1O0XA

Crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
249
structure length
249
Chain Sequence
MIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGYGGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQIPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Crystal structure of a methionine aminopeptidase (TM1478) from Thermotoga maritima at 1.9 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 84
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1o0xA00
2Q96A 2NQ6A 2GU6A 5CDLA 3PKAA 4ZWPA 4U75A 2BWTA 3IU9A 3IU7A 4IKSA 5E5BA 1QXZA 3FMQA 2MATA 5JHUA 4S2TP 1XGOA 5FCHA 4S00A 4IKRA 2Q8KA 5CE6A 4FLLA 2GGCA 2B3KA 2EA2A 4IKTA 2P99A 4FLIA 2P9AA 3CTZA 3PKDA 1WKMA 2Q94A 1BN5A 2BWWA 2G6PA 2GG9A 1Y1NA 2NQ7A 4FO8A 1QXYA 2P98A 4U6CA 4R60A 4U1BA 1BOAA 2BWSA 1CHMA 1A16A 4FO7A 2ADUA 3IG4A 1R5HA 1YW9A 2GTXA 4HXXA 1W2MA 2Q92A 4IU6A 4U6JA 1C21A 1YVMA 4EGEA 2IW2A 4RZZA 2BN7A 3PKCA 3L7GA 2BH3A 5FCFA 2B3LA 3PKBA 3L24A 4S01A 3IU8A 4IPAA 5CDEA 2GG2A 2V3ZA 1JAWA 1O0XA 4Z7MA 2OAZA 5D6EA 1R58A 3CB6A 4IKUA 1XGMA 1C27A 5CLSA 1C23A 2GZ5A 2HOWA 3BIQA 4U76A 1C22A 5CDVA 4B28A 5JI6A 2GG7A 3Q6DA 1N51A 4MATA 4FKCA 1C24A 2Q93A 4U6EA 2GU5A 1XGNA 5JFRA 1PV9A 1WY2A 5D6FA 1B6AA 1WN1A 3MATA 2BWYA 4IECA 4PV4A 3TB5A 4IDYA 3RVAA 2GA2A 3CB5A 2GU7A 2BWVA 2GG3A 4A6WA 1WL9A 1WLRA 4FUKA 1M35A 4U71A 2BWXA 4OOKA 1B59A 1YW7A 2BWUA 3MR1A 1XGSA 3S6BA 2BB7A 1YW8A 3FM3A 4U69A 4IF7A 4ZWUA 4ZWOA 2BHBA 3BITA 4RGZ1 3MX6A 3TAVA 2EVMA 2EA4A 1MATA 3D27A 4FLKA 3BIPA 2B3HA 2V3XA 1YJ3A 1WBQA 4FLJA 4U70A 2BHDA 2Q95A 4U6WA 4ZNGA 2BHAA 1WL6A 2OKNA 4U73A 2GG8A 2GG0A 2V3YA 2EVOA 4S2RP 1QXWA 1QZYA 4U6ZA 2DFIA 4QR8A 2GGBA 4KM3A 1KP0A 4A6VA 4JUQA 4PNCA 5CNXA 3RORA 3PKEA 5CIKA 2EVCA 2V6CA 2ZSGA 1R5GA 1KQ9A 1KQ0A 1W7VA 2BHCA 2GU4A 3FMRA 4RZYA 2GG5A 1XNZA
chains in the Genus database with same CATH superfamily
