4IKSA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(6-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iksA00
1WKMA 3RVAA 4FLKA 2GG3A 4FKCA 4U6CA 5CNXA 4KM3A 2BWWA 4S00A 4S2TP 2B3KA 2GU5A 2GTXA 2GZ5A 4PNCA 5E5BA 4U75A 3MX6A 2BHAA 1WY2A 2EA2A 3MATA 4IDYA 4RGZ1 5FCHA 2IW2A 3CB5A 5CIKA 2BHCA 1PV9A 2GG2A 4U6EA 4IKUA 4U69A 5FCFA 2BN7A 1QXYA 4FLJA 2EVMA 4FUKA 2P98A 2EA4A 1C22A 3D27A 4OOKA 1WL9A 3MR1A 3IG4A 1KP0A 4IF7A 1C21A 1QZYA 1XGNA 2V3ZA 4R60A 1JAWA 1A16A 5CLSA 2ZSGA 2V3XA 1KQ9A 1C24A 4ZNGA 2V3YA 2GGCA 3IU8A 2BH3A 4JUQA 2DFIA 4U6JA 1BN5A 4U6WA 4IECA 2BHDA 2BB7A 1YJ3A 3BIQA 4ZWUA 5CE6A 2GG5A 4S2RP 2GU7A 2Q96A 3L7GA 4IPAA 1XGMA 2GU6A 4IU6A 4FLLA 4ZWOA 2GG9A 3IU9A 4RZYA 4A6WA 2GG7A 1W2MA 4IKSA 4Z7MA 1O0XA 1YVMA 4FO7A 5D6EA 2P9AA 1QXZA 2BHBA 1XNZA 5CDVA 2B3LA 1MATA 3BITA 1R58A 4FO8A 4PV4A 2B3HA 1BOAA 1M35A 3RORA 3TB5A 5JFRA 2GA2A 1YW8A 4IKRA 4U70A 1C23A 3TAVA 5CDLA 3S6BA 3Q6DA 2Q8KA 4FLIA 1CHMA 2BWVA 4S01A 1YW9A 4HXXA 2GG0A 2Q95A 5JHUA 2BWTA 2BWYA 3PKAA 3FM3A 4U73A 1XGOA 4MATA 4U71A 1R5GA 2EVCA 3IU7A 1KQ0A 5D6FA 4QR8A 4U6ZA 2NQ6A 1N51A 2GU4A 1WL6A 3FMRA 3PKCA 4EGEA 1B6AA 1WLRA 2BWUA 2OAZA 1W7VA 1B59A 2V6CA 3CTZA 2HOWA 2OKNA 2GGBA 2NQ7A 3PKBA 2P99A 2BWSA 2Q94A 3FMQA 4A6VA 2EVOA 4U76A 2ADUA 3PKEA 2Q93A 1WBQA 1XGSA 2G6PA 1QXWA 1Y1NA 3BIPA 1WN1A 2Q92A 4RZZA 1YW7A 4IKTA 2BWXA 3PKDA 1C27A 2GG8A 5CDEA 3L24A 4ZWPA 5JI6A 3CB6A 2MATA 1R5HA 4U1BA 4B28A
chains in the Genus database with same CATH superfamily
1WKMA 3RVAA 4FLKA 2GG3A 4FKCA 4U6CA 5CNXA 4KM3A 2BWWA 4S00A 4S2TP 2B3KA 2GU5A 2GTXA 2GZ5A 4PNCA 5E5BA 4U75A 3MX6A 2BHAA 1WY2A 2EA2A 3MATA 4IDYA 4RGZ1 5FCHA 2IW2A 3CB5A 5CIKA 2BHCA 1PV9A 2GG2A 4U6EA 4IKUA 4U69A 5FCFA 2BN7A 1QXYA 4FLJA 2EVMA 4FUKA 2P98A 2EA4A 1C22A 3D27A 4OOKA 1WL9A 3MR1A 3IG4A 1KP0A 4IF7A 1C21A 1QZYA 1XGNA 2V3ZA 4R60A 1JAWA 1A16A 5CLSA 2ZSGA 2V3XA 1KQ9A 1C24A 4ZNGA 2V3YA 2GGCA 3IU8A 2BH3A 4JUQA 2DFIA 4U6JA 1BN5A 4U6WA 4IECA 2BHDA 2BB7A 1YJ3A 3BIQA 4ZWUA 5CE6A 2GG5A 4S2RP 2GU7A 2Q96A 3L7GA 4IPAA 1XGMA 2GU6A 4IU6A 