1O0XA

Crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
249
structure length
249
Chain Sequence
MIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a methionine aminopeptidase (TM1478) from Thermotoga maritima at 1.9 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1o0xA00
1WBQA 4PV4A 4U71A 3TAVA 2HOWA 2GG9A 1PV9A 4RZZA 4R60A 4ZWPA 4ZWOA 4U69A 2B3KA 3L7GA 4IKRA 1B6AA 2Q96A 1YJ3A 2BB7A 4IKUA 3IU8A 2BWWA 2P99A 4KM3A 2EVCA 2OAZA 4QR8A 1XGNA 3PKEA 1QXWA 2BWSA 4IDYA 1B59A 3FMRA 4RGZ1 1M35A 1WL9A 2BHDA 2GG0A 4FLIA 3IU7A 4U6CA 4U76A 5CDLA 1KP0A 2BHAA 2EA4A 2GTXA 1JAWA 3IU9A 4IKSA 1BN5A 1O0XA 5CDEA 2EA2A 4FO8A 2ZSGA 4MATA 2V6CA 3RVAA 2BWUA 3IG4A 4U1BA 3MR1A 5JFRA 1WLRA 1MATA 1BOAA 3PKCA 1R5HA 1XNZA 2V3ZA 5D6EA 5D6FA 1R5GA 3CB5A 1YVMA 1A16A 2MATA 2V3XA 1W7VA 5FCHA 5JHUA 2GGBA 4U75A 4A6WA 3BIQA 2GG3A 3MATA 1WKMA 1XGOA 2B3LA 5FCFA 4FKCA 4JUQA 4U70A 2GGCA 2BHBA 2GU7A 1W2MA 1C23A 4A6VA 1C27A 5JI6A 1QXYA 2DFIA 2GG5A 3BITA 1XGMA 4EGEA 2GU5A 2BWTA 2Q93A 5CLSA 3RORA 1QXZA 2GA2A 2BN7A 4FLLA 4PNCA 2Q95A 4U6EA 5CIKA 4B28A 4S2TP 4OOKA 3S6BA 2Q94A 2P9AA 5CE6A 4U6WA 1C21A 3PKDA 3TB5A 3FMQA 2BH3A 3MX6A 2GU6A 1KQ0A 4U73A 1YW8A 5E5BA 1WY2A 2IW2A 2Q92A 4FLKA 2GU4A 5CDVA 4IPAA 1XGSA 2ADUA 3Q6DA 4FO7A 4ZNGA 2BWXA 3L24A 2GG2A 1QZYA 2NQ6A 5CNXA 3FM3A 1YW9A 2BWVA 4S01A 4HXXA 2B3HA 2G6PA 2NQ7A 2OKNA 4S2RP 2BWYA 2GG7A 3D27A 4ZWUA 2GZ5A 2Q8KA 2BHCA 1CHMA 3CTZA 4IU6A 1C24A 4FLJA 4Z7MA 3PKAA 3CB6A 4S00A 4RZYA 4FUKA 1YW7A 2EVMA 4IKTA 1N51A 2EVOA 4IF7A 4U6ZA 4U6JA 3PKBA 4IECA 1Y1NA 1WN1A 2P98A 3BIPA 1C22A 1R58A 2GG8A 1WL6A 2V3YA 1KQ9A
chains in the Genus database with same CATH superfamily
1WBQA 4PV4A 4U71A 3TAVA 2HOWA 2GG9A 1PV9A 4RZZA 4R60A 4ZWPA 4ZWOA 4U69A 2B3KA 3L7GA 4IKRA 1B6AA 2Q96A 1YJ3A 2BB7A 4IKUA 3IU8A 2BWWA 2P99A 4KM3A 2EVCA 2OAZA 4QR8A 1XGNA 3PKEA 1QXWA 2BWSA 4IDYA 1B59A 3FMRA 4RGZ1 1M35A 1WL9A 2BHDA 2GG0A 4FLIA 3IU7A 4U6CA 4U76A 5CDLA 1KP0A 2BHAA 2EA4A 2GTXA 1JAWA 3IU9A 4IKSA 1BN5A 1O0XA 5CDEA 2EA2A 4FO8A 2ZSGA 4MATA 2V6CA 3RVAA 2BWUA 3IG4A 4U1BA 3MR1A 5JFRA 1WLRA 1MATA 