1O0XA

Crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
249
structure length
249
Chain Sequence
MIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Crystal structure of a methionine aminopeptidase (TM1478) from Thermotoga maritima at 1.9 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 84
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1o0xA00
4ZWOA 1MATA 4U75A 4ZNGA 5FCFA 2GA2A 4R60A 4S2TP 2ADUA 3PKCA 4FLJA 1XGSA 1QZYA 1QXYA 1BN5A 4FKCA 4JUQA 1W7VA 1WN1A 4S2RP 5JI6A 3TAVA 4A6VA 2GG8A 3RVAA 5CDLA 5E5BA 2BWXA 1KQ0A 1PV9A 2B3HA 2BWWA 2Q96A 2OAZA 4FLIA 4U73A 3L7GA 3IU8A 1C24A 2G6PA 4S00A 4PV4A 3CB5A 2OKNA 3IU9A 4RGZ1 1WY2A 2GG5A 2BHCA 2BWYA 4OOKA 2GTXA 1R5HA 2MATA 2ZSGA 4S01A 3FMQA 4U69A 3PKDA 4QR8A 3BIQA 4ZWUA 4A6WA 3TB5A 2BWUA 3CTZA 4U70A 2EVOA 2GG0A 2BHDA 4ZWPA 4U6ZA 1XGMA 4IU6A 4U71A 2EVCA 4U76A 1WBQA 1XGOA 1C21A 4FO8A 2GG7A 4IKRA 3MX6A 3CB6A 1YJ3A 1C27A 2BWSA 4FLLA 1KQ9A 4U6WA 4Z7MA 1XNZA 3BIPA 4U6JA 1A16A 2V3ZA 5CDEA 4U1BA 2DFIA 2V3XA 1XGNA 2Q94A 4IDYA 4IF7A 1WLRA 2GU7A 1B6AA 3L24A 1N51A 2GGBA 3PKEA 2GGCA 2P9AA 4U6CA 2Q8KA 4RZYA 1O0XA 1BOAA 3Q6DA 5CIKA 4IECA 1QXWA 4IKTA 3IG4A 2B3LA 4FUKA 5D6EA 1CHMA 4U6EA 3BITA 2NQ6A 2B3KA 2GU5A 5CNXA 5CLSA 2V3YA 1YW9A 3MATA 4HXXA 2IW2A 1W2MA 2EVMA 2V6CA 4FO7A 2P99A 3IU7A 1QXZA 1YW7A 2BWTA 2BHAA 4IPAA 1R58A 2Q92A 1WL6A 3FM3A 2GG3A 5CE6A 3PKAA 1KP0A 2NQ7A 2HOWA 1M35A 2BB7A 5FCHA 3D27A 3RORA 1R5GA 5JHUA 4KM3A 3S6BA 4B28A 5D6FA 1YW8A 2BN7A 2BHBA 4IKUA 2P98A 1WL9A 3FMRA 4IKSA 2EA2A 5CDVA 2Q93A 2BWVA 2GU6A 2EA4A 2GG9A 4PNCA 1YVMA 1C23A 5JFRA 1JAWA 3MR1A 1WKMA 2GG2A 1Y1NA 2GU4A 2GZ5A 4MATA 1C22A 3PKBA 4RZZA 4EGEA 4FLKA 2BH3A 1B59A 2Q95A
chains in the Genus database with same CATH superfamily
4ZWOA 1MATA 4U75A 4ZNGA 5FCFA 2GA2A 4R60A 4S2TP 2ADUA 3PKCA 4FLJA 1XGSA 1QZYA 1QXYA 1BN5A 4FKCA 4JUQA 1W7VA 1WN1A 4S2RP 5JI6A 3TAVA 4A6VA 2GG8A 3RVAA 5CDLA 5E5BA 2BWXA 1KQ0A 1PV9A 2B3HA 2BWWA 2Q96A 2OAZA 4FLIA 4U73A 3L7GA 3IU8A 1C24A 2G6PA 4S00A 4PV4A 3CB5A 2OKNA 3IU9A 4RGZ1 1WY2A 2GG5A 2BHCA 2BWYA 4OOKA 2GTXA 1R5HA 2MATA 2ZSGA 4S01A 