4FLLA 4ZWOA 2GG9A 3IU9A 4RZYA 4A6WA 2GG7A 1W2MA 4IKSA 4Z7MA 1O0XA 1YVMA 4FO7A 5D6EA 2P9AA 1QXZA 2BHBA 1XNZA 5CDVA 2B3LA 1MATA 3BITA 1R58A 4FO8A 4PV4A 2B3HA 1BOAA 1M35A 3RORA 3TB5A 5JFRA 2GA2A 1YW8A 4IKRA 4U70A 1C23A 3TAVA 5CDLA 3S6BA 3Q6DA 2Q8KA 4FLIA 1CHMA 2BWVA 4S01A 1YW9A 4HXXA 2GG0A 2Q95A 5JHUA 2BWTA 2BWYA 3PKAA 3FM3A 4U73A 1XGOA 4MATA 4U71A 1R5GA 2EVCA 3IU7A 1KQ0A 5D6FA 4QR8A 4U6ZA 2NQ6A 1N51A 2GU4A 1WL6A 3FMRA 3PKCA 4EGEA 1B6AA 1WLRA 2BWUA 2OAZA 1W7VA 1B59A 2V6CA 3CTZA 2HOWA 2OKNA 2GGBA 2NQ7A 3PKBA 2P99A 2BWSA 2Q94A 3FMQA 4A6VA 2EVOA 4U76A 2ADUA 3PKEA 2Q93A 1WBQA 1XGSA 2G6PA 1QXWA 1Y1NA 3BIPA 1WN1A 2Q92A 4RZZA 1YW7A 4IKTA 2BWXA 3PKDA 1C27A 2GG8A 5CDEA 3L24A 4ZWPA 5JI6A 3CB6A 2MATA 1R5HA 4U1BA 4B28A
chains in the Genus database with same CATH topology
1WKMA 3RVAA 4FLKA 2GG3A 4FKCA 4U6CA 5CNXA 4KM3A 2BWWA 4S00A 4S2TP 2B3KA 2GU5A 2GTXA 2GZ5A 4PNCA 5E5BA 4U75A 3MX6A 2BHAA 1WY2A 2EA2A 3MATA 4IDYA 4RGZ1 5FCHA 2IW2A 3CB5A 5CIKA 2BHCA 1PV9A 2GG2A 4U6EA 4IKUA 4U69A 5FCFA 2BN7A 1QXYA 4FLJA 2EVMA 4FUKA 2P98A 2EA4A 1C22A 3D27A 4OOKA 1WL9A 3MR1A 3IG4A 1KP0A 4IF7A 1C21A 1QZYA 1XGNA 2V3ZA 4R60A 1JAWA 1A16A 5CLSA 2ZSGA 2V3XA 1KQ9A 1C24A 4ZNGA 2V3YA 2GGCA 3IU8A 2BH3A 4JUQA 2DFIA 4U6JA 1BN5A 4U6WA 4IECA 2BHDA 2BB7A 1YJ3A 3BIQA 4ZWUA 5CE6A 2GG5A 4S2RP 2GU7A 2Q96A 3L7GA 4IPAA 1XGMA 2GU6A 4IU6A 4FLLA 4ZWOA 2GG9A 3IU9A 4RZYA 4A6WA 2GG7A 1W2MA 4IKSA 4Z7MA 1O0XA 1YVMA 4FO7A 5D6EA 2P9AA 1QXZA 2BHBA 1XNZA 5CDVA 2B3LA 1MATA 3BITA 1R58A 4FO8A 4PV4A 2B3HA 1BOAA 1M35A 3RORA 3TB5A 5JFRA 2GA2A 1YW8A 4IKRA 4U70A 1C23A 3TAVA 5CDLA 3S6BA 3Q6DA 2Q8KA 4FLIA 1CHMA 2BWVA 4S01A 1YW9A 4HXXA 2GG0A 2Q95A 5JHUA 2BWTA 2BWYA 3PKAA 3FM3A 4U73A 1XGOA 4MATA 4U71A 1R5GA 2EVCA 3IU7A 1KQ0A 5D6FA 4QR8A 4U6ZA 2NQ6A 1N51A 2GU4A 1WL6A 3FMRA 3PKCA 4EGEA 1B6AA 1WLRA 2BWUA 2OAZA 1W7VA 1B59A 2V6CA 3CTZA 2HOWA 2OKNA 2GGBA 2NQ7A 3PKBA 2P99A 2BWSA 2Q94A 3FMQA 4A6VA 2EVOA 4U76A 2ADUA 3PKEA 2Q93A 1WBQA 1XGSA 2G6PA 1QXWA 1Y1NA 3BIPA 1WN1A 2Q92A 4RZZA 1YW7A 4IKTA 2BWXA 3PKDA 1C27A 