1O0XA

Crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
249
structure length
249
Chain Sequence
MIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a methionine aminopeptidase (TM1478) from Thermotoga maritima at 1.9 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1o0xA00
4IF7A 4U69A 3BIQA 3CB6A 4U76A 2DFIA 3MR1A 4QR8A 5CLSA 2Q95A 2BHAA 5CDVA 5FCHA 2Q94A 2ADUA 4U70A 1XGMA 5CIKA 2B3HA 2GU6A 2OKNA 2Q92A 5CDEA 2EVCA 2GG2A 1XNZA 2BWYA 1QXWA 4RZYA 4FUKA 1YW7A 4S01A 2IW2A 1WY2A 1C24A 1O0XA 4MATA 3MATA 2GG7A 4A6VA 4EGEA 3PKDA 1BN5A 4IKSA 1WL6A 1XGSA 3FMQA 2GG9A 4IPAA 1A16A 4OOKA 4A6WA 4JUQA 2GG8A 2P98A 3L7GA 3BITA 3IU7A 4IU6A 1WL9A 3RVAA 5D6EA 2GZ5A 1XGNA 4RGZ1 4U6CA 2NQ6A 2HOWA 4U6ZA 4U6JA 4ZNGA 2B3LA 2EVOA 3MX6A 4U6EA 5CE6A 1BOAA 5FCFA 4FKCA 1W7VA 1Y1NA 4U1BA 4R60A 1C22A 1C23A 4FLIA 2ZSGA 2BWVA 4IKTA 2B3KA 5CNXA 3D27A 5CDLA 3FM3A 1C21A 4FLKA 1YJ3A 1MATA 2BHDA 4S2TP 1WN1A 3IU8A 1KQ0A 2P9AA 4IECA 5JI6A 3TB5A 1W2MA 3CTZA 2GGCA 2Q93A 3PKBA 4ZWPA 2GU4A 4S00A 4ZWUA 2BN7A 1YVMA 2GU5A 2G6PA 4FLJA 3FMRA 3IU9A 3IG4A 1QXZA 2GG0A 1WKMA 2BWXA 3RORA 3PKAA 3L24A 2GG5A 2BH3A 4B28A 4FO8A 2OAZA 1YW9A 1KP0A 4U6WA 2BB7A 1M35A 3CB5A 3PKCA 2GGBA 5JHUA 2V3YA 4IKUA 3PKEA 4PV4A 2BHCA 4U71A 1PV9A 1QZYA 4ZWOA 1WLRA 2MATA 1N51A 1R58A 2EA2A 1R5GA 2GA2A 3TAVA 4Z7MA 1KQ9A 1R5HA 2EVMA 1CHMA 1B59A 5JFRA 4FLLA 2V3ZA 4U73A 4U75A 2V6CA 1JAWA 5E5BA 2GU7A 1C27A 5D6FA 2BWWA 2GTXA 2Q96A 2BWTA 3Q6DA 4RZZA 2NQ7A 1WBQA 2Q8KA 3BIPA 2V3XA 4FO7A 1XGOA 4HXXA 3S6BA 1B6AA 2BHBA 1QXYA 4S2RP 2P99A 2BWSA 4KM3A 2BWUA 2GG3A 1YW8A 4PNCA 4IKRA 4IDYA 2EA4A
chains in the Genus database with same CATH superfamily
4IF7A 4U69A 3BIQA 3CB6A 4U76A 2DFIA 3MR1A 4QR8A 5CLSA 2Q95A 2BHAA 5CDVA 5FCHA 2Q94A 2ADUA 4U70A 1XGMA 5CIKA 2B3HA 2GU6A 2OKNA 2Q92A 5CDEA 2EVCA 2GG2A 1XNZA 2BWYA 1QXWA 4RZYA 4FUKA 1YW7A 4S01A 2IW2A 1WY2A 1C24A 1O0XA 4MATA 3MATA 2GG7A 4A6VA 4EGEA 3PKDA 1BN5A 4IKSA 1WL6A 1XGSA 3FMQA 2GG9A 4IPAA 1A16A 4OOKA 4A6WA 4JUQA 2GG8A 2P98A 3L7GA 3BITA 3IU7A 4IU6A 1WL9A 3RVAA 5D6EA 2GZ5A 1XGNA 4RGZ1 4U6CA 2NQ6A 