3FMQA 4U69A 3PKDA 4QR8A 3BIQA 4ZWUA 4A6WA 3TB5A 2BWUA 3CTZA 4U70A 2EVOA 2GG0A 2BHDA 4ZWPA 4U6ZA 1XGMA 4IU6A 4U71A 2EVCA 4U76A 1WBQA 1XGOA 1C21A 4FO8A 2GG7A 4IKRA 3MX6A 3CB6A 1YJ3A 1C27A 2BWSA 4FLLA 1KQ9A 4U6WA 4Z7MA 1XNZA 3BIPA 4U6JA 1A16A 2V3ZA 5CDEA 4U1BA 2DFIA 2V3XA 1XGNA 2Q94A 4IDYA 4IF7A 1WLRA 2GU7A 1B6AA 3L24A 1N51A 2GGBA 3PKEA 2GGCA 2P9AA 4U6CA 2Q8KA 4RZYA 1O0XA 1BOAA 3Q6DA 5CIKA 4IECA 1QXWA 4IKTA 3IG4A 2B3LA 4FUKA 5D6EA 1CHMA 4U6EA 3BITA 2NQ6A 2B3KA 2GU5A 5CNXA 5CLSA 2V3YA 1YW9A 3MATA 4HXXA 2IW2A 1W2MA 2EVMA 2V6CA 4FO7A 2P99A 3IU7A 1QXZA 1YW7A 2BWTA 2BHAA 4IPAA 1R58A 2Q92A 1WL6A 3FM3A 2GG3A 5CE6A 3PKAA 1KP0A 2NQ7A 2HOWA 1M35A 2BB7A 5FCHA 3D27A 3RORA 1R5GA 5JHUA 4KM3A 3S6BA 4B28A 5D6FA 1YW8A 2BN7A 2BHBA 4IKUA 2P98A 1WL9A 3FMRA 4IKSA 2EA2A 5CDVA 2Q93A 2BWVA 2GU6A 2EA4A 2GG9A 4PNCA 1YVMA 1C23A 5JFRA 1JAWA 3MR1A 1WKMA 2GG2A 1Y1NA 2GU4A 2GZ5A 4MATA 1C22A 3PKBA 4RZZA 4EGEA 4FLKA 2BH3A 1B59A 2Q95A
chains in the Genus database with same CATH topology
4ZWOA 1MATA 4U75A 4ZNGA 5FCFA 2GA2A 4R60A 4S2TP 2ADUA 3PKCA 4FLJA 1XGSA 1QZYA 1QXYA 1BN5A 4FKCA 4JUQA 1W7VA 1WN1A 4S2RP 5JI6A 3TAVA 4A6VA 2GG8A 3RVAA 5CDLA 5E5BA 2BWXA 1KQ0A 1PV9A 2B3HA 2BWWA 2Q96A 2OAZA 4FLIA 4U73A 3L7GA 3IU8A 1C24A 2G6PA 4S00A 4PV4A 3CB5A 2OKNA 3IU9A 4RGZ1 1WY2A 2GG5A 2BHCA 2BWYA 4OOKA 2GTXA 1R5HA 2MATA 2ZSGA 4S01A 3FMQA 4U69A 3PKDA 4QR8A 3BIQA 4ZWUA 4A6WA 3TB5A 2BWUA 3CTZA 4U70A 2EVOA 2GG0A 2BHDA 4ZWPA 4U6ZA 1XGMA 4IU6A 4U71A 2EVCA 4U76A 1WBQA 1XGOA 1C21A 4FO8A 2GG7A 4IKRA 3MX6A 3CB6A 1YJ3A 1C27A 2BWSA 4FLLA 1KQ9A 4U6WA 4Z7MA 1XNZA 3BIPA 4U6JA 1A16A 2V3ZA 5CDEA 4U1BA 2DFIA 2V3XA 1XGNA 2Q94A 4IDYA 4IF7A 1WLRA 2GU7A 1B6AA 3L24A 1N51A 2GGBA 3PKEA 2GGCA 2P9AA 4U6CA 2Q8KA 4RZYA 1O0XA 1BOAA 3Q6DA 5CIKA 4IECA 1QXWA 4IKTA 3IG4A 2B3LA 4FUKA 5D6EA 1CHMA 4U6EA 3BITA 2NQ6A 2B3KA 2GU5A 5CNXA 5CLSA 2V3YA 1YW9A 3MATA 4HXXA 2IW2A 1W2MA 2EVMA 2V6CA 4FO7A 2P99A 3IU7A 1QXZA 1YW7A 2BWTA 2BHAA 4IPAA 1R58A 2Q92A 1WL6A 3FM3A 2GG3A 5CE6A 3PKAA 1KP0A 2NQ7A 2HOWA 1M35A 2BB7A 5FCHA 3D27A 3RORA 1R5GA 5JHUA 4KM3A 3S6BA 4B28A 5D6FA 1YW8A 