4IKSA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(6-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iksA00
5D6FA 2Q93A 2V3YA 2BB7A 4FKCA 1XGSA 2GU6A 1YW9A 2B3HA 3FMRA 3IU8A 1YW8A 3CTZA 5CDEA 4ZWPA 2BWTA 4IF7A 4FLJA 1C21A 3IG4A 2IW2A 2P99A 3BITA 4Z7MA 2BWVA 3BIPA 4HXXA 2ZSGA 1WY2A 4FO7A 2P9AA 4R60A 2OKNA 4QR8A 2GG7A 1O0XA 2BHAA 2BHCA 5JFRA 1YVMA 2GU4A 3Q6DA 2DFIA 4A6VA 5CDVA 1N51A 2EVOA 1R5HA 4IECA 2BH3A 3MX6A 4IKTA 1KP0A 4U6WA 4EGEA 2EA4A 4S2RP 4JUQA 1QXYA 3PKDA 1BOAA 2BWXA 4U70A 1PV9A 4U1BA 1W2MA 4RGZ1 2GG8A 2GGCA 3L7GA 2G6PA 4IKUA 2HOWA 1QXWA 4FUKA 2V3ZA 4IDYA 2BWWA 4U75A 3MATA 2Q8KA 3IU7A 1M35A 4U71A 1KQ9A 1XNZA 2GU7A 2Q95A 3CB5A 1XGMA 1B6AA 1JAWA 2BN7A 2Q94A 2OAZA 4MATA 4B28A 4U76A 2Q92A 5JHUA 4IPAA 5CLSA 4IKRA 3S6BA 2BHBA 1Y1NA 4IKSA 1C24A 5CDLA 5D6EA 2GG5A 1CHMA 2B3LA 4ZWOA 1YJ3A 1WL9A 2GG3A 2GG2A 3BIQA 4U69A 4PV4A 1YW7A 4PNCA 4S01A 4FLKA 1WBQA 4ZNGA 4U73A 1A16A 2BHDA 2MATA 4RZYA 2BWYA 2GG9A 2GA2A 1QZYA 4U6ZA 3PKEA 3RVAA 2EVMA 1C23A 2V3XA 3D27A 3L24A 4FO8A 2EVCA 2ADUA 4U6JA 2GU5A 2GGBA 4S2TP 1R5GA 1C22A 4IU6A 2BWSA 4A6WA 2Q96A 1W7VA 5FCHA 4FLLA 2GG0A 5E5BA 3CB6A 3PKBA 2GZ5A 1QXZA 1B59A 2NQ6A 1KQ0A 4U6CA 4S00A 5CIKA 5CE6A 2V6CA 3FM3A 4FLIA 2BWUA 4RZZA 1MATA 4KM3A 3TB5A 1R58A 3PKCA 2EA2A 5FCFA 4U6EA 1XGNA 1WN1A 3MR1A 2NQ7A 1XGOA 2GTXA 3FMQA 2P98A 5CNXA 1WL6A 1WLRA 5JI6A 1C27A 3RORA 2B3KA 3PKAA 3IU9A 1WKMA 4ZWUA 3TAVA 1BN5A 4OOKA
chains in the Genus database with same CATH superfamily
5D6FA 2Q93A 2V3YA 2BB7A 4FKCA 1XGSA 2GU6A 1YW9A 2B3HA 3FMRA 3IU8A 1YW8A 3CTZA 5CDEA 4ZWPA 2BWTA 4IF7A 4FLJA 1C21A 3IG4A 2IW2A 2P99A 3BITA 4Z7MA 2BWVA 3BIPA 4HXXA 2ZSGA 1WY2A 4FO7A 2P9AA 4R60A 2OKNA 4QR8A 2GG7A 1O0XA 2BHAA 2BHCA 5JFRA 1YVMA 2GU4A 3Q6DA 2DFIA 4A6VA 5CDVA 1N51A 2EVOA 1R5HA 4IECA 2BH3A 3MX6A 4IKTA 1KP0A 4U6WA 4EGEA 2EA4A 4S2RP 4JUQA 1QXYA 3PKDA 1BOAA 2BWXA 4U70A 1PV9A 4U1BA 1W2MA 4RGZ1 2GG8A 2GGCA 3L7GA 2G6PA 4IKUA 2HOWA 1QXWA 4FUKA 2V3ZA 4IDYA 2BWWA 4U75A 3MATA 2Q8KA 3IU7A 1M35A 4U71A 1KQ9A 1XNZA 2GU7A 2Q95A 3CB5A 