4IKSA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(6-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iksA00
5CLSA 3IU8A 2OAZA 2G6PA 2BHCA 2GA2A 4IF7A 4ZWUA 1B6AA 2B3LA 4FLKA 2P98A 2GG3A 3MR1A 2DFIA 4FLIA 4FLJA 4RZZA 3FMRA 2GG0A 4S2TP 1YW8A 4IKTA 3TB5A 2BWTA 1QXZA 4PNCA 1R5HA 4OOKA 2V6CA 2B3KA 5CDEA 1QZYA 2NQ7A 2EVOA 5CE6A 1MATA 2V3YA 2V3ZA 4QR8A 1CHMA 1QXYA 3IU7A 2GU6A 3L7GA 4B28A 1WKMA 2GU7A 1WY2A 1B59A 4EGEA 2BWXA 4U69A 2BWVA 3RVAA 1XGNA 4S01A 1C22A 2EA2A 3BITA 5JHUA 2ADUA 1BOAA 2EVMA 3D27A 4ZWPA 1M35A 2BWSA 4IKSA 1R5GA 2GG7A 3PKCA 5CDLA 1WN1A 5FCHA 4IDYA 1BN5A 2Q8KA 4FO8A 1N51A 4U1BA 3PKAA 1KQ9A 2EA4A 2GG9A 2IW2A 3FMQA 1XGOA 2GG5A 5FCFA 2BN7A 4ZNGA 4S2RP 1W2MA 2HOWA 3BIQA 4Z7MA 4U75A 1KP0A 3IG4A 2BB7A 2BWWA 1WBQA 5CNXA 3FM3A 3RORA 5D6FA 1C27A 4A6WA 2GG2A 1KQ0A 1YW9A 4IPAA 4KM3A 4PV4A 1WLRA 5D6EA 4IECA 3L24A 4U6ZA 1R58A 2OKNA 2Q93A 2P9AA 1W7VA 3IU9A 1JAWA 2BHAA 3Q6DA 1QXWA 4A6VA 2ZSGA 3PKEA 1XGMA 2Q94A 2V3XA 3PKBA 4FO7A 2EVCA 4RZYA 4U73A 4U6JA 3TAVA 5E5BA 2GG8A 2GU5A 4U6WA 2Q96A 2BHDA 1WL6A 1YW7A 4MATA 4RGZ1 2P99A 5CIKA 3CTZA 3BIPA 1YVMA 4S00A 2GGCA 2MATA 4FUKA 5CDVA 4R60A 4JUQA 1XGSA 3CB6A 3MATA 2Q95A 1PV9A 4U76A 2GGBA 1A16A 1WL9A 5JFRA 4U6CA 1C21A 2GU4A 3S6BA 4HXXA 4U71A 1O0XA 3MX6A 2GTXA 1YJ3A 2GZ5A 4IU6A 4ZWOA 5JI6A 2NQ6A 4FKCA 4FLLA 2BHBA 1C24A 2BH3A 2BWUA 4IKRA 2Q92A 4U6EA 3PKDA 4U70A 2BWYA 1Y1NA 1C23A 2B3HA 3CB5A 1XNZA 4IKUA
chains in the Genus database with same CATH superfamily
5CLSA 3IU8A 2OAZA 2G6PA 2BHCA 2GA2A 4IF7A 4ZWUA 1B6AA 2B3LA 4FLKA 2P98A 2GG3A 3MR1A 2DFIA 4FLIA 4FLJA 4RZZA 3FMRA 2GG0A 4S2TP 1YW8A 4IKTA 3TB5A 2BWTA 1QXZA 4PNCA 1R5HA 4OOKA 2V6CA 2B3KA 5CDEA 1QZYA 2NQ7A 2EVOA 5CE6A 1MATA 2V3YA 2V3ZA 4QR8A 1CHMA 1QXYA 3IU7A 2GU6A 3L7GA 4B28A 1WKMA 2GU7A 1WY2A 1B59A 4EGEA 2BWXA 4U69A 2BWVA 3RVAA 1XGNA 4S01A 1C22A 2EA2A 3BITA 5JHUA 2ADUA 1BOAA 2EVMA 3D27A 4ZWPA 1M35A 2BWSA 4IKSA 1R5GA 2GG7A 3PKCA 5CDLA 1WN1A 5FCHA 4IDYA 1BN5A 2Q8KA 4FO8A 1N51A 4U1BA 3PKAA 1KQ9A 2EA4A 2GG9A 2IW2A 3FMQA 1XGOA 2GG5A 