2BN7A 2BHBA 4IKUA 2P98A 1WL9A 3FMRA 4IKSA 2EA2A 5CDVA 2Q93A 2BWVA 2GU6A 2EA4A 2GG9A 4PNCA 1YVMA 1C23A 5JFRA 1JAWA 3MR1A 1WKMA 2GG2A 1Y1NA 2GU4A 2GZ5A 4MATA 1C22A 3PKBA 4RZZA 4EGEA 4FLKA 2BH3A 1B59A 2Q95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWO A;  1MAT A;  4U75 A;  4ZNG A;  5FCF A;  2GA2 A;  4R60 A;  4S2T P;  2ADU A;  3PKC A;  4FLJ A;  1XGS A;  1QZY A;  1QXY A;  1BN5 A;  4FKC A;  4JUQ A;  1W7V A;  1WN1 A;  4S2R P;  5JI6 A;  3TAV A;  4A6V A;  2GG8 A;  3RVA A;  5CDL A;  5E5B A;  2BWX A;  1KQ0 A;  1PV9 A;  2B3H A;  2BWW A;  2Q96 A;  2OAZ A;  4FLI A;  4U73 A;  3L7G A;  3IU8 A;  1C24 A;  2G6P A;  4S00 A;  4PV4 A;  3CB5 A;  2OKN A;  3IU9 A;  4RGZ 1;  1WY2 A;  2GG5 A;  2BHC A;  2BWY A;  4OOK A;  2GTX A;  1R5H A;  2MAT A;  2ZSG A;  4S01 A;  3FMQ A;  4U69 A;  3PKD A;  4QR8 A;  3BIQ A;  4ZWU A;  4A6W A;  3TB5 A;  2BWU A;  3CTZ A;  4U70 A;  2EVO A;  2GG0 A;  2BHD A;  4ZWP A;  4U6Z A;  1XGM A;  4IU6 A;  4U71 A;  2EVC A;  4U76 A;  1WBQ A;  1XGO A;  1C21 A;  4FO8 A;  2GG7 A;  4IKR A;  3MX6 A;  3CB6 A;  1YJ3 A;  1C27 A;  2BWS A;  4FLL A;  1KQ9 A;  4U6W A;  4Z7M A;  1XNZ A;  3BIP A;  4U6J A;  1A16 A;  2V3Z A;  5CDE A;  4U1B A;  2DFI A;  2V3X A;  1XGN A;  2Q94 A;  4IDY A;  4IF7 A;  1WLR A;  2GU7 A;  1B6A A;  3L24 A;  1N51 A;  2GGB A;  3PKE A;  2GGC A;  2P9A A;  4U6C A;  2Q8K A;  4RZY A;  1O0X A;  1BOA A;  3Q6D A;  5CIK A;  4IEC A;  1QXW A;  4IKT A;  3IG4 A;  2B3L A;  4FUK A;  5D6E A;  1CHM A;  4U6E A;  3BIT A;  2NQ6 A;  2B3K A;  2GU5 A;  5CNX A;  5CLS A;  2V3Y A;  1YW9 A;  3MAT A;  4HXX A;  2IW2 A;  1W2M A;  2EVM A;  2V6C A;  4FO7 A;  2P99 A;  3IU7 A;  1QXZ A;  1YW7 A;  2BWT A;  2BHA A;  4IPA A;  1R58 A;  2Q92 A;  1WL6 A;  3FM3 A;  2GG3 A;  5CE6 A;  3PKA A;  1KP0 A;  2NQ7 A;  2HOW A;  1M35 A;  2BB7 A;  5FCH A;  3D27 A;  3ROR A;  1R5G A;  5JHU A;  4KM3 A;  3S6B A;  4B28 A;  5D6F A;  1YW8 A;  2BN7 A;  2BHB A;  4IKU A;  2P98 A;  1WL9 A;  3FMR A;  4IKS A;  2EA2 A;  5CDV A;  2Q93 A;  2BWV A;  2GU6 A;  2EA4 A;  2GG9 A;  4PNC A;  1YVM A;  1C23 A;  5JFR A;  1JAW A;  3MR1 A;  1WKM A;  2GG2 A;  1Y1N A;  2GU4 A;  2GZ5 A;  4MAT A;  1C22 A;  3PKB A;  4RZZ A;  4EGE A;  4FLK A;  2BH3 A;  1B59 A;  2Q95 A; 
