2B3HA

Crystal structure of human methionine aminopeptidase type i with a third cobalt in the active site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3hA00
5FCFA 1C23A 1KP0A 2Q94A 4FLLA 1WN1A 4Z7MA 1R58A 5CE6A 4IF7A 4U75A 2GU4A 2V3XA 4FUKA 3TB5A 5JI6A 2BHCA 4IU6A 3RVAA 3CTZA 4R60A 3FMRA 2Q96A 1W7VA 1JAWA 5D6EA 2EVOA 2ADUA 5D6FA 2BH3A 4FO7A 3BIPA 2OAZA 3PKDA 4IKSA 4U6WA 3RORA 2BWVA 2GTXA 1WL6A 2BWWA 2MATA 4U6JA 4A6WA 3Q6DA 2V3ZA 4U6CA 1XNZA 3D27A 2HOWA 4U71A 2BWSA 2GA2A 3BIQA 2V6CA 3PKAA 3PKBA 1YW9A 4B28A 3L24A 2B3LA 4FO8A 3MATA 2NQ7A 1QXYA 1PV9A 4U6ZA 1BOAA 5CNXA 1N51A 3PKEA 1C24A 1XGSA 1YW8A 3L7GA 1XGOA 4U73A 4IKRA 2BWTA 5FCHA 2BN7A 2BHAA 1C21A 2B3KA 3IG4A 4FLIA 5CDEA 1XGNA 1R5HA 3BITA 3IU8A 4U6EA 5CIKA 3IU7A 2G6PA 1YVMA 4IKUA 5CDVA 4MATA 1QXZA 2V3YA 1MATA 4IKTA 1C27A 2GG3A 2GU5A 4EGEA 1QZYA 1KQ9A 5JHUA 4ZWUA 1B6AA 2Q95A 2B3HA 4U1BA 4PNCA 2BB7A 2BWYA 2GG9A 4OOKA 2BWXA 3CB6A 3TAVA 1C22A 1WLRA 2DFIA 2EA4A 3FMQA 2EVMA 4S01A 3MR1A 2GG0A 2GGCA 1WKMA 2P98A 2BWUA 3FM3A 2GU6A 5JFRA 2GZ5A 1B59A 2Q8KA 1YJ3A 1WBQA 2EVCA 1W2MA 1BN5A 2BHBA 4A6VA 2Q93A 4RZZA 2GG5A 4RZYA 4U70A 5CDLA 2EA2A 2P9AA 3CB5A 4IECA 3MX6A 4RGZ1 4ZWOA 4FLJA 1M35A 1A16A 2BHDA 4S00A 2IW2A 2NQ6A 2GG7A 2P99A 4IPAA 2Q92A 3PKCA 1XGMA 1QXWA 2OKNA 4IDYA 4S2TP 2GG2A 4FLKA 4ZNGA 4JUQA 2ZSGA 1R5GA 1O0XA 5E5BA 1YW7A 4HXXA 1WY2A 2GU7A 3IU9A 1WL9A 2GGBA 4U69A 1CHMA 2GG8A 4U76A 4S2RP 4KM3A 4ZWPA 1Y1NA 1KQ0A 4FKCA 5CLSA 3S6BA 4QR8A 4PV4A
chains in the Genus database with same CATH superfamily
5FCFA 1C23A 1KP0A 2Q94A 4FLLA 1WN1A 4Z7MA 1R58A 5CE6A 4IF7A 4U75A 2GU4A 2V3XA 4FUKA 3TB5A 5JI6A 2BHCA 4IU6A 3RVAA 3CTZA 4R60A 3FMRA 2Q96A 1W7VA 1JAWA 5D6EA 2EVOA 2ADUA 5D6FA 2BH3A 4FO7A 3BIPA 2OAZA 3PKDA 4IKSA 4U6WA 3RORA 2BWVA 2GTXA 1WL6A 2BWWA 2MATA 4U6JA 4A6WA 3Q6DA 2V3ZA 4U6CA 1XNZA 3D27A 2HOWA 4U71A 2BWSA 2GA2A 3BIQA 2V6CA 3PKAA 3PKBA 1YW9A 4B28A 3L24A 2B3LA 4FO8A 3MATA 2NQ7A 1QXYA 1PV9A 4U6ZA 1BOAA 5CNXA 1N51A 3PKEA 1C24A 1XGSA 1YW8A 3L7GA 1XGOA 4U73A 4IKRA 2BWTA 5FCHA 2BN7A 2BHAA 1C21A 