5FCFA 2BN7A 4ZNGA 4S2RP 1W2MA 2HOWA 3BIQA 4Z7MA 4U75A 1KP0A 3IG4A 2BB7A 2BWWA 1WBQA 5CNXA 3FM3A 3RORA 5D6FA 1C27A 4A6WA 2GG2A 1KQ0A 1YW9A 4IPAA 4KM3A 4PV4A 1WLRA 5D6EA 4IECA 3L24A 4U6ZA 1R58A 2OKNA 2Q93A 2P9AA 1W7VA 3IU9A 1JAWA 2BHAA 3Q6DA 1QXWA 4A6VA 2ZSGA 3PKEA 1XGMA 2Q94A 2V3XA 3PKBA 4FO7A 2EVCA 4RZYA 4U73A 4U6JA 3TAVA 5E5BA 2GG8A 2GU5A 4U6WA 2Q96A 2BHDA 1WL6A 1YW7A 4MATA 4RGZ1 2P99A 5CIKA 3CTZA 3BIPA 1YVMA 4S00A 2GGCA 2MATA 4FUKA 5CDVA 4R60A 4JUQA 1XGSA 3CB6A 3MATA 2Q95A 1PV9A 4U76A 2GGBA 1A16A 1WL9A 5JFRA 4U6CA 1C21A 2GU4A 3S6BA 4HXXA 4U71A 1O0XA 3MX6A 2GTXA 1YJ3A 2GZ5A 4IU6A 4ZWOA 5JI6A 2NQ6A 4FKCA 4FLLA 2BHBA 1C24A 2BH3A 2BWUA 4IKRA 2Q92A 4U6EA 3PKDA 4U70A 2BWYA 1Y1NA 1C23A 2B3HA 3CB5A 1XNZA 4IKUA
chains in the Genus database with same CATH topology
5CLSA 3IU8A 2OAZA 2G6PA 2BHCA 2GA2A 4IF7A 4ZWUA 1B6AA 2B3LA 4FLKA 2P98A 2GG3A 3MR1A 2DFIA 4FLIA 4FLJA 4RZZA 3FMRA 2GG0A 4S2TP 1YW8A 4IKTA 3TB5A 2BWTA 1QXZA 4PNCA 1R5HA 4OOKA 2V6CA 2B3KA 5CDEA 1QZYA 2NQ7A 2EVOA 5CE6A 1MATA 2V3YA 2V3ZA 4QR8A 1CHMA 1QXYA 3IU7A 2GU6A 3L7GA 4B28A 1WKMA 2GU7A 1WY2A 1B59A 4EGEA 2BWXA 4U69A 2BWVA 3RVAA 1XGNA 4S01A 1C22A 2EA2A 3BITA 5JHUA 2ADUA 1BOAA 2EVMA 3D27A 4ZWPA 1M35A 2BWSA 4IKSA 1R5GA 2GG7A 3PKCA 5CDLA 1WN1A 5FCHA 4IDYA 1BN5A 2Q8KA 4FO8A 1N51A 4U1BA 3PKAA 1KQ9A 2EA4A 2GG9A 2IW2A 3FMQA 1XGOA 2GG5A 5FCFA 2BN7A 4ZNGA 4S2RP 1W2MA 2HOWA 3BIQA 4Z7MA 4U75A 1KP0A 3IG4A 2BB7A 2BWWA 1WBQA 5CNXA 3FM3A 3RORA 5D6FA 1C27A 4A6WA 2GG2A 1KQ0A 1YW9A 4IPAA 4KM3A 4PV4A 1WLRA 5D6EA 4IECA 3L24A 4U6ZA 1R58A 2OKNA 2Q93A 2P9AA 1W7VA 3IU9A 1JAWA 2BHAA 3Q6DA 1QXWA 4A6VA 2ZSGA 3PKEA 1XGMA 2Q94A 2V3XA 3PKBA 4FO7A 2EVCA 4RZYA 4U73A 4U6JA 3TAVA 5E5BA 2GG8A 2GU5A 4U6WA 2Q96A 2BHDA 1WL6A 1YW7A 4MATA 4RGZ1 2P99A 5CIKA 3CTZA 3BIPA 1YVMA 4S00A 2GGCA 2MATA 4FUKA 5CDVA 4R60A 4JUQA 1XGSA 3CB6A 3MATA 2Q95A 1PV9A 4U76A 2GGBA 1A16A 1WL9A 5JFRA 4U6CA 1C21A 2GU4A 3S6BA 4HXXA 4U71A 1O0XA 3MX6A 2GTXA 1YJ3A 2GZ5A 4IU6A 4ZWOA 5JI6A 2NQ6A 4FKCA 4FLLA 2BHBA 1C24A 2BH3A 2BWUA 4IKRA 2Q92A 4U6EA 