1BOAA 3PKCA 1R5HA 1XNZA 2V3ZA 5D6EA 5D6FA 1R5GA 3CB5A 1YVMA 1A16A 2MATA 2V3XA 1W7VA 5FCHA 5JHUA 2GGBA 4U75A 4A6WA 3BIQA 2GG3A 3MATA 1WKMA 1XGOA 2B3LA 5FCFA 4FKCA 4JUQA 4U70A 2GGCA 2BHBA 2GU7A 1W2MA 1C23A 4A6VA 1C27A 5JI6A 1QXYA 2DFIA 2GG5A 3BITA 1XGMA 4EGEA 2GU5A 2BWTA 2Q93A 5CLSA 3RORA 1QXZA 2GA2A 2BN7A 4FLLA 4PNCA 2Q95A 4U6EA 5CIKA 4B28A 4S2TP 4OOKA 3S6BA 2Q94A 2P9AA 5CE6A 4U6WA 1C21A 3PKDA 3TB5A 3FMQA 2BH3A 3MX6A 2GU6A 1KQ0A 4U73A 1YW8A 5E5BA 1WY2A 2IW2A 2Q92A 4FLKA 2GU4A 5CDVA 4IPAA 1XGSA 2ADUA 3Q6DA 4FO7A 4ZNGA 2BWXA 3L24A 2GG2A 1QZYA 2NQ6A 5CNXA 3FM3A 1YW9A 2BWVA 4S01A 4HXXA 2B3HA 2G6PA 2NQ7A 2OKNA 4S2RP 2BWYA 2GG7A 3D27A 4ZWUA 2GZ5A 2Q8KA 2BHCA 1CHMA 3CTZA 4IU6A 1C24A 4FLJA 4Z7MA 3PKAA 3CB6A 4S00A 4RZYA 4FUKA 1YW7A 2EVMA 4IKTA 1N51A 2EVOA 4IF7A 4U6ZA 4U6JA 3PKBA 4IECA 1Y1NA 1WN1A 2P98A 3BIPA 1C22A 1R58A 2GG8A 1WL6A 2V3YA 1KQ9A
chains in the Genus database with same CATH topology
1WBQA 4PV4A 4U71A 3TAVA 2HOWA 2GG9A 1PV9A 4RZZA 4R60A 4ZWPA 4ZWOA 4U69A 2B3KA 3L7GA 4IKRA 1B6AA 2Q96A 1YJ3A 2BB7A 4IKUA 3IU8A 2BWWA 2P99A 4KM3A 2EVCA 2OAZA 4QR8A 1XGNA 3PKEA 1QXWA 2BWSA 4IDYA 1B59A 3FMRA 4RGZ1 1M35A 1WL9A 2BHDA 2GG0A 4FLIA 3IU7A 4U6CA 4U76A 5CDLA 1KP0A 2BHAA 2EA4A 2GTXA 1JAWA 3IU9A 4IKSA 1BN5A 1O0XA 5CDEA 2EA2A 4FO8A 2ZSGA 4MATA 2V6CA 3RVAA 2BWUA 3IG4A 4U1BA 3MR1A 5JFRA 1WLRA 1MATA 1BOAA 3PKCA 1R5HA 1XNZA 2V3ZA 5D6EA 5D6FA 1R5GA 3CB5A 1YVMA 1A16A 2MATA 2V3XA 1W7VA 5FCHA 5JHUA 2GGBA 4U75A 4A6WA 3BIQA 2GG3A 3MATA 1WKMA 1XGOA 2B3LA 5FCFA 4FKCA 4JUQA 4U70A 2GGCA 2BHBA 2GU7A 1W2MA 1C23A 4A6VA 1C27A 5JI6A 1QXYA 2DFIA 2GG5A 3BITA 1XGMA 4EGEA 2GU5A 2BWTA 2Q93A 5CLSA 3RORA 1QXZA 2GA2A 2BN7A 4FLLA 4PNCA 2Q95A 4U6EA 5CIKA 4B28A 4S2TP 4OOKA 3S6BA 2Q94A 2P9AA 5CE6A 4U6WA 1C21A 3PKDA 3TB5A 3FMQA 2BH3A 3MX6A 2GU6A 1KQ0A 4U73A 1YW8A 5E5BA 1WY2A 2IW2A 2Q92A 4FLKA 2GU4A 5CDVA 4IPAA 1XGSA 2ADUA 3Q6DA 4FO7A 4ZNGA 2BWXA 3L24A 2GG2A 1QZYA 2NQ6A 5CNXA 3FM3A 1YW9A 2BWVA 4S01A 4HXXA 2B3HA 2G6PA 2NQ7A 2OKNA 4S2RP 2BWYA 2GG7A 3D27A 4ZWUA 2GZ5A 2Q8KA 2BHCA 1CHMA 3CTZA 4IU6A 1C24A 4FLJA 