1XGMA 1B6AA 1JAWA 2BN7A 2Q94A 2OAZA 4MATA 4B28A 4U76A 2Q92A 5JHUA 4IPAA 5CLSA 4IKRA 3S6BA 2BHBA 1Y1NA 4IKSA 1C24A 5CDLA 5D6EA 2GG5A 1CHMA 2B3LA 4ZWOA 1YJ3A 1WL9A 2GG3A 2GG2A 3BIQA 4U69A 4PV4A 1YW7A 4PNCA 4S01A 4FLKA 1WBQA 4ZNGA 4U73A 1A16A 2BHDA 2MATA 4RZYA 2BWYA 2GG9A 2GA2A 1QZYA 4U6ZA 3PKEA 3RVAA 2EVMA 1C23A 2V3XA 3D27A 3L24A 4FO8A 2EVCA 2ADUA 4U6JA 2GU5A 2GGBA 4S2TP 1R5GA 1C22A 4IU6A 2BWSA 4A6WA 2Q96A 1W7VA 5FCHA 4FLLA 2GG0A 5E5BA 3CB6A 3PKBA 2GZ5A 1QXZA 1B59A 2NQ6A 1KQ0A 4U6CA 4S00A 5CIKA 5CE6A 2V6CA 3FM3A 4FLIA 2BWUA 4RZZA 1MATA 4KM3A 3TB5A 1R58A 3PKCA 2EA2A 5FCFA 4U6EA 1XGNA 1WN1A 3MR1A 2NQ7A 1XGOA 2GTXA 3FMQA 2P98A 5CNXA 1WL6A 1WLRA 5JI6A 1C27A 3RORA 2B3KA 3PKAA 3IU9A 1WKMA 4ZWUA 3TAVA 1BN5A 4OOKA
chains in the Genus database with same CATH topology
5D6FA 2Q93A 2V3YA 2BB7A 4FKCA 1XGSA 2GU6A 1YW9A 2B3HA 3FMRA 3IU8A 1YW8A 3CTZA 5CDEA 4ZWPA 2BWTA 4IF7A 4FLJA 1C21A 3IG4A 2IW2A 2P99A 3BITA 4Z7MA 2BWVA 3BIPA 4HXXA 2ZSGA 1WY2A 4FO7A 2P9AA 4R60A 2OKNA 4QR8A 2GG7A 1O0XA 2BHAA 2BHCA 5JFRA 1YVMA 2GU4A 3Q6DA 2DFIA 4A6VA 5CDVA 1N51A 2EVOA 1R5HA 4IECA 2BH3A 3MX6A 4IKTA 1KP0A 4U6WA 4EGEA 2EA4A 4S2RP 4JUQA 1QXYA 3PKDA 1BOAA 2BWXA 4U70A 1PV9A 4U1BA 1W2MA 4RGZ1 2GG8A 2GGCA 3L7GA 2G6PA 4IKUA 2HOWA 1QXWA 4FUKA 2V3ZA 4IDYA 2BWWA 4U75A 3MATA 2Q8KA 3IU7A 1M35A 4U71A 1KQ9A 1XNZA 2GU7A 2Q95A 3CB5A 1XGMA 1B6AA 1JAWA 2BN7A 2Q94A 2OAZA 4MATA 4B28A 4U76A 2Q92A 5JHUA 4IPAA 5CLSA 4IKRA 3S6BA 2BHBA 1Y1NA 4IKSA 1C24A 5CDLA 5D6EA 2GG5A 1CHMA 2B3LA 4ZWOA 1YJ3A 1WL9A 2GG3A 2GG2A 3BIQA 4U69A 4PV4A 1YW7A 4PNCA 4S01A 4FLKA 1WBQA 4ZNGA 4U73A 1A16A 2BHDA 2MATA 4RZYA 2BWYA 2GG9A 2GA2A 1QZYA 4U6ZA 3PKEA 3RVAA 2EVMA 1C23A 2V3XA 3D27A 3L24A 4FO8A 2EVCA 2ADUA 4U6JA 2GU5A 2GGBA 4S2TP 1R5GA 1C22A 4IU6A 2BWSA 4A6WA 2Q96A 1W7VA 5FCHA 4FLLA 2GG0A 5E5BA 3CB6A 3PKBA 2GZ5A 1QXZA 1B59A 2NQ6A 1KQ0A 4U6CA 4S00A 5CIKA 5CE6A 2V6CA 3FM3A 4FLIA 2BWUA 4RZZA 1MATA 4KM3A 3TB5A 1R58A 3PKCA 2EA2A 5FCFA 4U6EA 1XGNA 1WN1A 3MR1A 2NQ7A 1XGOA 2GTXA 3FMQA 2P98A 5CNXA 1WL6A 1WLRA 5JI6A 1C27A 