2HOWA 4U6ZA 4U6JA 4ZNGA 2B3LA 2EVOA 3MX6A 4U6EA 5CE6A 1BOAA 5FCFA 4FKCA 1W7VA 1Y1NA 4U1BA 4R60A 1C22A 1C23A 4FLIA 2ZSGA 2BWVA 4IKTA 2B3KA 5CNXA 3D27A 5CDLA 3FM3A 1C21A 4FLKA 1YJ3A 1MATA 2BHDA 4S2TP 1WN1A 3IU8A 1KQ0A 2P9AA 4IECA 5JI6A 3TB5A 1W2MA 3CTZA 2GGCA 2Q93A 3PKBA 4ZWPA 2GU4A 4S00A 4ZWUA 2BN7A 1YVMA 2GU5A 2G6PA 4FLJA 3FMRA 3IU9A 3IG4A 1QXZA 2GG0A 1WKMA 2BWXA 3RORA 3PKAA 3L24A 2GG5A 2BH3A 4B28A 4FO8A 2OAZA 1YW9A 1KP0A 4U6WA 2BB7A 1M35A 3CB5A 3PKCA 2GGBA 5JHUA 2V3YA 4IKUA 3PKEA 4PV4A 2BHCA 4U71A 1PV9A 1QZYA 4ZWOA 1WLRA 2MATA 1N51A 1R58A 2EA2A 1R5GA 2GA2A 3TAVA 4Z7MA 1KQ9A 1R5HA 2EVMA 1CHMA 1B59A 5JFRA 4FLLA 2V3ZA 4U73A 4U75A 2V6CA 1JAWA 5E5BA 2GU7A 1C27A 5D6FA 2BWWA 2GTXA 2Q96A 2BWTA 3Q6DA 4RZZA 2NQ7A 1WBQA 2Q8KA 3BIPA 2V3XA 4FO7A 1XGOA 4HXXA 3S6BA 1B6AA 2BHBA 1QXYA 4S2RP 2P99A 2BWSA 4KM3A 2BWUA 2GG3A 1YW8A 4PNCA 4IKRA 4IDYA 2EA4A
chains in the Genus database with same CATH topology
4IF7A 4U69A 3BIQA 3CB6A 4U76A 2DFIA 3MR1A 4QR8A 5CLSA 2Q95A 2BHAA 5CDVA 5FCHA 2Q94A 2ADUA 4U70A 1XGMA 5CIKA 2B3HA 2GU6A 2OKNA 2Q92A 5CDEA 2EVCA 2GG2A 1XNZA 2BWYA 1QXWA 4RZYA 4FUKA 1YW7A 4S01A 2IW2A 1WY2A 1C24A 1O0XA 4MATA 3MATA 2GG7A 4A6VA 4EGEA 3PKDA 1BN5A 4IKSA 1WL6A 1XGSA 3FMQA 2GG9A 4IPAA 1A16A 4OOKA 4A6WA 4JUQA 2GG8A 2P98A 3L7GA 3BITA 3IU7A 4IU6A 1WL9A 3RVAA 5D6EA 2GZ5A 1XGNA 4RGZ1 4U6CA 2NQ6A 2HOWA 4U6ZA 4U6JA 4ZNGA 2B3LA 2EVOA 3MX6A 4U6EA 5CE6A 1BOAA 5FCFA 4FKCA 1W7VA 1Y1NA 4U1BA 4R60A 1C22A 1C23A 4FLIA 2ZSGA 2BWVA 4IKTA 2B3KA 5CNXA 3D27A 5CDLA 3FM3A 1C21A 4FLKA 1YJ3A 1MATA 2BHDA 4S2TP 1WN1A 3IU8A 1KQ0A 2P9AA 4IECA 5JI6A 3TB5A 1W2MA 3CTZA 2GGCA 2Q93A 3PKBA 4ZWPA 2GU4A 4S00A 4ZWUA 2BN7A 1YVMA 2GU5A 2G6PA 4FLJA 3FMRA 3IU9A 3IG4A 1QXZA 2GG0A 1WKMA 2BWXA 3RORA 3PKAA 3L24A 2GG5A 2BH3A 4B28A 4FO8A 2OAZA 1YW9A 1KP0A 4U6WA 2BB7A 1M35A 3CB5A 3PKCA 2GGBA 5JHUA 2V3YA 4IKUA 3PKEA 4PV4A 2BHCA 4U71A 1PV9A 1QZYA 4ZWOA 1WLRA 2MATA 1N51A 1R58A 2EA2A 1R5GA 2GA2A 3TAVA 4Z7MA 1KQ9A 1R5HA 2EVMA 1CHMA 1B59A 5JFRA 4FLLA 2V3ZA 4U73A 4U75A 2V6CA 1JAWA 5E5BA 2GU7A 1C27A 5D6FA 2BWWA 2GTXA 2Q96A 