2B3KA 3IG4A 4FLIA 5CDEA 1XGNA 1R5HA 3BITA 3IU8A 4U6EA 5CIKA 3IU7A 2G6PA 1YVMA 4IKUA 5CDVA 4MATA 1QXZA 2V3YA 1MATA 4IKTA 1C27A 2GG3A 2GU5A 4EGEA 1QZYA 1KQ9A 5JHUA 4ZWUA 1B6AA 2Q95A 2B3HA 4U1BA 4PNCA 2BB7A 2BWYA 2GG9A 4OOKA 2BWXA 3CB6A 3TAVA 1C22A 1WLRA 2DFIA 2EA4A 3FMQA 2EVMA 4S01A 3MR1A 2GG0A 2GGCA 1WKMA 2P98A 2BWUA 3FM3A 2GU6A 5JFRA 2GZ5A 1B59A 2Q8KA 1YJ3A 1WBQA 2EVCA 1W2MA 1BN5A 2BHBA 4A6VA 2Q93A 4RZZA 2GG5A 4RZYA 4U70A 5CDLA 2EA2A 2P9AA 3CB5A 4IECA 3MX6A 4RGZ1 4ZWOA 4FLJA 1M35A 1A16A 2BHDA 4S00A 2IW2A 2NQ6A 2GG7A 2P99A 4IPAA 2Q92A 3PKCA 1XGMA 1QXWA 2OKNA 4IDYA 4S2TP 2GG2A 4FLKA 4ZNGA 4JUQA 2ZSGA 1R5GA 1O0XA 5E5BA 1YW7A 4HXXA 1WY2A 2GU7A 3IU9A 1WL9A 2GGBA 4U69A 1CHMA 2GG8A 4U76A 4S2RP 4KM3A 4ZWPA 1Y1NA 1KQ0A 4FKCA 5CLSA 3S6BA 4QR8A 4PV4A
chains in the Genus database with same CATH topology
5FCFA 1C23A 1KP0A 2Q94A 4FLLA 1WN1A 4Z7MA 1R58A 5CE6A 4IF7A 4U75A 2GU4A 2V3XA 4FUKA 3TB5A 5JI6A 2BHCA 4IU6A 3RVAA 3CTZA 4R60A 3FMRA 2Q96A 1W7VA 1JAWA 5D6EA 2EVOA 2ADUA 5D6FA 2BH3A 4FO7A 3BIPA 2OAZA 3PKDA 4IKSA 4U6WA 3RORA 2BWVA 2GTXA 1WL6A 2BWWA 2MATA 4U6JA 4A6WA 3Q6DA 2V3ZA 4U6CA 1XNZA 3D27A 2HOWA 4U71A 2BWSA 2GA2A 3BIQA 2V6CA 3PKAA 3PKBA 1YW9A 4B28A 3L24A 2B3LA 4FO8A 3MATA 2NQ7A 1QXYA 1PV9A 4U6ZA 1BOAA 5CNXA 1N51A 3PKEA 1C24A 1XGSA 1YW8A 3L7GA 1XGOA 4U73A 4IKRA 2BWTA 5FCHA 2BN7A 2BHAA 1C21A 2B3KA 3IG4A 4FLIA 5CDEA 1XGNA 1R5HA 3BITA 3IU8A 4U6EA 5CIKA 3IU7A 2G6PA 1YVMA 4IKUA 5CDVA 4MATA 1QXZA 2V3YA 1MATA 4IKTA 1C27A 2GG3A 2GU5A 4EGEA 1QZYA 1KQ9A 5JHUA 4ZWUA 1B6AA 2Q95A 2B3HA 4U1BA 4PNCA 2BB7A 2BWYA 2GG9A 4OOKA 2BWXA 3CB6A 3TAVA 1C22A 1WLRA 2DFIA 2EA4A 3FMQA 2EVMA 4S01A 3MR1A 2GG0A 2GGCA 1WKMA 2P98A 2BWUA 3FM3A 2GU6A 5JFRA 2GZ5A 1B59A 2Q8KA 1YJ3A 1WBQA 2EVCA 1W2MA 1BN5A 2BHBA 4A6VA 2Q93A 4RZZA 2GG5A 4RZYA 4U70A 5CDLA 2EA2A 2P9AA 3CB5A 4IECA 3MX6A 4RGZ1 4ZWOA 4FLJA 1M35A 1A16A 2BHDA 4S00A 2IW2A 2NQ6A 2GG7A 2P99A 4IPAA 2Q92A 3PKCA 1XGMA 1QXWA 2OKNA 4IDYA 4S2TP 2GG2A 4FLKA 4ZNGA 4JUQA 2ZSGA 1R5GA 1O0XA 5E5BA 1YW7A 4HXXA 1WY2A 2GU7A 3IU9A 1WL9A 2GGBA 