3RORA 2B3KA 3PKAA 3IU9A 1WKMA 4ZWUA 3TAVA 1BN5A 4OOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6F A;  2Q93 A;  2V3Y A;  2BB7 A;  4FKC A;  1XGS A;  2GU6 A;  1YW9 A;  2B3H A;  3FMR A;  3IU8 A;  1YW8 A;  3CTZ A;  5CDE A;  4ZWP A;  2BWT A;  4IF7 A;  4FLJ A;  1C21 A;  3IG4 A;  2IW2 A;  2P99 A;  3BIT A;  4Z7M A;  2BWV A;  3BIP A;  4HXX A;  2ZSG A;  1WY2 A;  4FO7 A;  2P9A A;  4R60 A;  2OKN A;  4QR8 A;  2GG7 A;  1O0X A;  2BHA A;  2BHC A;  5JFR A;  1YVM A;  2GU4 A;  3Q6D A;  2DFI A;  4A6V A;  5CDV A;  1N51 A;  2EVO A;  1R5H A;  4IEC A;  2BH3 A;  3MX6 A;  4IKT A;  1KP0 A;  4U6W A;  4EGE A;  2EA4 A;  4S2R P;  4JUQ A;  1QXY A;  3PKD A;  1BOA A;  2BWX A;  4U70 A;  1PV9 A;  4U1B A;  1W2M A;  4RGZ 1;  2GG8 A;  2GGC A;  3L7G A;  2G6P A;  4IKU A;  2HOW A;  1QXW A;  4FUK A;  2V3Z A;  4IDY A;  2BWW A;  4U75 A;  3MAT A;  2Q8K A;  3IU7 A;  1M35 A;  4U71 A;  1KQ9 A;  1XNZ A;  2GU7 A;  2Q95 A;  3CB5 A;  1XGM A;  1B6A A;  1JAW A;  2BN7 A;  2Q94 A;  2OAZ A;  4MAT A;  4B28 A;  4U76 A;  2Q92 A;  5JHU A;  4IPA A;  5CLS A;  4IKR A;  3S6B A;  2BHB A;  1Y1N A;  4IKS A;  1C24 A;  5CDL A;  5D6E A;  2GG5 A;  1CHM A;  2B3L A;  4ZWO A;  1YJ3 A;  1WL9 A;  2GG3 A;  2GG2 A;  3BIQ A;  4U69 A;  4PV4 A;  1YW7 A;  4PNC A;  4S01 A;  4FLK A;  1WBQ A;  4ZNG A;  4U73 A;  1A16 A;  2BHD A;  2MAT A;  4RZY A;  2BWY A;  2GG9 A;  2GA2 A;  1QZY A;  4U6Z A;  3PKE A;  3RVA A;  2EVM A;  1C23 A;  2V3X A;  3D27 A;  3L24 A;  4FO8 A;  2EVC A;  2ADU A;  4U6J A;  2GU5 A;  2GGB A;  4S2T P;  1R5G A;  1C22 A;  4IU6 A;  2BWS A;  4A6W A;  2Q96 A;  1W7V A;  5FCH A;  4FLL A;  2GG0 A;  5E5B A;  3CB6 A;  3PKB A;  2GZ5 A;  1QXZ A;  1B59 A;  2NQ6 A;  1KQ0 A;  4U6C A;  4S00 A;  5CIK A;  5CE6 A;  2V6C A;  3FM3 A;  4FLI A;  2BWU A;  4RZZ A;  1MAT A;  4KM3 A;  3TB5 A;  1R58 A;  3PKC A;  2EA2 A;  5FCF A;  4U6E A;  1XGN A;  1WN1 A;  3MR1 A;  2NQ7 A;  1XGO A;  2GTX A;  3FMQ A;  2P98 A;  5CNX A;  1WL6 A;  1WLR A;  5JI6 A;  1C27 A;  3ROR A;  2B3K A;  3PKA A;  3IU9 A;  1WKM A;  4ZWU A;  3TAV A;  1BN5 A;  4OOK A; 
