2B3HA

Crystal structure of human methionine aminopeptidase type i with a third cobalt in the active site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 103
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3hA00
2P98A 2G6PA 2Q94A 4ZNGA 1YW8A 4IPAA 2Q96A 3L24A 2EA2A 1WBQA 2BWVA 5CDEA 3MX6A 4U1BA 2GGCA 2Q95A 4U70A 4U73A 2B3LA 4FO7A 3CTZA 2OKNA 4JUQA 1BOAA 2GG7A 2B3KA 5CDVA 1KQ0A 2GG8A 5E5BA 2BH3A 4U75A 2GGBA 4IECA 3TB5A 1C27A 1Y1NA 1YJ3A 1WLRA 2NQ6A 3L7GA 4S2RP 4R60A 2OAZA 2GZ5A 2Q93A 4KM3A 2P9AA 2GU7A 3BIPA 1MATA 1JAWA 2BWUA 1KQ9A 3D27A 1W2MA 1B59A 5JFRA 1XGSA 2BN7A 4EGEA 4HXXA 4PNCA 1R5GA 2EVMA 1WL9A 1N51A 2GG5A 5CLSA 4U6CA 2P99A 4IF7A 1WL6A 2GA2A 2V3YA 2GU5A 1BN5A 2V3ZA 1QXWA 4FLIA 4OOKA 3BIQA 4A6VA 3FM3A 5JHUA 1YW7A 5CE6A 4U71A 4FKCA 2GU4A 5CDLA 1XGNA 1M35A 1WY2A 2BWYA 2BHAA 1CHMA 5FCHA 2B3HA 4ZWUA 1KP0A 3BITA 4RGZ1 4MATA 1W7VA 1R58A 3RVAA 2BHBA 2DFIA 4IKSA 2NQ7A 5D6FA 4QR8A 4IKUA 2GG2A 1QZYA 1C24A 4U6EA 2Q92A 3TAVA 4PV4A 2GG9A 2HOWA 1R5HA 1QXZA 1XNZA 2BWSA 2GTXA 4U6WA 4U76A 2ZSGA 1XGMA 4B28A 4FUKA 2EVOA 4S01A 2IW2A 3RORA 2GG3A 1A16A 4S2TP 4IDYA 4FLKA 3IG4A 4IKRA 3S6BA 3FMQA 4FLJA 1YW9A 4ZWPA 2BWTA 5JI6A 3IU8A 3IU9A 2BHDA 4IU6A 3Q6DA 3CB6A 4FLLA 1QXYA 1C23A 4IKTA 1O0XA 1C21A 2V3XA 3MR1A 5D6EA 1PV9A 2EVCA 2BWXA 1WKMA 5FCFA 3CB5A 2MATA 2BWWA 4RZZA 2BHCA 4U6ZA 1YVMA 2GU6A 3FMRA 3PKBA 3PKAA 4RZYA 1B6AA 1C22A 3PKEA 4A6WA 2BB7A 4U6JA 4Z7MA 3MATA 5CNXA 4S00A 4ZWOA 5CIKA 4FO8A 2EA4A 4U69A 1WN1A 2Q8KA 3PKCA 3PKDA 1XGOA 2GG0A 2ADUA 2V6CA 3IU7A
chains in the Genus database with same CATH superfamily
2P98A 2G6PA 2Q94A 4ZNGA 1YW8A 4IPAA 2Q96A 3L24A 2EA2A 1WBQA 2BWVA 5CDEA 3MX6A 4U1BA 2GGCA 2Q95A 4U70A 4U73A 2B3LA 4FO7A 3CTZA 2OKNA 4JUQA 1BOAA 2GG7A 2B3KA 5CDVA 1KQ0A 2GG8A 5E5BA 2BH3A 4U75A 2GGBA 4IECA 3TB5A 1C27A 1Y1NA 1YJ3A 1WLRA 2NQ6A 3L7GA 4S2RP 4R60A 2OAZA 2GZ5A 2Q93A 4KM3A 2P9AA 2GU7A 3BIPA 1MATA 1JAWA 2BWUA 1KQ9A 3D27A 1W2MA 1B59A 5JFRA 1XGSA 2BN7A 4EGEA 4HXXA 4PNCA 1R5GA 2EVMA 1WL9A 1N51A 2GG5A 5CLSA 4U6CA 2P99A 4IF7A 1WL6A 2GA2A 2V3YA 2GU5A 