4U69A 1CHMA 2GG8A 4U76A 4S2RP 4KM3A 4ZWPA 1Y1NA 1KQ0A 4FKCA 5CLSA 3S6BA 4QR8A 4PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCF A;  1C23 A;  1KP0 A;  2Q94 A;  4FLL A;  1WN1 A;  4Z7M A;  1R58 A;  5CE6 A;  4IF7 A;  4U75 A;  2GU4 A;  2V3X A;  4FUK A;  3TB5 A;  5JI6 A;  2BHC A;  4IU6 A;  3RVA A;  3CTZ A;  4R60 A;  3FMR A;  2Q96 A;  1W7V A;  1JAW A;  5D6E A;  2EVO A;  2ADU A;  5D6F A;  2BH3 A;  4FO7 A;  3BIP A;  2OAZ A;  3PKD A;  4IKS A;  4U6W A;  3ROR A;  2BWV A;  2GTX A;  1WL6 A;  2BWW A;  2MAT A;  4U6J A;  4A6W A;  3Q6D A;  2V3Z A;  4U6C A;  1XNZ A;  3D27 A;  2HOW A;  4U71 A;  2BWS A;  2GA2 A;  3BIQ A;  2V6C A;  3PKA A;  3PKB A;  1YW9 A;  4B28 A;  3L24 A;  2B3L A;  4FO8 A;  3MAT A;  2NQ7 A;  1QXY A;  1PV9 A;  4U6Z A;  1BOA A;  5CNX A;  1N51 A;  3PKE A;  1C24 A;  1XGS A;  1YW8 A;  3L7G A;  1XGO A;  4U73 A;  4IKR A;  2BWT A;  5FCH A;  2BN7 A;  2BHA A;  1C21 A;  2B3K A;  3IG4 A;  4FLI A;  5CDE A;  1XGN A;  1R5H A;  3BIT A;  3IU8 A;  4U6E A;  5CIK A;  3IU7 A;  2G6P A;  1YVM A;  4IKU A;  5CDV A;  4MAT A;  1QXZ A;  2V3Y A;  1MAT A;  4IKT A;  1C27 A;  2GG3 A;  2GU5 A;  4EGE A;  1QZY A;  1KQ9 A;  5JHU A;  4ZWU A;  1B6A A;  2Q95 A;  2B3H A;  4U1B A;  4PNC A;  2BB7 A;  2BWY A;  2GG9 A;  4OOK A;  2BWX A;  3CB6 A;  3TAV A;  1C22 A;  1WLR A;  2DFI A;  2EA4 A;  3FMQ A;  2EVM A;  4S01 A;  3MR1 A;  2GG0 A;  2GGC A;  1WKM A;  2P98 A;  2BWU A;  3FM3 A;  2GU6 A;  5JFR A;  2GZ5 A;  1B59 A;  2Q8K A;  1YJ3 A;  1WBQ A;  2EVC A;  1W2M A;  1BN5 A;  2BHB A;  4A6V A;  2Q93 A;  4RZZ A;  2GG5 A;  4RZY A;  4U70 A;  5CDL A;  2EA2 A;  2P9A A;  3CB5 A;  4IEC A;  3MX6 A;  4RGZ 1;  4ZWO A;  4FLJ A;  1M35 A;  1A16 A;  2BHD A;  4S00 A;  2IW2 A;  2NQ6 A;  2GG7 A;  2P99 A;  4IPA A;  2Q92 A;  3PKC A;  1XGM A;  1QXW A;  2OKN A;  4IDY A;  4S2T P;  2GG2 A;  4FLK A;  4ZNG A;  4JUQ A;  2ZSG A;  1R5G A;  1O0X A;  5E5B A;  1YW7 A;  4HXX A;  1WY2 A;  2GU7 A;  3IU9 A;  1WL9 A;  2GGB A;  4U69 A;  1CHM A;  2GG8 A;  4U76 A;  4S2R P;  4KM3 A;  4ZWP A;  1Y1N A;  1KQ0 A;  4FKC A;  5CLS A;  3S6B A;  4QR8 A;  4PV4 A; 