4Z7MA 3PKAA 3CB6A 4S00A 4RZYA 4FUKA 1YW7A 2EVMA 4IKTA 1N51A 2EVOA 4IF7A 4U6ZA 4U6JA 3PKBA 4IECA 1Y1NA 1WN1A 2P98A 3BIPA 1C22A 1R58A 2GG8A 1WL6A 2V3YA 1KQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WBQ A;  4PV4 A;  4U71 A;  3TAV A;  2HOW A;  2GG9 A;  1PV9 A;  4RZZ A;  4R60 A;  4ZWP A;  4ZWO A;  4U69 A;  2B3K A;  3L7G A;  4IKR A;  1B6A A;  2Q96 A;  1YJ3 A;  2BB7 A;  4IKU A;  3IU8 A;  2BWW A;  2P99 A;  4KM3 A;  2EVC A;  2OAZ A;  4QR8 A;  1XGN A;  3PKE A;  1QXW A;  2BWS A;  4IDY A;  1B59 A;  3FMR A;  4RGZ 1;  1M35 A;  1WL9 A;  2BHD A;  2GG0 A;  4FLI A;  3IU7 A;  4U6C A;  4U76 A;  5CDL A;  1KP0 A;  2BHA A;  2EA4 A;  2GTX A;  1JAW A;  3IU9 A;  4IKS A;  1BN5 A;  1O0X A;  5CDE A;  2EA2 A;  4FO8 A;  2ZSG A;  4MAT A;  2V6C A;  3RVA A;  2BWU A;  3IG4 A;  4U1B A;  3MR1 A;  5JFR A;  1WLR A;  1MAT A;  1BOA A;  3PKC A;  1R5H A;  1XNZ A;  2V3Z A;  5D6E A;  5D6F A;  1R5G A;  3CB5 A;  1YVM A;  1A16 A;  2MAT A;  2V3X A;  1W7V A;  5FCH A;  5JHU A;  2GGB A;  4U75 A;  4A6W A;  3BIQ A;  2GG3 A;  3MAT A;  1WKM A;  1XGO A;  2B3L A;  5FCF A;  4FKC A;  4JUQ A;  4U70 A;  2GGC A;  2BHB A;  2GU7 A;  1W2M A;  1C23 A;  4A6V A;  1C27 A;  5JI6 A;  1QXY A;  2DFI A;  2GG5 A;  3BIT A;  1XGM A;  4EGE A;  2GU5 A;  2BWT A;  2Q93 A;  5CLS A;  3ROR A;  1QXZ A;  2GA2 A;  2BN7 A;  4FLL A;  4PNC A;  2Q95 A;  4U6E A;  5CIK A;  4B28 A;  4S2T P;  4OOK A;  3S6B A;  2Q94 A;  2P9A A;  5CE6 A;  4U6W A;  1C21 A;  3PKD A;  3TB5 A;  3FMQ A;  2BH3 A;  3MX6 A;  2GU6 A;  1KQ0 A;  4U73 A;  1YW8 A;  5E5B A;  1WY2 A;  2IW2 A;  2Q92 A;  4FLK A;  2GU4 A;  5CDV A;  4IPA A;  1XGS A;  2ADU A;  3Q6D A;  4FO7 A;  4ZNG A;  2BWX A;  3L24 A;  2GG2 A;  1QZY A;  2NQ6 A;  5CNX A;  3FM3 A;  1YW9 A;  2BWV A;  4S01 A;  4HXX A;  2B3H A;  2G6P A;  2NQ7 A;  2OKN A;  4S2R P;  2BWY A;  2GG7 A;  3D27 A;  4ZWU A;  2GZ5 A;  2Q8K A;  2BHC A;  1CHM A;  3CTZ A;  4IU6 A;  1C24 A;  4FLJ A;  4Z7M A;  3PKA A;  3CB6 A;  4S00 A;  4RZY A;  4FUK A;  1YW7 A;  2EVM A;  4IKT A;  1N51 A;  2EVO A;  4IF7 A;  4U6Z A;  4U6J A;  3PKB A;  4IEC A;  1Y1N A;  1WN1 A;  2P98 A;  3BIP A;  1C22 A;  1R58 A;  2GG8 A;  1WL6 A;  2V3Y A;  1KQ9 A; 