2BWTA 3Q6DA 4RZZA 2NQ7A 1WBQA 2Q8KA 3BIPA 2V3XA 4FO7A 1XGOA 4HXXA 3S6BA 1B6AA 2BHBA 1QXYA 4S2RP 2P99A 2BWSA 4KM3A 2BWUA 2GG3A 1YW8A 4PNCA 4IKRA 4IDYA 2EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF7 A;  4U69 A;  3BIQ A;  3CB6 A;  4U76 A;  2DFI A;  3MR1 A;  4QR8 A;  5CLS A;  2Q95 A;  2BHA A;  5CDV A;  5FCH A;  2Q94 A;  2ADU A;  4U70 A;  1XGM A;  5CIK A;  2B3H A;  2GU6 A;  2OKN A;  2Q92 A;  5CDE A;  2EVC A;  2GG2 A;  1XNZ A;  2BWY A;  1QXW A;  4RZY A;  4FUK A;  1YW7 A;  4S01 A;  2IW2 A;  1WY2 A;  1C24 A;  1O0X A;  4MAT A;  3MAT A;  2GG7 A;  4A6V A;  4EGE A;  3PKD A;  1BN5 A;  4IKS A;  1WL6 A;  1XGS A;  3FMQ A;  2GG9 A;  4IPA A;  1A16 A;  4OOK A;  4A6W A;  4JUQ A;  2GG8 A;  2P98 A;  3L7G A;  3BIT A;  3IU7 A;  4IU6 A;  1WL9 A;  3RVA A;  5D6E A;  2GZ5 A;  1XGN A;  4RGZ 1;  4U6C A;  2NQ6 A;  2HOW A;  4U6Z A;  4U6J A;  4ZNG A;  2B3L A;  2EVO A;  3MX6 A;  4U6E A;  5CE6 A;  1BOA A;  5FCF A;  4FKC A;  1W7V A;  1Y1N A;  4U1B A;  4R60 A;  1C22 A;  1C23 A;  4FLI A;  2ZSG A;  2BWV A;  4IKT A;  2B3K A;  5CNX A;  3D27 A;  5CDL A;  3FM3 A;  1C21 A;  4FLK A;  1YJ3 A;  1MAT A;  2BHD A;  4S2T P;  1WN1 A;  3IU8 A;  1KQ0 A;  2P9A A;  4IEC A;  5JI6 A;  3TB5 A;  1W2M A;  3CTZ A;  2GGC A;  2Q93 A;  3PKB A;  4ZWP A;  2GU4 A;  4S00 A;  4ZWU A;  2BN7 A;  1YVM A;  2GU5 A;  2G6P A;  4FLJ A;  3FMR A;  3IU9 A;  3IG4 A;  1QXZ A;  2GG0 A;  1WKM A;  2BWX A;  3ROR A;  3PKA A;  3L24 A;  2GG5 A;  2BH3 A;  4B28 A;  4FO8 A;  2OAZ A;  1YW9 A;  1KP0 A;  4U6W A;  2BB7 A;  1M35 A;  3CB5 A;  3PKC A;  2GGB A;  5JHU A;  2V3Y A;  4IKU A;  3PKE A;  4PV4 A;  2BHC A;  4U71 A;  1PV9 A;  1QZY A;  4ZWO A;  1WLR A;  2MAT A;  1N51 A;  1R58 A;  2EA2 A;  1R5G A;  2GA2 A;  3TAV A;  4Z7M A;  1KQ9 A;  1R5H A;  2EVM A;  1CHM A;  1B59 A;  5JFR A;  4FLL A;  2V3Z A;  4U73 A;  4U75 A;  2V6C A;  1JAW A;  5E5B A;  2GU7 A;  1C27 A;  5D6F A;  2BWW A;  2GTX A;  2Q96 A;  2BWT A;  3Q6D A;  4RZZ A;  2NQ7 A;  1WBQ A;  2Q8K A;  3BIP A;  2V3X A;  4FO7 A;  1XGO A;  4HXX A;  3S6B A;  1B6A A;  2BHB A;  1QXY A;  4S2R P;  2P99 A;  2BWS A;  4KM3 A;  2BWU A;  2GG3 A;  1YW8 A;  4PNC A;  4IKR A;  4IDY A;  2EA4 A; 