#chains in the Genus database with same CATH topology
 5FCF A;  1C23 A;  1KP0 A;  2Q94 A;  4FLL A;  1WN1 A;  4Z7M A;  1R58 A;  5CE6 A;  4IF7 A;  4U75 A;  2GU4 A;  2V3X A;  4FUK A;  3TB5 A;  5JI6 A;  2BHC A;  4IU6 A;  3RVA A;  3CTZ A;  4R60 A;  3FMR A;  2Q96 A;  1W7V A;  1JAW A;  5D6E A;  2EVO A;  2ADU A;  5D6F A;  2BH3 A;  4FO7 A;  3BIP A;  2OAZ A;  3PKD A;  4IKS A;  4U6W A;  3ROR A;  2BWV A;  2GTX A;  1WL6 A;  2BWW A;  2MAT A;  4U6J A;  4A6W A;  3Q6D A;  2V3Z A;  4U6C A;  1XNZ A;  3D27 A;  2HOW A;  4U71 A;  2BWS A;  2GA2 A;  3BIQ A;  2V6C A;  3PKA A;  3PKB A;  1YW9 A;  4B28 A;  3L24 A;  2B3L A;  4FO8 A;  3MAT A;  2NQ7 A;  1QXY A;  1PV9 A;  4U6Z A;  1BOA A;  5CNX A;  1N51 A;  3PKE A;  1C24 A;  1XGS A;  1YW8 A;  3L7G A;  1XGO A;  4U73 A;  4IKR A;  2BWT A;  5FCH A;  2BN7 A;  2BHA A;  1C21 A;  2B3K A;  3IG4 A;  4FLI A;  5CDE A;  1XGN A;  1R5H A;  3BIT A;  3IU8 A;  4U6E A;  5CIK A;  3IU7 A;  2G6P A;  1YVM A;  4IKU A;  5CDV A;  4MAT A;  1QXZ A;  2V3Y A;  1MAT A;  4IKT A;  1C27 A;  2GG3 A;  2GU5 A;  4EGE A;  1QZY A;  1KQ9 A;  5JHU A;  4ZWU A;  1B6A A;  2Q95 A;  2B3H A;  4U1B A;  4PNC A;  2BB7 A;  2BWY A;  2GG9 A;  4OOK A;  2BWX A;  3CB6 A;  3TAV A;  1C22 A;  1WLR A;  2DFI A;  2EA4 A;  3FMQ A;  2EVM A;  4S01 A;  3MR1 A;  2GG0 A;  2GGC A;  1WKM A;  2P98 A;  2BWU A;  3FM3 A;  2GU6 A;  5JFR A;  2GZ5 A;  1B59 A;  2Q8K A;  1YJ3 A;  1WBQ A;  2EVC A;  1W2M A;  1BN5 A;  2BHB A;  4A6V A;  2Q93 A;  4RZZ A;  2GG5 A;  4RZY A;  4U70 A;  5CDL A;  2EA2 A;  2P9A A;  3CB5 A;  4IEC A;  3MX6 A;  4RGZ 1;  4ZWO A;  4FLJ A;  1M35 A;  1A16 A;  2BHD A;  4S00 A;  2IW2 A;  2NQ6 A;  2GG7 A;  2P99 A;  4IPA A;  2Q92 A;  3PKC A;  1XGM A;  1QXW A;  2OKN A;  4IDY A;  4S2T P;  2GG2 A;  4FLK A;  4ZNG A;  4JUQ A;  2ZSG A;  1R5G A;  1O0X A;  5E5B A;  1YW7 A;  4HXX A;  1WY2 A;  2GU7 A;  3IU9 A;  1WL9 A;  2GGB A;  4U69 A;  1CHM A;  2GG8 A;  4U76 A;  4S2R P;  4KM3 A;  4ZWP A;  1Y1N A;  1KQ0 A;  4FKC A;  5CLS A;  3S6B A;  4QR8 A;  4PV4 A; 