3PKDA 4U70A 2BWYA 1Y1NA 1C23A 2B3HA 3CB5A 1XNZA 4IKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLS A;  3IU8 A;  2OAZ A;  2G6P A;  2BHC A;  2GA2 A;  4IF7 A;  4ZWU A;  1B6A A;  2B3L A;  4FLK A;  2P98 A;  2GG3 A;  3MR1 A;  2DFI A;  4FLI A;  4FLJ A;  4RZZ A;  3FMR A;  2GG0 A;  4S2T P;  1YW8 A;  4IKT A;  3TB5 A;  2BWT A;  1QXZ A;  4PNC A;  1R5H A;  4OOK A;  2V6C A;  2B3K A;  5CDE A;  1QZY A;  2NQ7 A;  2EVO A;  5CE6 A;  1MAT A;  2V3Y A;  2V3Z A;  4QR8 A;  1CHM A;  1QXY A;  3IU7 A;  2GU6 A;  3L7G A;  4B28 A;  1WKM A;  2GU7 A;  1WY2 A;  1B59 A;  4EGE A;  2BWX A;  4U69 A;  2BWV A;  3RVA A;  1XGN A;  4S01 A;  1C22 A;  2EA2 A;  3BIT A;  5JHU A;  2ADU A;  1BOA A;  2EVM A;  3D27 A;  4ZWP A;  1M35 A;  2BWS A;  4IKS A;  1R5G A;  2GG7 A;  3PKC A;  5CDL A;  1WN1 A;  5FCH A;  4IDY A;  1BN5 A;  2Q8K A;  4FO8 A;  1N51 A;  4U1B A;  3PKA A;  1KQ9 A;  2EA4 A;  2GG9 A;  2IW2 A;  3FMQ A;  1XGO A;  2GG5 A;  5FCF A;  2BN7 A;  4ZNG A;  4S2R P;  1W2M A;  2HOW A;  3BIQ A;  4Z7M A;  4U75 A;  1KP0 A;  3IG4 A;  2BB7 A;  2BWW A;  1WBQ A;  5CNX A;  3FM3 A;  3ROR A;  5D6F A;  1C27 A;  4A6W A;  2GG2 A;  1KQ0 A;  1YW9 A;  4IPA A;  4KM3 A;  4PV4 A;  1WLR A;  5D6E A;  4IEC A;  3L24 A;  4U6Z A;  1R58 A;  2OKN A;  2Q93 A;  2P9A A;  1W7V A;  3IU9 A;  1JAW A;  2BHA A;  3Q6D A;  1QXW A;  4A6V A;  2ZSG A;  3PKE A;  1XGM A;  2Q94 A;  2V3X A;  3PKB A;  4FO7 A;  2EVC A;  4RZY A;  4U73 A;  4U6J A;  3TAV A;  5E5B A;  2GG8 A;  2GU5 A;  4U6W A;  2Q96 A;  2BHD A;  1WL6 A;  1YW7 A;  4MAT A;  4RGZ 1;  2P99 A;  5CIK A;  3CTZ A;  3BIP A;  1YVM A;  4S00 A;  2GGC A;  2MAT A;  4FUK A;  5CDV A;  4R60 A;  4JUQ A;  1XGS A;  3CB6 A;  3MAT A;  2Q95 A;  1PV9 A;  4U76 A;  2GGB A;  1A16 A;  1WL9 A;  5JFR A;  4U6C A;  1C21 A;  2GU4 A;  3S6B A;  4HXX A;  4U71 A;  1O0X A;  3MX6 A;  2GTX A;  1YJ3 A;  2GZ5 A;  4IU6 A;  4ZWO A;  5JI6 A;  2NQ6 A;  4FKC A;  4FLL A;  2BHB A;  1C24 A;  2BH3 A;  2BWU A;  4IKR A;  2Q92 A;  4U6E A;  3PKD A;  4U70 A;  2BWY A;  1Y1N A;  1C23 A;  2B3H A;  3CB5 A;  1XNZ A;  4IKU A; 