#chains in the Genus database with same CATH topology
 4ZWO A;  1MAT A;  4U75 A;  4ZNG A;  5FCF A;  2GA2 A;  4R60 A;  4S2T P;  2ADU A;  3PKC A;  4FLJ A;  1XGS A;  1QZY A;  1QXY A;  1BN5 A;  4FKC A;  4JUQ A;  1W7V A;  1WN1 A;  4S2R P;  5JI6 A;  3TAV A;  4A6V A;  2GG8 A;  3RVA A;  5CDL A;  5E5B A;  2BWX A;  1KQ0 A;  1PV9 A;  2B3H A;  2BWW A;  2Q96 A;  2OAZ A;  4FLI A;  4U73 A;  3L7G A;  3IU8 A;  1C24 A;  2G6P A;  4S00 A;  4PV4 A;  3CB5 A;  2OKN A;  3IU9 A;  4RGZ 1;  1WY2 A;  2GG5 A;  2BHC A;  2BWY A;  4OOK A;  2GTX A;  1R5H A;  2MAT A;  2ZSG A;  4S01 A;  3FMQ A;  4U69 A;  3PKD A;  4QR8 A;  3BIQ A;  4ZWU A;  4A6W A;  3TB5 A;  2BWU A;  3CTZ A;  4U70 A;  2EVO A;  2GG0 A;  2BHD A;  4ZWP A;  4U6Z A;  1XGM A;  4IU6 A;  4U71 A;  2EVC A;  4U76 A;  1WBQ A;  1XGO A;  1C21 A;  4FO8 A;  2GG7 A;  4IKR A;  3MX6 A;  3CB6 A;  1YJ3 A;  1C27 A;  2BWS A;  4FLL A;  1KQ9 A;  4U6W A;  4Z7M A;  1XNZ A;  3BIP A;  4U6J A;  1A16 A;  2V3Z A;  5CDE A;  4U1B A;  2DFI A;  2V3X A;  1XGN A;  2Q94 A;  4IDY A;  4IF7 A;  1WLR A;  2GU7 A;  1B6A A;  3L24 A;  1N51 A;  2GGB A;  3PKE A;  2GGC A;  2P9A A;  4U6C A;  2Q8K A;  4RZY A;  1O0X A;  1BOA A;  3Q6D A;  5CIK A;  4IEC A;  1QXW A;  4IKT A;  3IG4 A;  2B3L A;  4FUK A;  5D6E A;  1CHM A;  4U6E A;  3BIT A;  2NQ6 A;  2B3K A;  2GU5 A;  5CNX A;  5CLS A;  2V3Y A;  1YW9 A;  3MAT A;  4HXX A;  2IW2 A;  1W2M A;  2EVM A;  2V6C A;  4FO7 A;  2P99 A;  3IU7 A;  1QXZ A;  1YW7 A;  2BWT A;  2BHA A;  4IPA A;  1R58 A;  2Q92 A;  1WL6 A;  3FM3 A;  2GG3 A;  5CE6 A;  3PKA A;  1KP0 A;  2NQ7 A;  2HOW A;  1M35 A;  2BB7 A;  5FCH A;  3D27 A;  3ROR A;  1R5G A;  5JHU A;  4KM3 A;  3S6B A;  4B28 A;  5D6F A;  1YW8 A;  2BN7 A;  2BHB A;  4IKU A;  2P98 A;  1WL9 A;  3FMR A;  4IKS A;  2EA2 A;  5CDV A;  2Q93 A;  2BWV A;  2GU6 A;  2EA4 A;  2GG9 A;  4PNC A;  1YVM A;  1C23 A;  5JFR A;  1JAW A;  3MR1 A;  1WKM A;  2GG2 A;  1Y1N A;  2GU4 A;  2GZ5 A;  4MAT A;  1C22 A;  3PKB A;  4RZZ A;  4EGE A;  4FLK A;  2BH3 A;  1B59 A;  2Q95 A; 
