1O0XA

Crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
249
structure length
249
Chain Sequence
MIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Crystal structure of a methionine aminopeptidase (TM1478) from Thermotoga maritima at 1.9 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 84
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1o0xA00
1W7VA 5CE6A 1WN1A 3PKCA 5CLSA 4FKCA 3Q6DA 1M35A 5JFRA 2BB7A 1QXYA 1W2MA 2HOWA 3L7GA 1YW7A 1WLRA 2GA2A 4U76A 3D27A 2B3KA 4EGEA 1QXWA 1C22A 2Q94A 2OAZA 1KQ9A 3CB5A 2GG8A 4S00A 4FO8A 4IDYA 1YJ3A 2GU4A 2NQ7A 4PV4A 3FMRA 2BWSA 4MATA 2EVCA 3S6BA 1R5HA 4FLIA 4IPAA 2V3XA 4RZYA 3BITA 4S2TP 2OKNA 4R60A 2BWTA 4FO7A 2BWVA 4U6JA 2P98A 3PKAA 2GGBA 2BWWA 2BWXA 1KP0A 3BIPA 5D6EA 2GG3A 2BHDA 2Q93A 3IU8A 2Q92A 5JHUA 2DFIA 3PKBA 4ZWPA 3RVAA 4U6WA 1KQ0A 4B28A 5CDEA 2P99A 1XGNA 2EA4A 2P9AA 5FCFA 2GG0A 2GTXA 3MX6A 3IU7A 4FUKA 2GGCA 3BIQA 2GU5A 2GG9A 1XGMA 3RORA 3L24A 1WKMA 2BHBA 4IU6A 3CTZA 4IKTA 1C24A 4HXXA 4U1BA 4RZZA 3CB6A 5CDLA 1CHMA 1BOAA 2GU7A 2ADUA 3PKDA 5FCHA 2Q8KA 3TAVA 1YW8A 1C21A 2NQ6A 4U6CA 2GZ5A 4IECA 4A6WA 1R58A 1WL9A 2BWUA 3FMQA 4QR8A 5CIKA 5E5BA 1MATA 2GU6A 3IG4A 3MR1A 4FLJA 3FM3A 1XGSA 2BHAA 2BH3A 2GG2A 4S01A 2Q96A 2V3YA 5JI6A 1XNZA 3IU9A 4ZWUA 2EVMA 4S2RP 1C23A 2BWYA 4FLLA 4Z7MA 5CDVA 4U6ZA 1PV9A 2GG5A 1C27A 4A6VA 4JUQA 2BN7A 1QZYA 1YVMA 1B6AA 3PKEA 1Y1NA 2G6PA 1O0XA 1BN5A 4U69A 5D6FA 1XGOA 1B59A 4U75A 2ZSGA 1N51A 1QXZA 4U71A 3TB5A 4PNCA 4IKSA 1WL6A 4KM3A 2B3LA 2B3HA 2IW2A 4IKUA 2EVOA 4FLKA 2EA2A 4U70A 4IKRA 1WBQA 1YW9A 4ZNGA 4ZWOA 4OOKA 2V6CA 2V3ZA 1JAWA 1WY2A 4RGZ1 2MATA 4IF7A 3MATA 2Q95A 2BHCA 4U73A 1A16A 1R5GA 5CNXA 4U6EA 2GG7A
chains in the Genus database with same CATH superfamily
1W7VA 5CE6A 1WN1A 3PKCA 5CLSA 4FKCA 3Q6DA 1M35A 5JFRA 2BB7A 1QXYA 1W2MA 2HOWA 3L7GA 1YW7A 1WLRA 2GA2A 4U76A 3D27A 2B3KA 4EGEA 1QXWA 1C22A 2Q94A 2OAZA 1KQ9A 3CB5A 2GG8A 4S00A 4FO8A 4IDYA 1YJ3A 2GU4A 2NQ7A 4PV4A 3FMRA 2BWSA 4MATA 2EVCA 3S6BA 1R5HA 4FLIA 4IPAA 2V3XA 4RZYA 3BITA 4S2TP 2OKNA 4R60A 2BWTA 4FO7A 2BWVA 4U6JA 2P98A 3PKAA 2GGBA 