2Q96A 2NQ6A 2GU6A 5CDLA 3PKAA 4ZWPA 4U75A 2BWTA 3IU9A 3IU7A 4IKSA 5E5BA 1QXZA 3FMQA 2MATA 5JHUA 4S2TP 1XGOA 5FCHA 4S00A 4IKRA 2Q8KA 5CE6A 4FLLA 2GGCA 2B3KA 2EA2A 4IKTA 2P99A 4FLIA 2P9AA 3CTZA 3PKDA 1WKMA 2Q94A 1BN5A 2BWWA 2G6PA 2GG9A 1Y1NA 2NQ7A 4FO8A 1QXYA 2P98A 4U6CA 4R60A 4U1BA 1BOAA 2BWSA 1CHMA 1A16A 4FO7A 2ADUA 3IG4A 1R5HA 1YW9A 2GTXA 4HXXA 1W2MA 2Q92A 4IU6A 4U6JA 1C21A 1YVMA 4EGEA 2IW2A 4RZZA 2BN7A 3PKCA 3L7GA 2BH3A 5FCFA 2B3LA 3PKBA 3L24A 4S01A 3IU8A 4IPAA 5CDEA 2GG2A 2V3ZA 1JAWA 1O0XA 4Z7MA 2OAZA 5D6EA 1R58A 3CB6A 4IKUA 1XGMA 1C27A 5CLSA 1C23A 2GZ5A 2HOWA 3BIQA 4U76A 1C22A 5CDVA 4B28A 5JI6A 2GG7A 3Q6DA 1N51A 4MATA 4FKCA 1C24A 2Q93A 4U6EA 2GU5A 1XGNA 5JFRA 1PV9A 1WY2A 5D6FA 1B6AA 1WN1A 3MATA 2BWYA 4IECA 4PV4A 3TB5A 4IDYA 3RVAA 2GA2A 3CB5A 2GU7A 2BWVA 2GG3A 4A6WA 1WL9A 1WLRA 4FUKA 1M35A 4U71A 2BWXA 4OOKA 1B59A 1YW7A 2BWUA 3MR1A 1XGSA 3S6BA 2BB7A 1YW8A 3FM3A 4U69A 4IF7A 4ZWUA 4ZWOA 2BHBA 3BITA 4RGZ1 3MX6A 3TAVA 2EVMA 2EA4A 1MATA 3D27A 4FLKA 3BIPA 2B3HA 2V3XA 1YJ3A 1WBQA 4FLJA 4U70A 2BHDA 2Q95A 4U6WA 4ZNGA 2BHAA 1WL6A 2OKNA 4U73A 2GG8A 2GG0A 2V3YA 2EVOA 4S2RP 1QXWA 1QZYA 4U6ZA 2DFIA 4QR8A 2GGBA 4KM3A 1KP0A 4A6VA 4JUQA 4PNCA 5CNXA 3RORA 3PKEA 5CIKA 2EVCA 2V6CA 2ZSGA 1R5GA 1KQ9A 1KQ0A 1W7VA 2BHCA 2GU4A 3FMRA 4RZYA 2GG5A 1XNZA
chains in the Genus database with same CATH topology
2Q96A 2NQ6A 2GU6A 5CDLA 3PKAA 4ZWPA 4U75A 2BWTA 3IU9A 3IU7A 4IKSA 5E5BA 1QXZA 3FMQA 2MATA 5JHUA 4S2TP 1XGOA 5FCHA 4S00A 4IKRA 2Q8KA 5CE6A 4FLLA 2GGCA 2B3KA 2EA2A 4IKTA 2P99A 4FLIA 2P9AA 3CTZA 3PKDA 1WKMA 2Q94A 1BN5A 2BWWA 2G6PA 2GG9A 1Y1NA 2NQ7A 4FO8A 1QXYA 2P98A 4U6CA 4R60A 4U1BA 1BOAA 2BWSA 1CHMA 1A16A 4FO7A 2ADUA 3IG4A 1R5HA 1YW9A 2GTXA 4HXXA 1W2MA 2Q92A 4IU6A 4U6JA 1C21A 1YVMA 4EGEA 2IW2A 4RZZA 2BN7A 3PKCA 3L7GA 2BH3A 5FCFA 2B3LA 3PKBA 3L24A 4S01A 3IU8A 4IPAA 5CDEA 2GG2A 2V3ZA 1JAWA 1O0XA 4Z7MA 2OAZA 5D6EA 1R58A 3CB6A 4IKUA 1XGMA 1C27A 5CLSA 1C23A 2GZ5A 2HOWA 3BIQA 4U76A 1C22A 5CDVA 4B28A 5JI6A 2GG7A 3Q6DA 1N51A 4MATA 4FKCA 1C24A 2Q93A 4U6EA 2GU5A 1XGNA 5JFRA 1PV9A 1WY2A 5D6FA 1B6AA 1WN1A 3MATA 2BWYA 4IECA 4PV4A 3TB5A 4IDYA 3RVAA 2GA2A 3CB5A 2GU7A 2BWVA 2GG3A 4A6WA 1WL9A 1WLRA 4FUKA 1M35A 4U71A 2BWXA 4OOKA 1B59A 1YW7A 2BWUA 3MR1A 1XGSA 3S6BA 2BB7A 1YW8A 3FM3A 4U69A 4IF7A 4ZWUA 4ZWOA 2BHBA 3BITA 4RGZ1 3MX6A 3TAVA 2EVMA 2EA4A 1MATA 3D27A 4FLKA 3BIPA 2B3HA 2V3XA 