#chains in the Genus database with same CATH topology
 1WBQ A;  4PV4 A;  4U71 A;  3TAV A;  2HOW A;  2GG9 A;  1PV9 A;  4RZZ A;  4R60 A;  4ZWP A;  4ZWO A;  4U69 A;  2B3K A;  3L7G A;  4IKR A;  1B6A A;  2Q96 A;  1YJ3 A;  2BB7 A;  4IKU A;  3IU8 A;  2BWW A;  2P99 A;  4KM3 A;  2EVC A;  2OAZ A;  4QR8 A;  1XGN A;  3PKE A;  1QXW A;  2BWS A;  4IDY A;  1B59 A;  3FMR A;  4RGZ 1;  1M35 A;  1WL9 A;  2BHD A;  2GG0 A;  4FLI A;  3IU7 A;  4U6C A;  4U76 A;  5CDL A;  1KP0 A;  2BHA A;  2EA4 A;  2GTX A;  1JAW A;  3IU9 A;  4IKS A;  1BN5 A;  1O0X A;  5CDE A;  2EA2 A;  4FO8 A;  2ZSG A;  4MAT A;  2V6C A;  3RVA A;  2BWU A;  3IG4 A;  4U1B A;  3MR1 A;  5JFR A;  1WLR A;  1MAT A;  1BOA A;  3PKC A;  1R5H A;  1XNZ A;  2V3Z A;  5D6E A;  5D6F A;  1R5G A;  3CB5 A;  1YVM A;  1A16 A;  2MAT A;  2V3X A;  1W7V A;  5FCH A;  5JHU A;  2GGB A;  4U75 A;  4A6W A;  3BIQ A;  2GG3 A;  3MAT A;  1WKM A;  1XGO A;  2B3L A;  5FCF A;  4FKC A;  4JUQ A;  4U70 A;  2GGC A;  2BHB A;  2GU7 A;  1W2M A;  1C23 A;  4A6V A;  1C27 A;  5JI6 A;  1QXY A;  2DFI A;  2GG5 A;  3BIT A;  1XGM A;  4EGE A;  2GU5 A;  2BWT A;  2Q93 A;  5CLS A;  3ROR A;  1QXZ A;  2GA2 A;  2BN7 A;  4FLL A;  4PNC A;  2Q95 A;  4U6E A;  5CIK A;  4B28 A;  4S2T P;  4OOK A;  3S6B A;  2Q94 A;  2P9A A;  5CE6 A;  4U6W A;  1C21 A;  3PKD A;  3TB5 A;  3FMQ A;  2BH3 A;  3MX6 A;  2GU6 A;  1KQ0 A;  4U73 A;  1YW8 A;  5E5B A;  1WY2 A;  2IW2 A;  2Q92 A;  4FLK A;  2GU4 A;  5CDV A;  4IPA A;  1XGS A;  2ADU A;  3Q6D A;  4FO7 A;  4ZNG A;  2BWX A;  3L24 A;  2GG2 A;  1QZY A;  2NQ6 A;  5CNX A;  3FM3 A;  1YW9 A;  2BWV A;  4S01 A;  4HXX A;  2B3H A;  2G6P A;  2NQ7 A;  2OKN A;  4S2R P;  2BWY A;  2GG7 A;  3D27 A;  4ZWU A;  2GZ5 A;  2Q8K A;  2BHC A;  1CHM A;  3CTZ A;  4IU6 A;  1C24 A;  4FLJ A;  4Z7M A;  3PKA A;  3CB6 A;  4S00 A;  4RZY A;  4FUK A;  1YW7 A;  2EVM A;  4IKT A;  1N51 A;  2EVO A;  4IF7 A;  4U6Z A;  4U6J A;  3PKB A;  4IEC A;  1Y1N A;  1WN1 A;  2P98 A;  3BIP A;  1C22 A;  1R58 A;  2GG8 A;  1WL6 A;  2V3Y A;  1KQ9 A; 