#chains in the Genus database with same CATH topology
 5CLS A;  3IU8 A;  2OAZ A;  2G6P A;  2BHC A;  2GA2 A;  4IF7 A;  4ZWU A;  1B6A A;  2B3L A;  4FLK A;  2P98 A;  2GG3 A;  3MR1 A;  2DFI A;  4FLI A;  4FLJ A;  4RZZ A;  3FMR A;  2GG0 A;  4S2T P;  1YW8 A;  4IKT A;  3TB5 A;  2BWT A;  1QXZ A;  4PNC A;  1R5H A;  4OOK A;  2V6C A;  2B3K A;  5CDE A;  1QZY A;  2NQ7 A;  2EVO A;  5CE6 A;  1MAT A;  2V3Y A;  2V3Z A;  4QR8 A;  1CHM A;  1QXY A;  3IU7 A;  2GU6 A;  3L7G A;  4B28 A;  1WKM A;  2GU7 A;  1WY2 A;  1B59 A;  4EGE A;  2BWX A;  4U69 A;  2BWV A;  3RVA A;  1XGN A;  4S01 A;  1C22 A;  2EA2 A;  3BIT A;  5JHU A;  2ADU A;  1BOA A;  2EVM A;  3D27 A;  4ZWP A;  1M35 A;  2BWS A;  4IKS A;  1R5G A;  2GG7 A;  3PKC A;  5CDL A;  1WN1 A;  5FCH A;  4IDY A;  1BN5 A;  2Q8K A;  4FO8 A;  1N51 A;  4U1B A;  3PKA A;  1KQ9 A;  2EA4 A;  2GG9 A;  2IW2 A;  3FMQ A;  1XGO A;  2GG5 A;  5FCF A;  2BN7 A;  4ZNG A;  4S2R P;  1W2M A;  2HOW A;  3BIQ A;  4Z7M A;  4U75 A;  1KP0 A;  3IG4 A;  2BB7 A;  2BWW A;  1WBQ A;  5CNX A;  3FM3 A;  3ROR A;  5D6F A;  1C27 A;  4A6W A;  2GG2 A;  1KQ0 A;  1YW9 A;  4IPA A;  4KM3 A;  4PV4 A;  1WLR A;  5D6E A;  4IEC A;  3L24 A;  4U6Z A;  1R58 A;  2OKN A;  2Q93 A;  2P9A A;  1W7V A;  3IU9 A;  1JAW A;  2BHA A;  3Q6D A;  1QXW A;  4A6V A;  2ZSG A;  3PKE A;  1XGM A;  2Q94 A;  2V3X A;  3PKB A;  4FO7 A;  2EVC A;  4RZY A;  4U73 A;  4U6J A;  3TAV A;  5E5B A;  2GG8 A;  2GU5 A;  4U6W A;  2Q96 A;  2BHD A;  1WL6 A;  1YW7 A;  4MAT A;  4RGZ 1;  2P99 A;  5CIK A;  3CTZ A;  3BIP A;  1YVM A;  4S00 A;  2GGC A;  2MAT A;  4FUK A;  5CDV A;  4R60 A;  4JUQ A;  1XGS A;  3CB6 A;  3MAT A;  2Q95 A;  1PV9 A;  4U76 A;  2GGB A;  1A16 A;  1WL9 A;  5JFR A;  4U6C A;  1C21 A;  2GU4 A;  3S6B A;  4HXX A;  4U71 A;  1O0X A;  3MX6 A;  2GTX A;  1YJ3 A;  2GZ5 A;  4IU6 A;  4ZWO A;  5JI6 A;  2NQ6 A;  4FKC A;  4FLL A;  2BHB A;  1C24 A;  2BH3 A;  2BWU A;  4IKR A;  2Q92 A;  4U6E A;  3PKD A;  4U70 A;  2BWY A;  1Y1N A;  1C23 A;  2B3H A;  3CB5 A;  1XNZ A;  4IKU A; 