1YJ3A 1WBQA 4FLJA 4U70A 2BHDA 2Q95A 4U6WA 4ZNGA 2BHAA 1WL6A 2OKNA 4U73A 2GG8A 2GG0A 2V3YA 2EVOA 4S2RP 1QXWA 1QZYA 4U6ZA 2DFIA 4QR8A 2GGBA 4KM3A 1KP0A 4A6VA 4JUQA 4PNCA 5CNXA 3RORA 3PKEA 5CIKA 2EVCA 2V6CA 2ZSGA 1R5GA 1KQ9A 1KQ0A 1W7VA 2BHCA 2GU4A 3FMRA 4RZYA 2GG5A 1XNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q96 A;  2NQ6 A;  2GU6 A;  5CDL A;  3PKA A;  4ZWP A;  4U75 A;  2BWT A;  3IU9 A;  3IU7 A;  4IKS A;  5E5B A;  1QXZ A;  3FMQ A;  2MAT A;  5JHU A;  4S2T P;  1XGO A;  5FCH A;  4S00 A;  4IKR A;  2Q8K A;  5CE6 A;  4FLL A;  2GGC A;  2B3K A;  2EA2 A;  4IKT A;  2P99 A;  4FLI A;  2P9A A;  3CTZ A;  3PKD A;  1WKM A;  2Q94 A;  1BN5 A;  2BWW A;  2G6P A;  2GG9 A;  1Y1N A;  2NQ7 A;  4FO8 A;  1QXY A;  2P98 A;  4U6C A;  4R60 A;  4U1B A;  1BOA A;  2BWS A;  1CHM A;  1A16 A;  4FO7 A;  2ADU A;  3IG4 A;  1R5H A;  1YW9 A;  2GTX A;  4HXX A;  1W2M A;  2Q92 A;  4IU6 A;  4U6J A;  1C21 A;  1YVM A;  4EGE A;  2IW2 A;  4RZZ A;  2BN7 A;  3PKC A;  3L7G A;  2BH3 A;  5FCF A;  2B3L A;  3PKB A;  3L24 A;  4S01 A;  3IU8 A;  4IPA A;  5CDE A;  2GG2 A;  2V3Z A;  1JAW A;  1O0X A;  4Z7M A;  2OAZ A;  5D6E A;  1R58 A;  3CB6 A;  4IKU A;  1XGM A;  1C27 A;  5CLS A;  1C23 A;  2GZ5 A;  2HOW A;  3BIQ A;  4U76 A;  1C22 A;  5CDV A;  4B28 A;  5JI6 A;  2GG7 A;  3Q6D A;  1N51 A;  4MAT A;  4FKC A;  1C24 A;  2Q93 A;  4U6E A;  2GU5 A;  1XGN A;  5JFR A;  1PV9 A;  1WY2 A;  5D6F A;  1B6A A;  1WN1 A;  3MAT A;  2BWY A;  4IEC A;  4PV4 A;  3TB5 A;  4IDY A;  3RVA A;  2GA2 A;  3CB5 A;  2GU7 A;  2BWV A;  2GG3 A;  4A6W A;  1WL9 A;  1WLR A;  4FUK A;  1M35 A;  4U71 A;  2BWX A;  4OOK A;  1B59 A;  1YW7 A;  2BWU A;  3MR1 A;  1XGS A;  3S6B A;  2BB7 A;  1YW8 A;  3FM3 A;  4U69 A;  4IF7 A;  4ZWU A;  4ZWO A;  2BHB A;  3BIT A;  4RGZ 1;  3MX6 A;  3TAV A;  2EVM A;  2EA4 A;  1MAT A;  3D27 A;  4FLK A;  3BIP A;  2B3H A;  2V3X A;  1YJ3 A;  1WBQ A;  4FLJ A;  4U70 A;  2BHD A;  2Q95 A;  4U6W A;  4ZNG A;  2BHA A;  1WL6 A;  2OKN A;  4U73 A;  2GG8 A;  2GG0 A;  2V3Y A;  2EVO A;  4S2R P;  1QXW A;  1QZY A;  4U6Z A;  2DFI A;  4QR8 A;  2GGB A;  4KM3 A;  1KP0 A;  4A6V A;  4JUQ A;  4PNC A;  5CNX A;  3ROR A;  3PKE A;  5CIK A;  2EVC A;  2V6C A;  2ZSG A;  1R5G A;  1KQ9 A;  1KQ0 A;  1W7V A;  2BHC A;  2GU4 A;  3FMR A;  4RZY A;  2GG5 A;  1XNZ A; 