#chains in the Genus database with same CATH homology
 1WBQ A;  4PV4 A;  4U71 A;  3TAV A;  2HOW A;  2GG9 A;  1PV9 A;  4RZZ A;  4R60 A;  4ZWP A;  4ZWO A;  4U69 A;  2B3K A;  3L7G A;  4IKR A;  1B6A A;  2Q96 A;  1YJ3 A;  2BB7 A;  4IKU A;  3IU8 A;  2BWW A;  2P99 A;  4KM3 A;  2EVC A;  2OAZ A;  4QR8 A;  1XGN A;  3PKE A;  1QXW A;  2BWS A;  4IDY A;  1B59 A;  3FMR A;  4RGZ 1;  1M35 A;  1WL9 A;  2BHD A;  2GG0 A;  4FLI A;  3IU7 A;  4U6C A;  4U76 A;  5CDL A;  1KP0 A;  2BHA A;  2EA4 A;  2GTX A;  1JAW A;  3IU9 A;  4IKS A;  1BN5 A;  1O0X A;  5CDE A;  2EA2 A;  4FO8 A;  2ZSG A;  4MAT A;  2V6C A;  3RVA A;  2BWU A;  3IG4 A;  4U1B A;  3MR1 A;  5JFR A;  1WLR A;  1MAT A;  1BOA A;  3PKC A;  1R5H A;  1XNZ A;  2V3Z A;  5D6E A;  5D6F A;  1R5G A;  3CB5 A;  1YVM A;  1A16 A;  2MAT A;  2V3X A;  1W7V A;  5FCH A;  5JHU A;  2GGB A;  4U75 A;  4A6W A;  3BIQ A;  2GG3 A;  3MAT A;  1WKM A;  1XGO A;  2B3L A;  5FCF A;  4FKC A;  4JUQ A;  4U70 A;  2GGC A;  2BHB A;  2GU7 A;  1W2M A;  1C23 A;  4A6V A;  1C27 A;  5JI6 A;  1QXY A;  2DFI A;  2GG5 A;  3BIT A;  1XGM A;  4EGE A;  2GU5 A;  2BWT A;  2Q93 A;  5CLS A;  3ROR A;  1QXZ A;  2GA2 A;  2BN7 A;  4FLL A;  4PNC A;  2Q95 A;  4U6E A;  5CIK A;  4B28 A;  4S2T P;  4OOK A;  3S6B A;  2Q94 A;  2P9A A;  5CE6 A;  4U6W A;  1C21 A;  3PKD A;  3TB5 A;  3FMQ A;  2BH3 A;  3MX6 A;  2GU6 A;  1KQ0 A;  4U73 A;  1YW8 A;  5E5B A;  1WY2 A;  2IW2 A;  2Q92 A;  4FLK A;  2GU4 A;  5CDV A;  4IPA A;  1XGS A;  2ADU A;  3Q6D A;  4FO7 A;  4ZNG A;  2BWX A;  3L24 A;  2GG2 A;  1QZY A;  2NQ6 A;  5CNX A;  3FM3 A;  1YW9 A;  2BWV A;  4S01 A;  4HXX A;  2B3H A;  2G6P A;  2NQ7 A;  2OKN A;  4S2R P;  2BWY A;  2GG7 A;  3D27 A;  4ZWU A;  2GZ5 A;  2Q8K A;  2BHC A;  1CHM A;  3CTZ A;  4IU6 A;  1C24 A;  4FLJ A;  4Z7M A;  3PKA A;  3CB6 A;  4S00 A;  4RZY A;  4FUK A;  1YW7 A;  2EVM A;  4IKT A;  1N51 A;  2EVO A;  4IF7 A;  4U6Z A;  4U6J A;  3PKB A;  4IEC A;  1Y1N A;  1WN1 A;  2P98 A;  3BIP A;  1C22 A;  1R58 A;  2GG8 A;  1WL6 A;  2V3Y A;  1KQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...