1BN5A 2V3ZA 1QXWA 4FLIA 4OOKA 3BIQA 4A6VA 3FM3A 5JHUA 1YW7A 5CE6A 4U71A 4FKCA 2GU4A 5CDLA 1XGNA 1M35A 1WY2A 2BWYA 2BHAA 1CHMA 5FCHA 2B3HA 4ZWUA 1KP0A 3BITA 4RGZ1 4MATA 1W7VA 1R58A 3RVAA 2BHBA 2DFIA 4IKSA 2NQ7A 5D6FA 4QR8A 4IKUA 2GG2A 1QZYA 1C24A 4U6EA 2Q92A 3TAVA 4PV4A 2GG9A 2HOWA 1R5HA 1QXZA 1XNZA 2BWSA 2GTXA 4U6WA 4U76A 2ZSGA 1XGMA 4B28A 4FUKA 2EVOA 4S01A 2IW2A 3RORA 2GG3A 1A16A 4S2TP 4IDYA 4FLKA 3IG4A 4IKRA 3S6BA 3FMQA 4FLJA 1YW9A 4ZWPA 2BWTA 5JI6A 3IU8A 3IU9A 2BHDA 4IU6A 3Q6DA 3CB6A 4FLLA 1QXYA 1C23A 4IKTA 1O0XA 1C21A 2V3XA 3MR1A 5D6EA 1PV9A 2EVCA 2BWXA 1WKMA 5FCFA 3CB5A 2MATA 2BWWA 4RZZA 2BHCA 4U6ZA 1YVMA 2GU6A 3FMRA 3PKBA 3PKAA 4RZYA 1B6AA 1C22A 3PKEA 4A6WA 2BB7A 4U6JA 4Z7MA 3MATA 5CNXA 4S00A 4ZWOA 5CIKA 4FO8A 2EA4A 4U69A 1WN1A 2Q8KA 3PKCA 3PKDA 1XGOA 2GG0A 2ADUA 2V6CA 3IU7A
chains in the Genus database with same CATH topology
2P98A 2G6PA 2Q94A 4ZNGA 1YW8A 4IPAA 2Q96A 3L24A 2EA2A 1WBQA 2BWVA 5CDEA 3MX6A 4U1BA 2GGCA 2Q95A 4U70A 4U73A 2B3LA 4FO7A 3CTZA 2OKNA 4JUQA 1BOAA 2GG7A 2B3KA 5CDVA 1KQ0A 2GG8A 5E5BA 2BH3A 4U75A 2GGBA 4IECA 3TB5A 1C27A 1Y1NA 1YJ3A 1WLRA 2NQ6A 3L7GA 4S2RP 4R60A 2OAZA 2GZ5A 2Q93A 4KM3A 2P9AA 2GU7A 3BIPA 1MATA 1JAWA 2BWUA 1KQ9A 3D27A 1W2MA 1B59A 5JFRA 1XGSA 2BN7A 4EGEA 4HXXA 4PNCA 1R5GA 2EVMA 1WL9A 1N51A 2GG5A 5CLSA 4U6CA 2P99A 4IF7A 1WL6A 2GA2A 2V3YA 2GU5A 1BN5A 2V3ZA 1QXWA 4FLIA 4OOKA 3BIQA 4A6VA 3FM3A 5JHUA 1YW7A 5CE6A 4U71A 4FKCA 2GU4A 5CDLA 1XGNA 1M35A 1WY2A 2BWYA 2BHAA 1CHMA 5FCHA 2B3HA 4ZWUA 1KP0A 3BITA 4RGZ1 4MATA 1W7VA 1R58A 3RVAA 2BHBA 2DFIA 4IKSA 2NQ7A 5D6FA 4QR8A 4IKUA 2GG2A 1QZYA 1C24A 4U6EA 2Q92A 3TAVA 4PV4A 2GG9A 2HOWA 1R5HA 1QXZA 1XNZA 2BWSA 2GTXA 4U6WA 4U76A 2ZSGA 1XGMA 4B28A 4FUKA 2EVOA 4S01A 2IW2A 3RORA 2GG3A 1A16A 4S2TP 4IDYA 4FLKA 3IG4A 4IKRA 3S6BA 3FMQA 4FLJA 1YW9A 4ZWPA 2BWTA 5JI6A 3IU8A 3IU9A 2BHDA 4IU6A 3Q6DA 3CB6A 4FLLA 1QXYA 1C23A 4IKTA 1O0XA 1C21A 2V3XA 3MR1A 5D6EA 1PV9A 2EVCA 2BWXA 1WKMA 5FCFA 3CB5A 2MATA 2BWWA 4RZZA 2BHCA 4U6ZA 1YVMA 2GU6A 3FMRA 3PKBA 3PKAA 4RZYA 1B6AA 1C22A 3PKEA 4A6WA 2BB7A 