2GG8A 5CDEA 3L24A 4ZWPA 5JI6A 3CB6A 2MATA 1R5HA 4U1BA 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKM A;  3RVA A;  4FLK A;  2GG3 A;  4FKC A;  4U6C A;  5CNX A;  4KM3 A;  2BWW A;  4S00 A;  4S2T P;  2B3K A;  2GU5 A;  2GTX A;  2GZ5 A;  4PNC A;  5E5B A;  4U75 A;  3MX6 A;  2BHA A;  1WY2 A;  2EA2 A;  3MAT A;  4IDY A;  4RGZ 1;  5FCH A;  2IW2 A;  3CB5 A;  5CIK A;  2BHC A;  1PV9 A;  2GG2 A;  4U6E A;  4IKU A;  4U69 A;  5FCF A;  2BN7 A;  1QXY A;  4FLJ A;  2EVM A;  4FUK A;  2P98 A;  2EA4 A;  1C22 A;  3D27 A;  4OOK A;  1WL9 A;  3MR1 A;  3IG4 A;  1KP0 A;  4IF7 A;  1C21 A;  1QZY A;  1XGN A;  2V3Z A;  4R60 A;  1JAW A;  1A16 A;  5CLS A;  2ZSG A;  2V3X A;  1KQ9 A;  1C24 A;  4ZNG A;  2V3Y A;  2GGC A;  3IU8 A;  2BH3 A;  4JUQ A;  2DFI A;  4U6J A;  1BN5 A;  4U6W A;  4IEC A;  2BHD A;  2BB7 A;  1YJ3 A;  3BIQ A;  4ZWU A;  5CE6 A;  2GG5 A;  4S2R P;  2GU7 A;  2Q96 A;  3L7G A;  4IPA A;  1XGM A;  2GU6 A;  4IU6 A;  4FLL A;  4ZWO A;  2GG9 A;  3IU9 A;  4RZY A;  4A6W A;  2GG7 A;  1W2M A;  4IKS A;  4Z7M A;  1O0X A;  1YVM A;  4FO7 A;  5D6E A;  2P9A A;  1QXZ A;  2BHB A;  1XNZ A;  5CDV A;  2B3L A;  1MAT A;  3BIT A;  1R58 A;  4FO8 A;  4PV4 A;  2B3H A;  1BOA A;  1M35 A;  3ROR A;  3TB5 A;  5JFR A;  2GA2 A;  1YW8 A;  4IKR A;  4U70 A;  1C23 A;  3TAV A;  5CDL A;  3S6B A;  3Q6D A;  2Q8K A;  4FLI A;  1CHM A;  2BWV A;  4S01 A;  1YW9 A;  4HXX A;  2GG0 A;  2Q95 A;  5JHU A;  2BWT A;  2BWY A;  3PKA A;  3FM3 A;  4U73 A;  1XGO A;  4MAT A;  4U71 A;  1R5G A;  2EVC A;  3IU7 A;  1KQ0 A;  5D6F A;  4QR8 A;  4U6Z A;  2NQ6 A;  1N51 A;  2GU4 A;  1WL6 A;  3FMR A;  3PKC A;  4EGE A;  1B6A A;  1WLR A;  2BWU A;  2OAZ A;  1W7V A;  1B59 A;  2V6C A;  3CTZ A;  2HOW A;  2OKN A;  2GGB A;  2NQ7 A;  3PKB A;  2P99 A;  2BWS A;  2Q94 A;  3FMQ A;  4A6V A;  2EVO A;  4U76 A;  2ADU A;  3PKE A;  2Q93 A;  1WBQ A;  1XGS A;  2G6P A;  1QXW A;  1Y1N A;  3BIP A;  1WN1 A;  2Q92 A;  4RZZ A;  1YW7 A;  4IKT A;  2BWX A;  3PKD A;  1C27 A;  2GG8 A;  5CDE A;  3L24 A;  4ZWP A;  5JI6 A;  3CB6 A;  2MAT A;  1R5H A;  4U1B A;  4B28 A; 