2BWWA 2BWXA 1KP0A 3BIPA 5D6EA 2GG3A 2BHDA 2Q93A 3IU8A 2Q92A 5JHUA 2DFIA 3PKBA 4ZWPA 3RVAA 4U6WA 1KQ0A 4B28A 5CDEA 2P99A 1XGNA 2EA4A 2P9AA 5FCFA 2GG0A 2GTXA 3MX6A 3IU7A 4FUKA 2GGCA 3BIQA 2GU5A 2GG9A 1XGMA 3RORA 3L24A 1WKMA 2BHBA 4IU6A 3CTZA 4IKTA 1C24A 4HXXA 4U1BA 4RZZA 3CB6A 5CDLA 1CHMA 1BOAA 2GU7A 2ADUA 3PKDA 5FCHA 2Q8KA 3TAVA 1YW8A 1C21A 2NQ6A 4U6CA 2GZ5A 4IECA 4A6WA 1R58A 1WL9A 2BWUA 3FMQA 4QR8A 5CIKA 5E5BA 1MATA 2GU6A 3IG4A 3MR1A 4FLJA 3FM3A 1XGSA 2BHAA 2BH3A 2GG2A 4S01A 2Q96A 2V3YA 5JI6A 1XNZA 3IU9A 4ZWUA 2EVMA 4S2RP 1C23A 2BWYA 4FLLA 4Z7MA 5CDVA 4U6ZA 1PV9A 2GG5A 1C27A 4A6VA 4JUQA 2BN7A 1QZYA 1YVMA 1B6AA 3PKEA 1Y1NA 2G6PA 1O0XA 1BN5A 4U69A 5D6FA 1XGOA 1B59A 4U75A 2ZSGA 1N51A 1QXZA 4U71A 3TB5A 4PNCA 4IKSA 1WL6A 4KM3A 2B3LA 2B3HA 2IW2A 4IKUA 2EVOA 4FLKA 2EA2A 4U70A 4IKRA 1WBQA 1YW9A 4ZNGA 4ZWOA 4OOKA 2V6CA 2V3ZA 1JAWA 1WY2A 4RGZ1 2MATA 4IF7A 3MATA 2Q95A 2BHCA 4U73A 1A16A 1R5GA 5CNXA 4U6EA 2GG7A
chains in the Genus database with same CATH topology
1W7VA 5CE6A 1WN1A 3PKCA 5CLSA 4FKCA 3Q6DA 1M35A 5JFRA 2BB7A 1QXYA 1W2MA 2HOWA 3L7GA 1YW7A 1WLRA 2GA2A 4U76A 3D27A 2B3KA 4EGEA 1QXWA 1C22A 2Q94A 2OAZA 1KQ9A 3CB5A 2GG8A 4S00A 4FO8A 4IDYA 1YJ3A 2GU4A 2NQ7A 4PV4A 3FMRA 2BWSA 4MATA 2EVCA 3S6BA 1R5HA 4FLIA 4IPAA 2V3XA 4RZYA 3BITA 4S2TP 2OKNA 4R60A 2BWTA 4FO7A 2BWVA 4U6JA 2P98A 3PKAA 2GGBA 2BWWA 2BWXA 1KP0A 3BIPA 5D6EA 2GG3A 2BHDA 2Q93A 3IU8A 2Q92A 5JHUA 2DFIA 3PKBA 4ZWPA 3RVAA 4U6WA 1KQ0A 4B28A 5CDEA 2P99A 1XGNA 2EA4A 2P9AA 5FCFA 2GG0A 2GTXA 3MX6A 3IU7A 4FUKA 2GGCA 3BIQA 2GU5A 2GG9A 1XGMA 3RORA 3L24A 1WKMA 2BHBA 4IU6A 3CTZA 4IKTA 1C24A 4HXXA 4U1BA 4RZZA 3CB6A 5CDLA 1CHMA 1BOAA 2GU7A 2ADUA 3PKDA 5FCHA 2Q8KA 3TAVA 1YW8A 1C21A 2NQ6A 4U6CA 2GZ5A 4IECA 4A6WA 1R58A 1WL9A 2BWUA 3FMQA 4QR8A 5CIKA 5E5BA 1MATA 2GU6A 3IG4A 3MR1A 4FLJA 3FM3A 1XGSA 2BHAA 2BH3A 2GG2A 4S01A 2Q96A 2V3YA 5JI6A 1XNZA 3IU9A 4ZWUA 2EVMA 4S2RP 1C23A 2BWYA 4FLLA 4Z7MA 5CDVA 4U6ZA 1PV9A 2GG5A 1C27A 4A6VA 4JUQA 2BN7A 1QZYA 1YVMA 1B6AA 3PKEA 1Y1NA 2G6PA 1O0XA 1BN5A 4U69A 5D6FA 1XGOA 1B59A 4U75A 2ZSGA 1N51A 1QXZA 4U71A 3TB5A 