4U6JA 4Z7MA 3MATA 5CNXA 4S00A 4ZWOA 5CIKA 4FO8A 2EA4A 4U69A 1WN1A 2Q8KA 3PKCA 3PKDA 1XGOA 2GG0A 2ADUA 2V6CA 3IU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P98 A;  2G6P A;  2Q94 A;  4ZNG A;  1YW8 A;  4IPA A;  2Q96 A;  3L24 A;  2EA2 A;  1WBQ A;  2BWV A;  5CDE A;  3MX6 A;  4U1B A;  2GGC A;  2Q95 A;  4U70 A;  4U73 A;  2B3L A;  4FO7 A;  3CTZ A;  2OKN A;  4JUQ A;  1BOA A;  2GG7 A;  2B3K A;  5CDV A;  1KQ0 A;  2GG8 A;  5E5B A;  2BH3 A;  4U75 A;  2GGB A;  4IEC A;  3TB5 A;  1C27 A;  1Y1N A;  1YJ3 A;  1WLR A;  2NQ6 A;  3L7G A;  4S2R P;  4R60 A;  2OAZ A;  2GZ5 A;  2Q93 A;  4KM3 A;  2P9A A;  2GU7 A;  3BIP A;  1MAT A;  1JAW A;  2BWU A;  1KQ9 A;  3D27 A;  1W2M A;  1B59 A;  5JFR A;  1XGS A;  2BN7 A;  4EGE A;  4HXX A;  4PNC A;  1R5G A;  2EVM A;  1WL9 A;  1N51 A;  2GG5 A;  5CLS A;  4U6C A;  2P99 A;  4IF7 A;  1WL6 A;  2GA2 A;  2V3Y A;  2GU5 A;  1BN5 A;  2V3Z A;  1QXW A;  4FLI A;  4OOK A;  3BIQ A;  4A6V A;  3FM3 A;  5JHU A;  1YW7 A;  5CE6 A;  4U71 A;  4FKC A;  2GU4 A;  5CDL A;  1XGN A;  1M35 A;  1WY2 A;  2BWY A;  2BHA A;  1CHM A;  5FCH A;  2B3H A;  4ZWU A;  1KP0 A;  3BIT A;  4RGZ 1;  4MAT A;  1W7V A;  1R58 A;  3RVA A;  2BHB A;  2DFI A;  4IKS A;  2NQ7 A;  5D6F A;  4QR8 A;  4IKU A;  2GG2 A;  1QZY A;  1C24 A;  4U6E A;  2Q92 A;  3TAV A;  4PV4 A;  2GG9 A;  2HOW A;  1R5H A;  1QXZ A;  1XNZ A;  2BWS A;  2GTX A;  4U6W A;  4U76 A;  2ZSG A;  1XGM A;  4B28 A;  4FUK A;  2EVO A;  4S01 A;  2IW2 A;  3ROR A;  2GG3 A;  1A16 A;  4S2T P;  4IDY A;  4FLK A;  3IG4 A;  4IKR A;  3S6B A;  3FMQ A;  4FLJ A;  1YW9 A;  4ZWP A;  2BWT A;  5JI6 A;  3IU8 A;  3IU9 A;  2BHD A;  4IU6 A;  3Q6D A;  3CB6 A;  4FLL A;  1QXY A;  1C23 A;  4IKT A;  1O0X A;  1C21 A;  2V3X A;  3MR1 A;  5D6E A;  1PV9 A;  2EVC A;  2BWX A;  1WKM A;  5FCF A;  3CB5 A;  2MAT A;  2BWW A;  4RZZ A;  2BHC A;  4U6Z A;  1YVM A;  2GU6 A;  3FMR A;  3PKB A;  3PKA A;  4RZY A;  1B6A A;  1C22 A;  3PKE A;  4A6W A;  2BB7 A;  4U6J A;  4Z7M A;  3MAT A;  5CNX A;  4S00 A;  4ZWO A;  5CIK A;  4FO8 A;  2EA4 A;  4U69 A;  1WN1 A;  2Q8K A;  3PKC A;  3PKD A;  1XGO A;  2GG0 A;  2ADU A;  2V6C A;  3IU7 A; 