#chains in the Genus database with same CATH topology
 1WKM A;  3RVA A;  4FLK A;  2GG3 A;  4FKC A;  4U6C A;  5CNX A;  4KM3 A;  2BWW A;  4S00 A;  4S2T P;  2B3K A;  2GU5 A;  2GTX A;  2GZ5 A;  4PNC A;  5E5B A;  4U75 A;  3MX6 A;  2BHA A;  1WY2 A;  2EA2 A;  3MAT A;  4IDY A;  4RGZ 1;  5FCH A;  2IW2 A;  3CB5 A;  5CIK A;  2BHC A;  1PV9 A;  2GG2 A;  4U6E A;  4IKU A;  4U69 A;  5FCF A;  2BN7 A;  1QXY A;  4FLJ A;  2EVM A;  4FUK A;  2P98 A;  2EA4 A;  1C22 A;  3D27 A;  4OOK A;  1WL9 A;  3MR1 A;  3IG4 A;  1KP0 A;  4IF7 A;  1C21 A;  1QZY A;  1XGN A;  2V3Z A;  4R60 A;  1JAW A;  1A16 A;  5CLS A;  2ZSG A;  2V3X A;  1KQ9 A;  1C24 A;  4ZNG A;  2V3Y A;  2GGC A;  3IU8 A;  2BH3 A;  4JUQ A;  2DFI A;  4U6J A;  1BN5 A;  4U6W A;  4IEC A;  2BHD A;  2BB7 A;  1YJ3 A;  3BIQ A;  4ZWU A;  5CE6 A;  2GG5 A;  4S2R P;  2GU7 A;  2Q96 A;  3L7G A;  4IPA A;  1XGM A;  2GU6 A;  4IU6 A;  4FLL A;  4ZWO A;  2GG9 A;  3IU9 A;  4RZY A;  4A6W A;  2GG7 A;  1W2M A;  4IKS A;  4Z7M A;  1O0X A;  1YVM A;  4FO7 A;  5D6E A;  2P9A A;  1QXZ A;  2BHB A;  1XNZ A;  5CDV A;  2B3L A;  1MAT A;  3BIT A;  1R58 A;  4FO8 A;  4PV4 A;  2B3H A;  1BOA A;  1M35 A;  3ROR A;  3TB5 A;  5JFR A;  2GA2 A;  1YW8 A;  4IKR A;  4U70 A;  1C23 A;  3TAV A;  5CDL A;  3S6B A;  3Q6D A;  2Q8K A;  4FLI A;  1CHM A;  2BWV A;  4S01 A;  1YW9 A;  4HXX A;  2GG0 A;  2Q95 A;  5JHU A;  2BWT A;  2BWY A;  3PKA A;  3FM3 A;  4U73 A;  1XGO A;  4MAT A;  4U71 A;  1R5G A;  2EVC A;  3IU7 A;  1KQ0 A;  5D6F A;  4QR8 A;  4U6Z A;  2NQ6 A;  1N51 A;  2GU4 A;  1WL6 A;  3FMR A;  3PKC A;  4EGE A;  1B6A A;  1WLR A;  2BWU A;  2OAZ A;  1W7V A;  1B59 A;  2V6C A;  3CTZ A;  2HOW A;  2OKN A;  2GGB A;  2NQ7 A;  3PKB A;  2P99 A;  2BWS A;  2Q94 A;  3FMQ A;  4A6V A;  2EVO A;  4U76 A;  2ADU A;  3PKE A;  2Q93 A;  1WBQ A;  1XGS A;  2G6P A;  1QXW A;  1Y1N A;  3BIP A;  1WN1 A;  2Q92 A;  4RZZ A;  1YW7 A;  4IKT A;  2BWX A;  3PKD A;  1C27 A;  2GG8 A;  5CDE A;  3L24 A;  4ZWP A;  5JI6 A;  3CB6 A;  2MAT A;  1R5H A;  4U1B A;  4B28 A; 