4PNCA 4IKSA 1WL6A 4KM3A 2B3LA 2B3HA 2IW2A 4IKUA 2EVOA 4FLKA 2EA2A 4U70A 4IKRA 1WBQA 1YW9A 4ZNGA 4ZWOA 4OOKA 2V6CA 2V3ZA 1JAWA 1WY2A 4RGZ1 2MATA 4IF7A 3MATA 2Q95A 2BHCA 4U73A 1A16A 1R5GA 5CNXA 4U6EA 2GG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7V A;  5CE6 A;  1WN1 A;  3PKC A;  5CLS A;  4FKC A;  3Q6D A;  1M35 A;  5JFR A;  2BB7 A;  1QXY A;  1W2M A;  2HOW A;  3L7G A;  1YW7 A;  1WLR A;  2GA2 A;  4U76 A;  3D27 A;  2B3K A;  4EGE A;  1QXW A;  1C22 A;  2Q94 A;  2OAZ A;  1KQ9 A;  3CB5 A;  2GG8 A;  4S00 A;  4FO8 A;  4IDY A;  1YJ3 A;  2GU4 A;  2NQ7 A;  4PV4 A;  3FMR A;  2BWS A;  4MAT A;  2EVC A;  3S6B A;  1R5H A;  4FLI A;  4IPA A;  2V3X A;  4RZY A;  3BIT A;  4S2T P;  2OKN A;  4R60 A;  2BWT A;  4FO7 A;  2BWV A;  4U6J A;  2P98 A;  3PKA A;  2GGB A;  2BWW A;  2BWX A;  1KP0 A;  3BIP A;  5D6E A;  2GG3 A;  2BHD A;  2Q93 A;  3IU8 A;  2Q92 A;  5JHU A;  2DFI A;  3PKB A;  4ZWP A;  3RVA A;  4U6W A;  1KQ0 A;  4B28 A;  5CDE A;  2P99 A;  1XGN A;  2EA4 A;  2P9A A;  5FCF A;  2GG0 A;  2GTX A;  3MX6 A;  3IU7 A;  4FUK A;  2GGC A;  3BIQ A;  2GU5 A;  2GG9 A;  1XGM A;  3ROR A;  3L24 A;  1WKM A;  2BHB A;  4IU6 A;  3CTZ A;  4IKT A;  1C24 A;  4HXX A;  4U1B A;  4RZZ A;  3CB6 A;  5CDL A;  1CHM A;  1BOA A;  2GU7 A;  2ADU A;  3PKD A;  5FCH A;  2Q8K A;  3TAV A;  1YW8 A;  1C21 A;  2NQ6 A;  4U6C A;  2GZ5 A;  4IEC A;  4A6W A;  1R58 A;  1WL9 A;  2BWU A;  3FMQ A;  4QR8 A;  5CIK A;  5E5B A;  1MAT A;  2GU6 A;  3IG4 A;  3MR1 A;  4FLJ A;  3FM3 A;  1XGS A;  2BHA A;  2BH3 A;  2GG2 A;  4S01 A;  2Q96 A;  2V3Y A;  5JI6 A;  1XNZ A;  3IU9 A;  4ZWU A;  2EVM A;  4S2R P;  1C23 A;  2BWY A;  4FLL A;  4Z7M A;  5CDV A;  4U6Z A;  1PV9 A;  2GG5 A;  1C27 A;  4A6V A;  4JUQ A;  2BN7 A;  1QZY A;  1YVM A;  1B6A A;  3PKE A;  1Y1N A;  2G6P A;  1O0X A;  1BN5 A;  4U69 A;  5D6F A;  1XGO A;  1B59 A;  4U75 A;  2ZSG A;  1N51 A;  1QXZ A;  4U71 A;  3TB5 A;  4PNC A;  4IKS A;  1WL6 A;  4KM3 A;  2B3L A;  2B3H A;  2IW2 A;  4IKU A;  2EVO A;  4FLK A;  2EA2 A;  4U70 A;  4IKR A;  1WBQ A;  1YW9 A;  4ZNG A;  4ZWO A;  4OOK A;  2V6C A;  2V3Z A;  1JAW A;  1WY2 A;  4RGZ 1;  2MAT A;  4IF7 A;  3MAT A;  2Q95 A;  2BHC A;  4U73 A;  1A16 A;  1R5G A;  5CNX A;  4U6E A;  2GG7 A; 