#chains in the Genus database with same CATH topology
 5D6F A;  2Q93 A;  2V3Y A;  2BB7 A;  4FKC A;  1XGS A;  2GU6 A;  1YW9 A;  2B3H A;  3FMR A;  3IU8 A;  1YW8 A;  3CTZ A;  5CDE A;  4ZWP A;  2BWT A;  4IF7 A;  4FLJ A;  1C21 A;  3IG4 A;  2IW2 A;  2P99 A;  3BIT A;  4Z7M A;  2BWV A;  3BIP A;  4HXX A;  2ZSG A;  1WY2 A;  4FO7 A;  2P9A A;  4R60 A;  2OKN A;  4QR8 A;  2GG7 A;  1O0X A;  2BHA A;  2BHC A;  5JFR A;  1YVM A;  2GU4 A;  3Q6D A;  2DFI A;  4A6V A;  5CDV A;  1N51 A;  2EVO A;  1R5H A;  4IEC A;  2BH3 A;  3MX6 A;  4IKT A;  1KP0 A;  4U6W A;  4EGE A;  2EA4 A;  4S2R P;  4JUQ A;  1QXY A;  3PKD A;  1BOA A;  2BWX A;  4U70 A;  1PV9 A;  4U1B A;  1W2M A;  4RGZ 1;  2GG8 A;  2GGC A;  3L7G A;  2G6P A;  4IKU A;  2HOW A;  1QXW A;  4FUK A;  2V3Z A;  4IDY A;  2BWW A;  4U75 A;  3MAT A;  2Q8K A;  3IU7 A;  1M35 A;  4U71 A;  1KQ9 A;  1XNZ A;  2GU7 A;  2Q95 A;  3CB5 A;  1XGM A;  1B6A A;  1JAW A;  2BN7 A;  2Q94 A;  2OAZ A;  4MAT A;  4B28 A;  4U76 A;  2Q92 A;  5JHU A;  4IPA A;  5CLS A;  4IKR A;  3S6B A;  2BHB A;  1Y1N A;  4IKS A;  1C24 A;  5CDL A;  5D6E A;  2GG5 A;  1CHM A;  2B3L A;  4ZWO A;  1YJ3 A;  1WL9 A;  2GG3 A;  2GG2 A;  3BIQ A;  4U69 A;  4PV4 A;  1YW7 A;  4PNC A;  4S01 A;  4FLK A;  1WBQ A;  4ZNG A;  4U73 A;  1A16 A;  2BHD A;  2MAT A;  4RZY A;  2BWY A;  2GG9 A;  2GA2 A;  1QZY A;  4U6Z A;  3PKE A;  3RVA A;  2EVM A;  1C23 A;  2V3X A;  3D27 A;  3L24 A;  4FO8 A;  2EVC A;  2ADU A;  4U6J A;  2GU5 A;  2GGB A;  4S2T P;  1R5G A;  1C22 A;  4IU6 A;  2BWS A;  4A6W A;  2Q96 A;  1W7V A;  5FCH A;  4FLL A;  2GG0 A;  5E5B A;  3CB6 A;  3PKB A;  2GZ5 A;  1QXZ A;  1B59 A;  2NQ6 A;  1KQ0 A;  4U6C A;  4S00 A;  5CIK A;  5CE6 A;  2V6C A;  3FM3 A;  4FLI A;  2BWU A;  4RZZ A;  1MAT A;  4KM3 A;  3TB5 A;  1R58 A;  3PKC A;  2EA2 A;  5FCF A;  4U6E A;  1XGN A;  1WN1 A;  3MR1 A;  2NQ7 A;  1XGO A;  2GTX A;  3FMQ A;  2P98 A;  5CNX A;  1WL6 A;  1WLR A;  5JI6 A;  1C27 A;  3ROR A;  2B3K A;  3PKA A;  3IU9 A;  1WKM A;  4ZWU A;  3TAV A;  1BN5 A;  4OOK A; 