#chains in the Genus database with same CATH homology
 4ZWO A;  1MAT A;  4U75 A;  4ZNG A;  5FCF A;  2GA2 A;  4R60 A;  4S2T P;  2ADU A;  3PKC A;  4FLJ A;  1XGS A;  1QZY A;  1QXY A;  1BN5 A;  4FKC A;  4JUQ A;  1W7V A;  1WN1 A;  4S2R P;  5JI6 A;  3TAV A;  4A6V A;  2GG8 A;  3RVA A;  5CDL A;  5E5B A;  2BWX A;  1KQ0 A;  1PV9 A;  2B3H A;  2BWW A;  2Q96 A;  2OAZ A;  4FLI A;  4U73 A;  3L7G A;  3IU8 A;  1C24 A;  2G6P A;  4S00 A;  4PV4 A;  3CB5 A;  2OKN A;  3IU9 A;  4RGZ 1;  1WY2 A;  2GG5 A;  2BHC A;  2BWY A;  4OOK A;  2GTX A;  1R5H A;  2MAT A;  2ZSG A;  4S01 A;  3FMQ A;  4U69 A;  3PKD A;  4QR8 A;  3BIQ A;  4ZWU A;  4A6W A;  3TB5 A;  2BWU A;  3CTZ A;  4U70 A;  2EVO A;  2GG0 A;  2BHD A;  4ZWP A;  4U6Z A;  1XGM A;  4IU6 A;  4U71 A;  2EVC A;  4U76 A;  1WBQ A;  1XGO A;  1C21 A;  4FO8 A;  2GG7 A;  4IKR A;  3MX6 A;  3CB6 A;  1YJ3 A;  1C27 A;  2BWS A;  4FLL A;  1KQ9 A;  4U6W A;  4Z7M A;  1XNZ A;  3BIP A;  4U6J A;  1A16 A;  2V3Z A;  5CDE A;  4U1B A;  2DFI A;  2V3X A;  1XGN A;  2Q94 A;  4IDY A;  4IF7 A;  1WLR A;  2GU7 A;  1B6A A;  3L24 A;  1N51 A;  2GGB A;  3PKE A;  2GGC A;  2P9A A;  4U6C A;  2Q8K A;  4RZY A;  1O0X A;  1BOA A;  3Q6D A;  5CIK A;  4IEC A;  1QXW A;  4IKT A;  3IG4 A;  2B3L A;  4FUK A;  5D6E A;  1CHM A;  4U6E A;  3BIT A;  2NQ6 A;  2B3K A;  2GU5 A;  5CNX A;  5CLS A;  2V3Y A;  1YW9 A;  3MAT A;  4HXX A;  2IW2 A;  1W2M A;  2EVM A;  2V6C A;  4FO7 A;  2P99 A;  3IU7 A;  1QXZ A;  1YW7 A;  2BWT A;  2BHA A;  4IPA A;  1R58 A;  2Q92 A;  1WL6 A;  3FM3 A;  2GG3 A;  5CE6 A;  3PKA A;  1KP0 A;  2NQ7 A;  2HOW A;  1M35 A;  2BB7 A;  5FCH A;  3D27 A;  3ROR A;  1R5G A;  5JHU A;  4KM3 A;  3S6B A;  4B28 A;  5D6F A;  1YW8 A;  2BN7 A;  2BHB A;  4IKU A;  2P98 A;  1WL9 A;  3FMR A;  4IKS A;  2EA2 A;  5CDV A;  2Q93 A;  2BWV A;  2GU6 A;  2EA4 A;  2GG9 A;  4PNC A;  1YVM A;  1C23 A;  5JFR A;  1JAW A;  3MR1 A;  1WKM A;  2GG2 A;  1Y1N A;  2GU4 A;  2GZ5 A;  4MAT A;  1C22 A;  3PKB A;  4RZZ A;  4EGE A;  4FLK A;  2BH3 A;  1B59 A;  2Q95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...