#chains in the Genus database with same CATH homology
 5CLS A;  3IU8 A;  2OAZ A;  2G6P A;  2BHC A;  2GA2 A;  4IF7 A;  4ZWU A;  1B6A A;  2B3L A;  4FLK A;  2P98 A;  2GG3 A;  3MR1 A;  2DFI A;  4FLI A;  4FLJ A;  4RZZ A;  3FMR A;  2GG0 A;  4S2T P;  1YW8 A;  4IKT A;  3TB5 A;  2BWT A;  1QXZ A;  4PNC A;  1R5H A;  4OOK A;  2V6C A;  2B3K A;  5CDE A;  1QZY A;  2NQ7 A;  2EVO A;  5CE6 A;  1MAT A;  2V3Y A;  2V3Z A;  4QR8 A;  1CHM A;  1QXY A;  3IU7 A;  2GU6 A;  3L7G A;  4B28 A;  1WKM A;  2GU7 A;  1WY2 A;  1B59 A;  4EGE A;  2BWX A;  4U69 A;  2BWV A;  3RVA A;  1XGN A;  4S01 A;  1C22 A;  2EA2 A;  3BIT A;  5JHU A;  2ADU A;  1BOA A;  2EVM A;  3D27 A;  4ZWP A;  1M35 A;  2BWS A;  4IKS A;  1R5G A;  2GG7 A;  3PKC A;  5CDL A;  1WN1 A;  5FCH A;  4IDY A;  1BN5 A;  2Q8K A;  4FO8 A;  1N51 A;  4U1B A;  3PKA A;  1KQ9 A;  2EA4 A;  2GG9 A;  2IW2 A;  3FMQ A;  1XGO A;  2GG5 A;  5FCF A;  2BN7 A;  4ZNG A;  4S2R P;  1W2M A;  2HOW A;  3BIQ A;  4Z7M A;  4U75 A;  1KP0 A;  3IG4 A;  2BB7 A;  2BWW A;  1WBQ A;  5CNX A;  3FM3 A;  3ROR A;  5D6F A;  1C27 A;  4A6W A;  2GG2 A;  1KQ0 A;  1YW9 A;  4IPA A;  4KM3 A;  4PV4 A;  1WLR A;  5D6E A;  4IEC A;  3L24 A;  4U6Z A;  1R58 A;  2OKN A;  2Q93 A;  2P9A A;  1W7V A;  3IU9 A;  1JAW A;  2BHA A;  3Q6D A;  1QXW A;  4A6V A;  2ZSG A;  3PKE A;  1XGM A;  2Q94 A;  2V3X A;  3PKB A;  4FO7 A;  2EVC A;  4RZY A;  4U73 A;  4U6J A;  3TAV A;  5E5B A;  2GG8 A;  2GU5 A;  4U6W A;  2Q96 A;  2BHD A;  1WL6 A;  1YW7 A;  4MAT A;  4RGZ 1;  2P99 A;  5CIK A;  3CTZ A;  3BIP A;  1YVM A;  4S00 A;  2GGC A;  2MAT A;  4FUK A;  5CDV A;  4R60 A;  4JUQ A;  1XGS A;  3CB6 A;  3MAT A;  2Q95 A;  1PV9 A;  4U76 A;  2GGB A;  1A16 A;  1WL9 A;  5JFR A;  4U6C A;  1C21 A;  2GU4 A;  3S6B A;  4HXX A;  4U71 A;  1O0X A;  3MX6 A;  2GTX A;  1YJ3 A;  2GZ5 A;  4IU6 A;  4ZWO A;  5JI6 A;  2NQ6 A;  4FKC A;  4FLL A;  2BHB A;  1C24 A;  2BH3 A;  2BWU A;  4IKR A;  2Q92 A;  4U6E A;  3PKD A;  4U70 A;  2BWY A;  1Y1N A;  1C23 A;  2B3H A;  3CB5 A;  1XNZ A;  4IKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...