#chains in the Genus database with same CATH topology
 2Q96 A;  2NQ6 A;  2GU6 A;  5CDL A;  3PKA A;  4ZWP A;  4U75 A;  2BWT A;  3IU9 A;  3IU7 A;  4IKS A;  5E5B A;  1QXZ A;  3FMQ A;  2MAT A;  5JHU A;  4S2T P;  1XGO A;  5FCH A;  4S00 A;  4IKR A;  2Q8K A;  5CE6 A;  4FLL A;  2GGC A;  2B3K A;  2EA2 A;  4IKT A;  2P99 A;  4FLI A;  2P9A A;  3CTZ A;  3PKD A;  1WKM A;  2Q94 A;  1BN5 A;  2BWW A;  2G6P A;  2GG9 A;  1Y1N A;  2NQ7 A;  4FO8 A;  1QXY A;  2P98 A;  4U6C A;  4R60 A;  4U1B A;  1BOA A;  2BWS A;  1CHM A;  1A16 A;  4FO7 A;  2ADU A;  3IG4 A;  1R5H A;  1YW9 A;  2GTX A;  4HXX A;  1W2M A;  2Q92 A;  4IU6 A;  4U6J A;  1C21 A;  1YVM A;  4EGE A;  2IW2 A;  4RZZ A;  2BN7 A;  3PKC A;  3L7G A;  2BH3 A;  5FCF A;  2B3L A;  3PKB A;  3L24 A;  4S01 A;  3IU8 A;  4IPA A;  5CDE A;  2GG2 A;  2V3Z A;  1JAW A;  1O0X A;  4Z7M A;  2OAZ A;  5D6E A;  1R58 A;  3CB6 A;  4IKU A;  1XGM A;  1C27 A;  5CLS A;  1C23 A;  2GZ5 A;  2HOW A;  3BIQ A;  4U76 A;  1C22 A;  5CDV A;  4B28 A;  5JI6 A;  2GG7 A;  3Q6D A;  1N51 A;  4MAT A;  4FKC A;  1C24 A;  2Q93 A;  4U6E A;  2GU5 A;  1XGN A;  5JFR A;  1PV9 A;  1WY2 A;  5D6F A;  1B6A A;  1WN1 A;  3MAT A;  2BWY A;  4IEC A;  4PV4 A;  3TB5 A;  4IDY A;  3RVA A;  2GA2 A;  3CB5 A;  2GU7 A;  2BWV A;  2GG3 A;  4A6W A;  1WL9 A;  1WLR A;  4FUK A;  1M35 A;  4U71 A;  2BWX A;  4OOK A;  1B59 A;  1YW7 A;  2BWU A;  3MR1 A;  1XGS A;  3S6B A;  2BB7 A;  1YW8 A;  3FM3 A;  4U69 A;  4IF7 A;  4ZWU A;  4ZWO A;  2BHB A;  3BIT A;  4RGZ 1;  3MX6 A;  3TAV A;  2EVM A;  2EA4 A;  1MAT A;  3D27 A;  4FLK A;  3BIP A;  2B3H A;  2V3X A;  1YJ3 A;  1WBQ A;  4FLJ A;  4U70 A;  2BHD A;  2Q95 A;  4U6W A;  4ZNG A;  2BHA A;  1WL6 A;  2OKN A;  4U73 A;  2GG8 A;  2GG0 A;  2V3Y A;  2EVO A;  4S2R P;  1QXW A;  1QZY A;  4U6Z A;  2DFI A;  4QR8 A;  2GGB A;  4KM3 A;  1KP0 A;  4A6V A;  4JUQ A;  4PNC A;  5CNX A;  3ROR A;  3PKE A;  5CIK A;  2EVC A;  2V6C A;  2ZSG A;  1R5G A;  1KQ9 A;  1KQ0 A;  1W7V A;  2BHC A;  2GU4 A;  3FMR A;  4RZY A;  2GG5 A;  1XNZ A; 