#chains in the Genus database with same CATH topology
 2P98 A;  2G6P A;  2Q94 A;  4ZNG A;  1YW8 A;  4IPA A;  2Q96 A;  3L24 A;  2EA2 A;  1WBQ A;  2BWV A;  5CDE A;  3MX6 A;  4U1B A;  2GGC A;  2Q95 A;  4U70 A;  4U73 A;  2B3L A;  4FO7 A;  3CTZ A;  2OKN A;  4JUQ A;  1BOA A;  2GG7 A;  2B3K A;  5CDV A;  1KQ0 A;  2GG8 A;  5E5B A;  2BH3 A;  4U75 A;  2GGB A;  4IEC A;  3TB5 A;  1C27 A;  1Y1N A;  1YJ3 A;  1WLR A;  2NQ6 A;  3L7G A;  4S2R P;  4R60 A;  2OAZ A;  2GZ5 A;  2Q93 A;  4KM3 A;  2P9A A;  2GU7 A;  3BIP A;  1MAT A;  1JAW A;  2BWU A;  1KQ9 A;  3D27 A;  1W2M A;  1B59 A;  5JFR A;  1XGS A;  2BN7 A;  4EGE A;  4HXX A;  4PNC A;  1R5G A;  2EVM A;  1WL9 A;  1N51 A;  2GG5 A;  5CLS A;  4U6C A;  2P99 A;  4IF7 A;  1WL6 A;  2GA2 A;  2V3Y A;  2GU5 A;  1BN5 A;  2V3Z A;  1QXW A;  4FLI A;  4OOK A;  3BIQ A;  4A6V A;  3FM3 A;  5JHU A;  1YW7 A;  5CE6 A;  4U71 A;  4FKC A;  2GU4 A;  5CDL A;  1XGN A;  1M35 A;  1WY2 A;  2BWY A;  2BHA A;  1CHM A;  5FCH A;  2B3H A;  4ZWU A;  1KP0 A;  3BIT A;  4RGZ 1;  4MAT A;  1W7V A;  1R58 A;  3RVA A;  2BHB A;  2DFI A;  4IKS A;  2NQ7 A;  5D6F A;  4QR8 A;  4IKU A;  2GG2 A;  1QZY A;  1C24 A;  4U6E A;  2Q92 A;  3TAV A;  4PV4 A;  2GG9 A;  2HOW A;  1R5H A;  1QXZ A;  1XNZ A;  2BWS A;  2GTX A;  4U6W A;  4U76 A;  2ZSG A;  1XGM A;  4B28 A;  4FUK A;  2EVO A;  4S01 A;  2IW2 A;  3ROR A;  2GG3 A;  1A16 A;  4S2T P;  4IDY A;  4FLK A;  3IG4 A;  4IKR A;  3S6B A;  3FMQ A;  4FLJ A;  1YW9 A;  4ZWP A;  2BWT A;  5JI6 A;  3IU8 A;  3IU9 A;  2BHD A;  4IU6 A;  3Q6D A;  3CB6 A;  4FLL A;  1QXY A;  1C23 A;  4IKT A;  1O0X A;  1C21 A;  2V3X A;  3MR1 A;  5D6E A;  1PV9 A;  2EVC A;  2BWX A;  1WKM A;  5FCF A;  3CB5 A;  2MAT A;  2BWW A;  4RZZ A;  2BHC A;  4U6Z A;  1YVM A;  2GU6 A;  3FMR A;  3PKB A;  3PKA A;  4RZY A;  1B6A A;  1C22 A;  3PKE A;  4A6W A;  2BB7 A;  4U6J A;  4Z7M A;  3MAT A;  5CNX A;  4S00 A;  4ZWO A;  5CIK A;  4FO8 A;  2EA4 A;  4U69 A;  1WN1 A;  2Q8K A;  3PKC A;  3PKD A;  1XGO A;  2GG0 A;  2ADU A;  2V6C A;  3IU7 A; 