#chains in the Genus database with same CATH topology
 4IF7 A;  4U69 A;  3BIQ A;  3CB6 A;  4U76 A;  2DFI A;  3MR1 A;  4QR8 A;  5CLS A;  2Q95 A;  2BHA A;  5CDV A;  5FCH A;  2Q94 A;  2ADU A;  4U70 A;  1XGM A;  5CIK A;  2B3H A;  2GU6 A;  2OKN A;  2Q92 A;  5CDE A;  2EVC A;  2GG2 A;  1XNZ A;  2BWY A;  1QXW A;  4RZY A;  4FUK A;  1YW7 A;  4S01 A;  2IW2 A;  1WY2 A;  1C24 A;  1O0X A;  4MAT A;  3MAT A;  2GG7 A;  4A6V A;  4EGE A;  3PKD A;  1BN5 A;  4IKS A;  1WL6 A;  1XGS A;  3FMQ A;  2GG9 A;  4IPA A;  1A16 A;  4OOK A;  4A6W A;  4JUQ A;  2GG8 A;  2P98 A;  3L7G A;  3BIT A;  3IU7 A;  4IU6 A;  1WL9 A;  3RVA A;  5D6E A;  2GZ5 A;  1XGN A;  4RGZ 1;  4U6C A;  2NQ6 A;  2HOW A;  4U6Z A;  4U6J A;  4ZNG A;  2B3L A;  2EVO A;  3MX6 A;  4U6E A;  5CE6 A;  1BOA A;  5FCF A;  4FKC A;  1W7V A;  1Y1N A;  4U1B A;  4R60 A;  1C22 A;  1C23 A;  4FLI A;  2ZSG A;  2BWV A;  4IKT A;  2B3K A;  5CNX A;  3D27 A;  5CDL A;  3FM3 A;  1C21 A;  4FLK A;  1YJ3 A;  1MAT A;  2BHD A;  4S2T P;  1WN1 A;  3IU8 A;  1KQ0 A;  2P9A A;  4IEC A;  5JI6 A;  3TB5 A;  1W2M A;  3CTZ A;  2GGC A;  2Q93 A;  3PKB A;  4ZWP A;  2GU4 A;  4S00 A;  4ZWU A;  2BN7 A;  1YVM A;  2GU5 A;  2G6P A;  4FLJ A;  3FMR A;  3IU9 A;  3IG4 A;  1QXZ A;  2GG0 A;  1WKM A;  2BWX A;  3ROR A;  3PKA A;  3L24 A;  2GG5 A;  2BH3 A;  4B28 A;  4FO8 A;  2OAZ A;  1YW9 A;  1KP0 A;  4U6W A;  2BB7 A;  1M35 A;  3CB5 A;  3PKC A;  2GGB A;  5JHU A;  2V3Y A;  4IKU A;  3PKE A;  4PV4 A;  2BHC A;  4U71 A;  1PV9 A;  1QZY A;  4ZWO A;  1WLR A;  2MAT A;  1N51 A;  1R58 A;  2EA2 A;  1R5G A;  2GA2 A;  3TAV A;  4Z7M A;  1KQ9 A;  1R5H A;  2EVM A;  1CHM A;  1B59 A;  5JFR A;  4FLL A;  2V3Z A;  4U73 A;  4U75 A;  2V6C A;  1JAW A;  5E5B A;  2GU7 A;  1C27 A;  5D6F A;  2BWW A;  2GTX A;  2Q96 A;  2BWT A;  3Q6D A;  4RZZ A;  2NQ7 A;  1WBQ A;  2Q8K A;  3BIP A;  2V3X A;  4FO7 A;  1XGO A;  4HXX A;  3S6B A;  1B6A A;  2BHB A;  1QXY A;  4S2R P;  2P99 A;  2BWS A;  4KM3 A;  2BWU A;  2GG3 A;  1YW8 A;  4PNC A;  4IKR A;  4IDY A;  2EA4 A; 