#chains in the Genus database with same CATH homology
 1WKM A;  3RVA A;  4FLK A;  2GG3 A;  4FKC A;  4U6C A;  5CNX A;  4KM3 A;  2BWW A;  4S00 A;  4S2T P;  2B3K A;  2GU5 A;  2GTX A;  2GZ5 A;  4PNC A;  5E5B A;  4U75 A;  3MX6 A;  2BHA A;  1WY2 A;  2EA2 A;  3MAT A;  4IDY A;  4RGZ 1;  5FCH A;  2IW2 A;  3CB5 A;  5CIK A;  2BHC A;  1PV9 A;  2GG2 A;  4U6E A;  4IKU A;  4U69 A;  5FCF A;  2BN7 A;  1QXY A;  4FLJ A;  2EVM A;  4FUK A;  2P98 A;  2EA4 A;  1C22 A;  3D27 A;  4OOK A;  1WL9 A;  3MR1 A;  3IG4 A;  1KP0 A;  4IF7 A;  1C21 A;  1QZY A;  1XGN A;  2V3Z A;  4R60 A;  1JAW A;  1A16 A;  5CLS A;  2ZSG A;  2V3X A;  1KQ9 A;  1C24 A;  4ZNG A;  2V3Y A;  2GGC A;  3IU8 A;  2BH3 A;  4JUQ A;  2DFI A;  4U6J A;  1BN5 A;  4U6W A;  4IEC A;  2BHD A;  2BB7 A;  1YJ3 A;  3BIQ A;  4ZWU A;  5CE6 A;  2GG5 A;  4S2R P;  2GU7 A;  2Q96 A;  3L7G A;  4IPA A;  1XGM A;  2GU6 A;  4IU6 A;  4FLL A;  4ZWO A;  2GG9 A;  3IU9 A;  4RZY A;  4A6W A;  2GG7 A;  1W2M A;  4IKS A;  4Z7M A;  1O0X A;  1YVM A;  4FO7 A;  5D6E A;  2P9A A;  1QXZ A;  2BHB A;  1XNZ A;  5CDV A;  2B3L A;  1MAT A;  3BIT A;  1R58 A;  4FO8 A;  4PV4 A;  2B3H A;  1BOA A;  1M35 A;  3ROR A;  3TB5 A;  5JFR A;  2GA2 A;  1YW8 A;  4IKR A;  4U70 A;  1C23 A;  3TAV A;  5CDL A;  3S6B A;  3Q6D A;  2Q8K A;  4FLI A;  1CHM A;  2BWV A;  4S01 A;  1YW9 A;  4HXX A;  2GG0 A;  2Q95 A;  5JHU A;  2BWT A;  2BWY A;  3PKA A;  3FM3 A;  4U73 A;  1XGO A;  4MAT A;  4U71 A;  1R5G A;  2EVC A;  3IU7 A;  1KQ0 A;  5D6F A;  4QR8 A;  4U6Z A;  2NQ6 A;  1N51 A;  2GU4 A;  1WL6 A;  3FMR A;  3PKC A;  4EGE A;  1B6A A;  1WLR A;  2BWU A;  2OAZ A;  1W7V A;  1B59 A;  2V6C A;  3CTZ A;  2HOW A;  2OKN A;  2GGB A;  2NQ7 A;  3PKB A;  2P99 A;  2BWS A;  2Q94 A;  3FMQ A;  4A6V A;  2EVO A;  4U76 A;  2ADU A;  3PKE A;  2Q93 A;  1WBQ A;  1XGS A;  2G6P A;  1QXW A;  1Y1N A;  3BIP A;  1WN1 A;  2Q92 A;  4RZZ A;  1YW7 A;  4IKT A;  2BWX A;  3PKD A;  1C27 A;  2GG8 A;  5CDE A;  3L24 A;  4ZWP A;  5JI6 A;  3CB6 A;  2MAT A;  1R5H A;  4U1B A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...