#chains in the Genus database with same CATH topology
 1W7V A;  5CE6 A;  1WN1 A;  3PKC A;  5CLS A;  4FKC A;  3Q6D A;  1M35 A;  5JFR A;  2BB7 A;  1QXY A;  1W2M A;  2HOW A;  3L7G A;  1YW7 A;  1WLR A;  2GA2 A;  4U76 A;  3D27 A;  2B3K A;  4EGE A;  1QXW A;  1C22 A;  2Q94 A;  2OAZ A;  1KQ9 A;  3CB5 A;  2GG8 A;  4S00 A;  4FO8 A;  4IDY A;  1YJ3 A;  2GU4 A;  2NQ7 A;  4PV4 A;  3FMR A;  2BWS A;  4MAT A;  2EVC A;  3S6B A;  1R5H A;  4FLI A;  4IPA A;  2V3X A;  4RZY A;  3BIT A;  4S2T P;  2OKN A;  4R60 A;  2BWT A;  4FO7 A;  2BWV A;  4U6J A;  2P98 A;  3PKA A;  2GGB A;  2BWW A;  2BWX A;  1KP0 A;  3BIP A;  5D6E A;  2GG3 A;  2BHD A;  2Q93 A;  3IU8 A;  2Q92 A;  5JHU A;  2DFI A;  3PKB A;  4ZWP A;  3RVA A;  4U6W A;  1KQ0 A;  4B28 A;  5CDE A;  2P99 A;  1XGN A;  2EA4 A;  2P9A A;  5FCF A;  2GG0 A;  2GTX A;  3MX6 A;  3IU7 A;  4FUK A;  2GGC A;  3BIQ A;  2GU5 A;  2GG9 A;  1XGM A;  3ROR A;  3L24 A;  1WKM A;  2BHB A;  4IU6 A;  3CTZ A;  4IKT A;  1C24 A;  4HXX A;  4U1B A;  4RZZ A;  3CB6 A;  5CDL A;  1CHM A;  1BOA A;  2GU7 A;  2ADU A;  3PKD A;  5FCH A;  2Q8K A;  3TAV A;  1YW8 A;  1C21 A;  2NQ6 A;  4U6C A;  2GZ5 A;  4IEC A;  4A6W A;  1R58 A;  1WL9 A;  2BWU A;  3FMQ A;  4QR8 A;  5CIK A;  5E5B A;  1MAT A;  2GU6 A;  3IG4 A;  3MR1 A;  4FLJ A;  3FM3 A;  1XGS A;  2BHA A;  2BH3 A;  2GG2 A;  4S01 A;  2Q96 A;  2V3Y A;  5JI6 A;  1XNZ A;  3IU9 A;  4ZWU A;  2EVM A;  4S2R P;  1C23 A;  2BWY A;  4FLL A;  4Z7M A;  5CDV A;  4U6Z A;  1PV9 A;  2GG5 A;  1C27 A;  4A6V A;  4JUQ A;  2BN7 A;  1QZY A;  1YVM A;  1B6A A;  3PKE A;  1Y1N A;  2G6P A;  1O0X A;  1BN5 A;  4U69 A;  5D6F A;  1XGO A;  1B59 A;  4U75 A;  2ZSG A;  1N51 A;  1QXZ A;  4U71 A;  3TB5 A;  4PNC A;  4IKS A;  1WL6 A;  4KM3 A;  2B3L A;  2B3H A;  2IW2 A;  4IKU A;  2EVO A;  4FLK A;  2EA2 A;  4U70 A;  4IKR A;  1WBQ A;  1YW9 A;  4ZNG A;  4ZWO A;  4OOK A;  2V6C A;  2V3Z A;  1JAW A;  1WY2 A;  4RGZ 1;  2MAT A;  4IF7 A;  3MAT A;  2Q95 A;  2BHC A;  4U73 A;  1A16 A;  1R5G A;  5CNX A;  4U6E A;  2GG7 A; 