#chains in the Genus database with same CATH homology
 4IF7 A;  4U69 A;  3BIQ A;  3CB6 A;  4U76 A;  2DFI A;  3MR1 A;  4QR8 A;  5CLS A;  2Q95 A;  2BHA A;  5CDV A;  5FCH A;  2Q94 A;  2ADU A;  4U70 A;  1XGM A;  5CIK A;  2B3H A;  2GU6 A;  2OKN A;  2Q92 A;  5CDE A;  2EVC A;  2GG2 A;  1XNZ A;  2BWY A;  1QXW A;  4RZY A;  4FUK A;  1YW7 A;  4S01 A;  2IW2 A;  1WY2 A;  1C24 A;  1O0X A;  4MAT A;  3MAT A;  2GG7 A;  4A6V A;  4EGE A;  3PKD A;  1BN5 A;  4IKS A;  1WL6 A;  1XGS A;  3FMQ A;  2GG9 A;  4IPA A;  1A16 A;  4OOK A;  4A6W A;  4JUQ A;  2GG8 A;  2P98 A;  3L7G A;  3BIT A;  3IU7 A;  4IU6 A;  1WL9 A;  3RVA A;  5D6E A;  2GZ5 A;  1XGN A;  4RGZ 1;  4U6C A;  2NQ6 A;  2HOW A;  4U6Z A;  4U6J A;  4ZNG A;  2B3L A;  2EVO A;  3MX6 A;  4U6E A;  5CE6 A;  1BOA A;  5FCF A;  4FKC A;  1W7V A;  1Y1N A;  4U1B A;  4R60 A;  1C22 A;  1C23 A;  4FLI A;  2ZSG A;  2BWV A;  4IKT A;  2B3K A;  5CNX A;  3D27 A;  5CDL A;  3FM3 A;  1C21 A;  4FLK A;  1YJ3 A;  1MAT A;  2BHD A;  4S2T P;  1WN1 A;  3IU8 A;  1KQ0 A;  2P9A A;  4IEC A;  5JI6 A;  3TB5 A;  1W2M A;  3CTZ A;  2GGC A;  2Q93 A;  3PKB A;  4ZWP A;  2GU4 A;  4S00 A;  4ZWU A;  2BN7 A;  1YVM A;  2GU5 A;  2G6P A;  4FLJ A;  3FMR A;  3IU9 A;  3IG4 A;  1QXZ A;  2GG0 A;  1WKM A;  2BWX A;  3ROR A;  3PKA A;  3L24 A;  2GG5 A;  2BH3 A;  4B28 A;  4FO8 A;  2OAZ A;  1YW9 A;  1KP0 A;  4U6W A;  2BB7 A;  1M35 A;  3CB5 A;  3PKC A;  2GGB A;  5JHU A;  2V3Y A;  4IKU A;  3PKE A;  4PV4 A;  2BHC A;  4U71 A;  1PV9 A;  1QZY A;  4ZWO A;  1WLR A;  2MAT A;  1N51 A;  1R58 A;  2EA2 A;  1R5G A;  2GA2 A;  3TAV A;  4Z7M A;  1KQ9 A;  1R5H A;  2EVM A;  1CHM A;  1B59 A;  5JFR A;  4FLL A;  2V3Z A;  4U73 A;  4U75 A;  2V6C A;  1JAW A;  5E5B A;  2GU7 A;  1C27 A;  5D6F A;  2BWW A;  2GTX A;  2Q96 A;  2BWT A;  3Q6D A;  4RZZ A;  2NQ7 A;  1WBQ A;  2Q8K A;  3BIP A;  2V3X A;  4FO7 A;  1XGO A;  4HXX A;  3S6B A;  1B6A A;  2BHB A;  1QXY A;  4S2R P;  2P99 A;  2BWS A;  4KM3 A;  2BWU A;  2GG3 A;  1YW8 A;  4PNC A;  4IKR A;  4IDY A;  2EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...