#chains in the Genus database with same CATH homology
 5D6F A;  2Q93 A;  2V3Y A;  2BB7 A;  4FKC A;  1XGS A;  2GU6 A;  1YW9 A;  2B3H A;  3FMR A;  3IU8 A;  1YW8 A;  3CTZ A;  5CDE A;  4ZWP A;  2BWT A;  4IF7 A;  4FLJ A;  1C21 A;  3IG4 A;  2IW2 A;  2P99 A;  3BIT A;  4Z7M A;  2BWV A;  3BIP A;  4HXX A;  2ZSG A;  1WY2 A;  4FO7 A;  2P9A A;  4R60 A;  2OKN A;  4QR8 A;  2GG7 A;  1O0X A;  2BHA A;  2BHC A;  5JFR A;  1YVM A;  2GU4 A;  3Q6D A;  2DFI A;  4A6V A;  5CDV A;  1N51 A;  2EVO A;  1R5H A;  4IEC A;  2BH3 A;  3MX6 A;  4IKT A;  1KP0 A;  4U6W A;  4EGE A;  2EA4 A;  4S2R P;  4JUQ A;  1QXY A;  3PKD A;  1BOA A;  2BWX A;  4U70 A;  1PV9 A;  4U1B A;  1W2M A;  4RGZ 1;  2GG8 A;  2GGC A;  3L7G A;  2G6P A;  4IKU A;  2HOW A;  1QXW A;  4FUK A;  2V3Z A;  4IDY A;  2BWW A;  4U75 A;  3MAT A;  2Q8K A;  3IU7 A;  1M35 A;  4U71 A;  1KQ9 A;  1XNZ A;  2GU7 A;  2Q95 A;  3CB5 A;  1XGM A;  1B6A A;  1JAW A;  2BN7 A;  2Q94 A;  2OAZ A;  4MAT A;  4B28 A;  4U76 A;  2Q92 A;  5JHU A;  4IPA A;  5CLS A;  4IKR A;  3S6B A;  2BHB A;  1Y1N A;  4IKS A;  1C24 A;  5CDL A;  5D6E A;  2GG5 A;  1CHM A;  2B3L A;  4ZWO A;  1YJ3 A;  1WL9 A;  2GG3 A;  2GG2 A;  3BIQ A;  4U69 A;  4PV4 A;  1YW7 A;  4PNC A;  4S01 A;  4FLK A;  1WBQ A;  4ZNG A;  4U73 A;  1A16 A;  2BHD A;  2MAT A;  4RZY A;  2BWY A;  2GG9 A;  2GA2 A;  1QZY A;  4U6Z A;  3PKE A;  3RVA A;  2EVM A;  1C23 A;  2V3X A;  3D27 A;  3L24 A;  4FO8 A;  2EVC A;  2ADU A;  4U6J A;  2GU5 A;  2GGB A;  4S2T P;  1R5G A;  1C22 A;  4IU6 A;  2BWS A;  4A6W A;  2Q96 A;  1W7V A;  5FCH A;  4FLL A;  2GG0 A;  5E5B A;  3CB6 A;  3PKB A;  2GZ5 A;  1QXZ A;  1B59 A;  2NQ6 A;  1KQ0 A;  4U6C A;  4S00 A;  5CIK A;  5CE6 A;  2V6C A;  3FM3 A;  4FLI A;  2BWU A;  4RZZ A;  1MAT A;  4KM3 A;  3TB5 A;  1R58 A;  3PKC A;  2EA2 A;  5FCF A;  4U6E A;  1XGN A;  1WN1 A;  3MR1 A;  2NQ7 A;  1XGO A;  2GTX A;  3FMQ A;  2P98 A;  5CNX A;  1WL6 A;  1WLR A;  5JI6 A;  1C27 A;  3ROR A;  2B3K A;  3PKA A;  3IU9 A;  1WKM A;  4ZWU A;  3TAV A;  1BN5 A;  4OOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...