#chains in the Genus database with same CATH homology
 1W7V A;  5CE6 A;  1WN1 A;  3PKC A;  5CLS A;  4FKC A;  3Q6D A;  1M35 A;  5JFR A;  2BB7 A;  1QXY A;  1W2M A;  2HOW A;  3L7G A;  1YW7 A;  1WLR A;  2GA2 A;  4U76 A;  3D27 A;  2B3K A;  4EGE A;  1QXW A;  1C22 A;  2Q94 A;  2OAZ A;  1KQ9 A;  3CB5 A;  2GG8 A;  4S00 A;  4FO8 A;  4IDY A;  1YJ3 A;  2GU4 A;  2NQ7 A;  4PV4 A;  3FMR A;  2BWS A;  4MAT A;  2EVC A;  3S6B A;  1R5H A;  4FLI A;  4IPA A;  2V3X A;  4RZY A;  3BIT A;  4S2T P;  2OKN A;  4R60 A;  2BWT A;  4FO7 A;  2BWV A;  4U6J A;  2P98 A;  3PKA A;  2GGB A;  2BWW A;  2BWX A;  1KP0 A;  3BIP A;  5D6E A;  2GG3 A;  2BHD A;  2Q93 A;  3IU8 A;  2Q92 A;  5JHU A;  2DFI A;  3PKB A;  4ZWP A;  3RVA A;  4U6W A;  1KQ0 A;  4B28 A;  5CDE A;  2P99 A;  1XGN A;  2EA4 A;  2P9A A;  5FCF A;  2GG0 A;  2GTX A;  3MX6 A;  3IU7 A;  4FUK A;  2GGC A;  3BIQ A;  2GU5 A;  2GG9 A;  1XGM A;  3ROR A;  3L24 A;  1WKM A;  2BHB A;  4IU6 A;  3CTZ A;  4IKT A;  1C24 A;  4HXX A;  4U1B A;  4RZZ A;  3CB6 A;  5CDL A;  1CHM A;  1BOA A;  2GU7 A;  2ADU A;  3PKD A;  5FCH A;  2Q8K A;  3TAV A;  1YW8 A;  1C21 A;  2NQ6 A;  4U6C A;  2GZ5 A;  4IEC A;  4A6W A;  1R58 A;  1WL9 A;  2BWU A;  3FMQ A;  4QR8 A;  5CIK A;  5E5B A;  1MAT A;  2GU6 A;  3IG4 A;  3MR1 A;  4FLJ A;  3FM3 A;  1XGS A;  2BHA A;  2BH3 A;  2GG2 A;  4S01 A;  2Q96 A;  2V3Y A;  5JI6 A;  1XNZ A;  3IU9 A;  4ZWU A;  2EVM A;  4S2R P;  1C23 A;  2BWY A;  4FLL A;  4Z7M A;  5CDV A;  4U6Z A;  1PV9 A;  2GG5 A;  1C27 A;  4A6V A;  4JUQ A;  2BN7 A;  1QZY A;  1YVM A;  1B6A A;  3PKE A;  1Y1N A;  2G6P A;  1O0X A;  1BN5 A;  4U69 A;  5D6F A;  1XGO A;  1B59 A;  4U75 A;  2ZSG A;  1N51 A;  1QXZ A;  4U71 A;  3TB5 A;  4PNC A;  4IKS A;  1WL6 A;  4KM3 A;  2B3L A;  2B3H A;  2IW2 A;  4IKU A;  2EVO A;  4FLK A;  2EA2 A;  4U70 A;  4IKR A;  1WBQ A;  1YW9 A;  4ZNG A;  4ZWO A;  4OOK A;  2V6C A;  2V3Z A;  1JAW A;  1WY2 A;  4RGZ 1;  2MAT A;  4IF7 A;  3MAT A;  2Q95 A;  2BHC A;  4U73 A;  1A16 A;  1R5G A;  5CNX A;  4U6E A;  2GG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...