#chains in the Genus database with same CATH homology
 5FCF A;  1C23 A;  1KP0 A;  2Q94 A;  4FLL A;  1WN1 A;  4Z7M A;  1R58 A;  5CE6 A;  4IF7 A;  4U75 A;  2GU4 A;  2V3X A;  4FUK A;  3TB5 A;  5JI6 A;  2BHC A;  4IU6 A;  3RVA A;  3CTZ A;  4R60 A;  3FMR A;  2Q96 A;  1W7V A;  1JAW A;  5D6E A;  2EVO A;  2ADU A;  5D6F A;  2BH3 A;  4FO7 A;  3BIP A;  2OAZ A;  3PKD A;  4IKS A;  4U6W A;  3ROR A;  2BWV A;  2GTX A;  1WL6 A;  2BWW A;  2MAT A;  4U6J A;  4A6W A;  3Q6D A;  2V3Z A;  4U6C A;  1XNZ A;  3D27 A;  2HOW A;  4U71 A;  2BWS A;  2GA2 A;  3BIQ A;  2V6C A;  3PKA A;  3PKB A;  1YW9 A;  4B28 A;  3L24 A;  2B3L A;  4FO8 A;  3MAT A;  2NQ7 A;  1QXY A;  1PV9 A;  4U6Z A;  1BOA A;  5CNX A;  1N51 A;  3PKE A;  1C24 A;  1XGS A;  1YW8 A;  3L7G A;  1XGO A;  4U73 A;  4IKR A;  2BWT A;  5FCH A;  2BN7 A;  2BHA A;  1C21 A;  2B3K A;  3IG4 A;  4FLI A;  5CDE A;  1XGN A;  1R5H A;  3BIT A;  3IU8 A;  4U6E A;  5CIK A;  3IU7 A;  2G6P A;  1YVM A;  4IKU A;  5CDV A;  4MAT A;  1QXZ A;  2V3Y A;  1MAT A;  4IKT A;  1C27 A;  2GG3 A;  2GU5 A;  4EGE A;  1QZY A;  1KQ9 A;  5JHU A;  4ZWU A;  1B6A A;  2Q95 A;  2B3H A;  4U1B A;  4PNC A;  2BB7 A;  2BWY A;  2GG9 A;  4OOK A;  2BWX A;  3CB6 A;  3TAV A;  1C22 A;  1WLR A;  2DFI A;  2EA4 A;  3FMQ A;  2EVM A;  4S01 A;  3MR1 A;  2GG0 A;  2GGC A;  1WKM A;  2P98 A;  2BWU A;  3FM3 A;  2GU6 A;  5JFR A;  2GZ5 A;  1B59 A;  2Q8K A;  1YJ3 A;  1WBQ A;  2EVC A;  1W2M A;  1BN5 A;  2BHB A;  4A6V A;  2Q93 A;  4RZZ A;  2GG5 A;  4RZY A;  4U70 A;  5CDL A;  2EA2 A;  2P9A A;  3CB5 A;  4IEC A;  3MX6 A;  4RGZ 1;  4ZWO A;  4FLJ A;  1M35 A;  1A16 A;  2BHD A;  4S00 A;  2IW2 A;  2NQ6 A;  2GG7 A;  2P99 A;  4IPA A;  2Q92 A;  3PKC A;  1XGM A;  1QXW A;  2OKN A;  4IDY A;  4S2T P;  2GG2 A;  4FLK A;  4ZNG A;  4JUQ A;  2ZSG A;  1R5G A;  1O0X A;  5E5B A;  1YW7 A;  4HXX A;  1WY2 A;  2GU7 A;  3IU9 A;  1WL9 A;  2GGB A;  4U69 A;  1CHM A;  2GG8 A;  4U76 A;  4S2R P;  4KM3 A;  4ZWP A;  1Y1N A;  1KQ0 A;  4FKC A;  5CLS A;  3S6B A;  4QR8 A;  4PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...