#chains in the Genus database with same CATH homology
 2P98 A;  2G6P A;  2Q94 A;  4ZNG A;  1YW8 A;  4IPA A;  2Q96 A;  3L24 A;  2EA2 A;  1WBQ A;  2BWV A;  5CDE A;  3MX6 A;  4U1B A;  2GGC A;  2Q95 A;  4U70 A;  4U73 A;  2B3L A;  4FO7 A;  3CTZ A;  2OKN A;  4JUQ A;  1BOA A;  2GG7 A;  2B3K A;  5CDV A;  1KQ0 A;  2GG8 A;  5E5B A;  2BH3 A;  4U75 A;  2GGB A;  4IEC A;  3TB5 A;  1C27 A;  1Y1N A;  1YJ3 A;  1WLR A;  2NQ6 A;  3L7G A;  4S2R P;  4R60 A;  2OAZ A;  2GZ5 A;  2Q93 A;  4KM3 A;  2P9A A;  2GU7 A;  3BIP A;  1MAT A;  1JAW A;  2BWU A;  1KQ9 A;  3D27 A;  1W2M A;  1B59 A;  5JFR A;  1XGS A;  2BN7 A;  4EGE A;  4HXX A;  4PNC A;  1R5G A;  2EVM A;  1WL9 A;  1N51 A;  2GG5 A;  5CLS A;  4U6C A;  2P99 A;  4IF7 A;  1WL6 A;  2GA2 A;  2V3Y A;  2GU5 A;  1BN5 A;  2V3Z A;  1QXW A;  4FLI A;  4OOK A;  3BIQ A;  4A6V A;  3FM3 A;  5JHU A;  1YW7 A;  5CE6 A;  4U71 A;  4FKC A;  2GU4 A;  5CDL A;  1XGN A;  1M35 A;  1WY2 A;  2BWY A;  2BHA A;  1CHM A;  5FCH A;  2B3H A;  4ZWU A;  1KP0 A;  3BIT A;  4RGZ 1;  4MAT A;  1W7V A;  1R58 A;  3RVA A;  2BHB A;  2DFI A;  4IKS A;  2NQ7 A;  5D6F A;  4QR8 A;  4IKU A;  2GG2 A;  1QZY A;  1C24 A;  4U6E A;  2Q92 A;  3TAV A;  4PV4 A;  2GG9 A;  2HOW A;  1R5H A;  1QXZ A;  1XNZ A;  2BWS A;  2GTX A;  4U6W A;  4U76 A;  2ZSG A;  1XGM A;  4B28 A;  4FUK A;  2EVO A;  4S01 A;  2IW2 A;  3ROR A;  2GG3 A;  1A16 A;  4S2T P;  4IDY A;  4FLK A;  3IG4 A;  4IKR A;  3S6B A;  3FMQ A;  4FLJ A;  1YW9 A;  4ZWP A;  2BWT A;  5JI6 A;  3IU8 A;  3IU9 A;  2BHD A;  4IU6 A;  3Q6D A;  3CB6 A;  4FLL A;  1QXY A;  1C23 A;  4IKT A;  1O0X A;  1C21 A;  2V3X A;  3MR1 A;  5D6E A;  1PV9 A;  2EVC A;  2BWX A;  1WKM A;  5FCF A;  3CB5 A;  2MAT A;  2BWW A;  4RZZ A;  2BHC A;  4U6Z A;  1YVM A;  2GU6 A;  3FMR A;  3PKB A;  3PKA A;  4RZY A;  1B6A A;  1C22 A;  3PKE A;  4A6W A;  2BB7 A;  4U6J A;  4Z7M A;  3MAT A;  5CNX A;  4S00 A;  4ZWO A;  5CIK A;  4FO8 A;  2EA4 A;  4U69 A;  1WN1 A;  2Q8K A;  3PKC A;  3PKD A;  1XGO A;  2GG0 A;  2ADU A;  2V6C A;  3IU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...