4U6J A;  1WL6 A;  2B3L A;  4IEC A;  1C22 A;  2BWW A;  2EVC A;  4ZWU A;  4ZNG A;  2GU4 A;  5JHU A;  3IU7 A;  4FUK A;  2OKN A;  2GZ5 A;  1YW8 A;  2DFI A;  5E5B A;  1WN1 A;  5CIK A;  1QXY A;  2GGB A;  4B28 A;  3CTZ A;  2NQ6 A;  2BWU A;  4U70 A;  1PV9 A;  3MR1 A;  2GG3 A;  4R60 A;  2BWV A;  4FLI A;  4EGE A;  1YW7 A;  1WKM A;  2NQ7 A;  3TB5 A;  3D27 A;  4HXX A;  3FMR A;  4IKT A;  2EA2 A;  3IU9 A;  5D6F A;  4FO8 A;  2B3K A;  2P98 A;  4U73 A;  5CLS A;  4FLK A;  3IU8 A;  1QZY A;  2GTX A;  2P99 A;  1WL9 A;  2GG7 A;  2Q94 A;  2GG5 A;  4Z7M A;  1BOA A;  2GG0 A;  4IKS A;  1KP0 A;  2Q96 A;  2Q95 A;  2GA2 A;  2EVO A;  2HOW A;  3FMQ A;  5CDE A;  1QXZ A;  1JAW A;  5FCH A;  2BHD A;  4KM3 A;  4ZWP A;  1R5H A;  4FLJ A;  2V3X A;  4S2R P;  2GG2 A;  4U76 A;  1YVM A;  3PKD A;  3IG4 A;  2ZSG A;  4RGZ 1;  2BHA A;  1WY2 A;  3BIQ A;  3CB5 A;  4IPA A;  2Q92 A;  3S6B A;  4QR8 A;  1B6A A;  3PKA A;  1A16 A;  1MAT A;  2GG8 A;  4S2T P;  1N51 A;  2BB7 A;  5D6E A;  1R58 A;  2BWX A;  5FCF A;  1YJ3 A;  3Q6D A;  1C27 A;  4A6V A;  2V3Z A; 
#chains in the Genus database with same CATH homology
 3RVA A;  2BH3 A;  4U1B A;  3PKC A;  1XGN A;  1WBQ A;  4RZZ A;  2EVM A;  2BWT A;  2GG9 A;  3PKB A;  4IDY A;  4S01 A;  3ROR A;  5CDV A;  1R5G A;  4ZWO A;  2IW2 A;  2BWY A;  2EA4 A;  3CB6 A;  2BHC A;  4A6W A;  1C24 A;  3BIP A;  3L7G A;  4FLL A;  4PNC A;  4U71 A;  3PKE A;  1BN5 A;  4JUQ A;  1XNZ A;  4U69 A;  1XGS A;  4U6E A;  4PV4 A;  1W7V A;  1XGM A;  2GU7 A;  4IKU A;  1QXW A;  2Q8K A;  4U75 A;  3TAV A;  2GU6 A;  1CHM A;  4OOK A;  1M35 A;  5JI6 A;  2P9A A;  2GGC A;  1C21 A;  2OAZ A;  4MAT A;  1W2M A;  4U6C A;  1KQ0 A;  2B3H A;  4U6Z A;  1Y1N A;  5JFR A;  3BIT A;  3MAT A;  5CE6 A;  2MAT A;  5CDL A;  1WLR A;  2BHB A;  2G6P A;  2ADU A;  4FKC A;  2GU5 A;  3L24 A;  1YW9 A;  2V6C A;  3FM3 A;  4IF7 A;  4IKR A;  3MX6 A;  5CNX A;  4FO7 A;  4U6W A;  2Q93 A;  2BWS A;  1C23 A;  1O0X A;  1B59 A;  1XGO A;  1KQ9 A;  4S00 A;  4RZY A;  4IU6 A;  2V3Y A;  2BN7 A;  4U6J A;  1WL6 A;  2B3L A;  4IEC A;  1C22 A;  2BWW A;  2EVC A;  4ZWU A;  4ZNG A;  2GU4 A;  5JHU A;  3IU7 A;  4FUK A;  2OKN A;  2GZ5 A;  1YW8 A;  2DFI A;  5E5B A;  1WN1 A;  5CIK A;  1QXY A;  2GGB A;  4B28 A;  3CTZ A;  2NQ6 A;  2BWU A;  4U70 A;  1PV9 A;  3MR1 A;  2GG3 A;  4R60 A;  2BWV A;  4FLI A;  4EGE A;  1YW7 A;  1WKM A;  2NQ7 A;  3TB5 A;  3D27 A;  4HXX A;  3FMR A;  4IKT A;  2EA2 A;  3IU9 A;  5D6F A;  4FO8 A;  2B3K A;  2P98 A;  4U73 A;  5CLS A;  4FLK A;  3IU8 A;  1QZY A;  2GTX A;  2P99 A;  1WL9 A;  2GG7 A;  2Q94 A;  2GG5 A;  4Z7M A;  1BOA A;  2GG0 A;  4IKS A;  1KP0 A;  2Q96 A;  2Q95 A;  2GA2 A;  2EVO A;  2HOW A;  3FMQ A;  5CDE A;  1QXZ A;  1JAW A;  5FCH A;  2BHD A;  4KM3 A;  4ZWP A;  1R5H A;  4FLJ A;  2V3X A;  4S2R P;  2GG2 A;  4U76 A;  1YVM A;  3PKD A;  3IG4 A;  2ZSG A;  4RGZ 1;  2BHA A;  1WY2 A;  3BIQ A;  3CB5 A;  4IPA A;  2Q92 A;  3S6B A;  4QR8 A;  1B6A A;  3PKA A;  1A16 A;  1MAT A;  2GG8 A;  4S2T P;  1N51 A;  2BB7 A;  5D6E A;  1R58 A;  2BWX A;  5FCF A;  1YJ3 A;  3Q6D A;  1C27 A;  4A6V A;  2V3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...