#chains in the Genus database with same CATH homology
 2Q96 A;  2NQ6 A;  2GU6 A;  5CDL A;  3PKA A;  4ZWP A;  4U75 A;  2BWT A;  3IU9 A;  3IU7 A;  4IKS A;  5E5B A;  1QXZ A;  3FMQ A;  2MAT A;  5JHU A;  4S2T P;  1XGO A;  5FCH A;  4S00 A;  4IKR A;  2Q8K A;  5CE6 A;  4FLL A;  2GGC A;  2B3K A;  2EA2 A;  4IKT A;  2P99 A;  4FLI A;  2P9A A;  3CTZ A;  3PKD A;  1WKM A;  2Q94 A;  1BN5 A;  2BWW A;  2G6P A;  2GG9 A;  1Y1N A;  2NQ7 A;  4FO8 A;  1QXY A;  2P98 A;  4U6C A;  4R60 A;  4U1B A;  1BOA A;  2BWS A;  1CHM A;  1A16 A;  4FO7 A;  2ADU A;  3IG4 A;  1R5H A;  1YW9 A;  2GTX A;  4HXX A;  1W2M A;  2Q92 A;  4IU6 A;  4U6J A;  1C21 A;  1YVM A;  4EGE A;  2IW2 A;  4RZZ A;  2BN7 A;  3PKC A;  3L7G A;  2BH3 A;  5FCF A;  2B3L A;  3PKB A;  3L24 A;  4S01 A;  3IU8 A;  4IPA A;  5CDE A;  2GG2 A;  2V3Z A;  1JAW A;  1O0X A;  4Z7M A;  2OAZ A;  5D6E A;  1R58 A;  3CB6 A;  4IKU A;  1XGM A;  1C27 A;  5CLS A;  1C23 A;  2GZ5 A;  2HOW A;  3BIQ A;  4U76 A;  1C22 A;  5CDV A;  4B28 A;  5JI6 A;  2GG7 A;  3Q6D A;  1N51 A;  4MAT A;  4FKC A;  1C24 A;  2Q93 A;  4U6E A;  2GU5 A;  1XGN A;  5JFR A;  1PV9 A;  1WY2 A;  5D6F A;  1B6A A;  1WN1 A;  3MAT A;  2BWY A;  4IEC A;  4PV4 A;  3TB5 A;  4IDY A;  3RVA A;  2GA2 A;  3CB5 A;  2GU7 A;  2BWV A;  2GG3 A;  4A6W A;  1WL9 A;  1WLR A;  4FUK A;  1M35 A;  4U71 A;  2BWX A;  4OOK A;  1B59 A;  1YW7 A;  2BWU A;  3MR1 A;  1XGS A;  3S6B A;  2BB7 A;  1YW8 A;  3FM3 A;  4U69 A;  4IF7 A;  4ZWU A;  4ZWO A;  2BHB A;  3BIT A;  4RGZ 1;  3MX6 A;  3TAV A;  2EVM A;  2EA4 A;  1MAT A;  3D27 A;  4FLK A;  3BIP A;  2B3H A;  2V3X A;  1YJ3 A;  1WBQ A;  4FLJ A;  4U70 A;  2BHD A;  2Q95 A;  4U6W A;  4ZNG A;  2BHA A;  1WL6 A;  2OKN A;  4U73 A;  2GG8 A;  2GG0 A;  2V3Y A;  2EVO A;  4S2R P;  1QXW A;  1QZY A;  4U6Z A;  2DFI A;  4QR8 A;  2GGB A;  4KM3 A;  1KP0 A;  4A6V A;  4JUQ A;  4PNC A;  5CNX A;  3ROR A;  3PKE A;  5CIK A;  2EVC A;  2V6C A;  2ZSG A;  1R5G A;  1KQ9 A;  1KQ0 A;  1W7V A;  2BHC A;  2GU4 A;  3FMR A;  4RZY A;  2GG5 A;  1XNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...