4IKSA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(6-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iksA00
1BN5A 1XGOA 3BIQA 3PKCA 1QXYA 4OOKA 3PKAA 3TAVA 4RZZA 1XGNA 3RORA 3PKDA 4ZNGA 1WN1A 2V3XA 4IDYA 1M35A 5CLSA 1WL6A 2MATA 1B59A 2GU4A 1R5GA 2NQ7A 3L7GA 5D6FA 4U6CA 2BHAA 2OAZA 3FMQA 2GG5A 2DFIA 2GU6A 1WBQA 1KQ0A 1B6AA 1KP0A 3CB5A 1KQ9A 3RVAA 4U6WA 2V3ZA 3FMRA 2B3LA 1XGSA 4U70A 2OKNA 3MX6A 2BWSA 2EVOA 4FUKA 2BB7A 2BWXA 2B3HA 1A16A 4U75A 4U6JA 2P98A 2GG7A 2Q94A 2GA2A 4IKUA 2GG9A 1C27A 2BWTA 1PV9A 2ZSGA 1W7VA 2Q93A 2G6PA 3Q6DA 4A6WA 4QR8A 5CDEA 4FKCA 4IU6A 4U73A 1JAWA 4FO7A 5JI6A 2HOWA 2NQ6A 5CE6A 5CNXA 4RZYA 4S2TP 1C21A 1CHMA 2Q96A 4S01A 1MATA 1YW9A 1QXWA 2EA2A 3TB5A 4R60A 2V3YA 1C23A 4IKTA 3MR1A 5CDLA 1YW8A 1YW7A 2GU5A 4PV4A 1YVMA 1WY2A 4RGZ1 1BOAA 2BHDA 4U6ZA 5E5BA 1XNZA 4FLJA 4JUQA 2BWVA 4FLIA 5CIKA 1WKMA 1N51A 4U1BA 4IECA 2BHBA 2Q95A 3BITA 4U71A 1WL9A 1C22A 2BWWA 2BN7A 2BWYA 2GGCA 3IU7A 4B28A 2EVCA 2GG0A 4U76A 3IU9A 5FCFA 3S6BA 3PKBA 1O0XA 3FM3A 2GG8A 2BH3A 2GGBA 4ZWUA 4KM3A 4U6EA 2GTXA 3CTZA 2GG2A 2V6CA 4MATA 4S2RP 3BIPA 2EA4A 2Q92A 1Y1NA 2IW2A 2Q8KA 2B3KA 3IG4A 2GG3A 2GU7A 4Z7MA 1YJ3A 4ZWOA 3IU8A 2P99A 1R58A 2GZ5A 1QXZA 4U69A 3MATA 1XGMA 4S00A 2ADUA 2EVMA 3D27A 1W2MA 4FO8A 3CB6A 4A6VA 4IKSA 2BHCA 4IKRA 4FLLA 4HXXA 1C24A 2P9AA 5FCHA 5JFRA 3PKEA 5CDVA 4PNCA 1QZYA 1R5HA 1WLRA 3L24A 2BWUA 4EGEA 4ZWPA 5D6EA 4IF7A 4FLKA 5JHUA 4IPAA
chains in the Genus database with same CATH superfamily
1BN5A 1XGOA 3BIQA 3PKCA 1QXYA 4OOKA 3PKAA 3TAVA 4RZZA 1XGNA 3RORA 3PKDA 4ZNGA 1WN1A 2V3XA 4IDYA 1M35A 5CLSA 1WL6A 2MATA 1B59A 2GU4A 1R5GA 2NQ7A 3L7GA 5D6FA 4U6CA 2BHAA 2OAZA 3FMQA 2GG5A 2DFIA 2GU6A 1WBQA 1KQ0A 1B6AA 1KP0A 3CB5A 1KQ9A 3RVAA 4U6WA 2V3ZA 3FMRA 2B3LA 1XGSA 4U70A 2OKNA 3MX6A 2BWSA 2EVOA 4FUKA 2BB7A 2BWXA 2B3HA 1A16A 4U75A 4U6JA 2P98A 2GG7A 2Q94A 2GA2A 4IKUA 2GG9A 1C27A 2BWTA 1PV9A 2ZSGA 1W7VA 2Q93A 2G6PA 3Q6DA 4A6WA 4QR8A 5CDEA 4FKCA 4IU6A 4U73A 1JAWA 4FO7A 5JI6A 2HOWA 2NQ6A 5CE6A 5CNXA 4RZYA 4S2TP 1C21A 1CHMA 2Q96A 4S01A 1MATA 1YW9A 1QXWA 2EA2A 3TB5A 4R60A 2V3YA 1C23A 4IKTA 3MR1A 5CDLA 1YW8A 1YW7A 2GU5A 4PV4A 1YVMA 1WY2A 4RGZ1 1BOAA 2BHDA 4U6ZA 5E5BA 1XNZA 4FLJA 4JUQA 2BWVA 4FLIA 5CIKA 1WKMA 1N51A 4U1BA 4IECA 2BHBA 2Q95A 3BITA 4U71A 1WL9A 1C22A 2BWWA 2BN7A 2BWYA 2GGCA 3IU7A 4B28A 2EVCA 2GG0A 4U76A 3IU9A 5FCFA 3S6BA 3PKBA 1O0XA 3FM3A 2GG8A 2BH3A 2GGBA 4ZWUA 4KM3A 4U6EA 2GTXA 3CTZA 2GG2A 2V6CA 4MATA 4S2RP 3BIPA 2EA4A 2Q92A 1Y1NA 2IW2A 2Q8KA 2B3KA 3IG4A 2GG3A 2GU7A 4Z7MA 1YJ3A 4ZWOA 3IU8A 2P99A 1R58A 2GZ5A 1QXZA 4U69A 3MATA 1XGMA 4S00A 2ADUA 2EVMA 3D27A 1W2MA 4FO8A 3CB6A 4A6VA 4IKSA 2BHCA 4IKRA 4FLLA 4HXXA 1C24A 2P9AA 5FCHA 5JFRA 3PKEA 5CDVA 4PNCA 1QZYA 1R5HA 1WLRA 3L24A 2BWUA 4EGEA 4ZWPA 5D6EA 4IF7A 4FLKA 5JHUA 4IPAA
chains in the Genus database with same CATH topology
1BN5A 1XGOA 3BIQA 3PKCA 1QXYA 4OOKA 3PKAA 3TAVA 4RZZA 1XGNA 3RORA 3PKDA 4ZNGA 1WN1A 2V3XA 4IDYA 1M35A 5CLSA 1WL6A 2MATA 1B59A 2GU4A 1R5GA 2NQ7A 3L7GA 5D6FA 4U6CA 2BHAA 2OAZA 3FMQA 2GG5A 2DFIA 2GU6A 1WBQA 1KQ0A 1B6AA 1KP0A 3CB5A 1KQ9A 3RVAA 4U6WA 2V3ZA 3FMRA 2B3LA 1XGSA 4U70A 2OKNA 3MX6A 2BWSA 2EVOA 4FUKA 2BB7A 2BWXA 2B3HA 1A16A 4U75A 4U6JA 2P98A 2GG7A 2Q94A 2GA2A 4IKUA 2GG9A 1C27A 2BWTA 1PV9A 2ZSGA 1W7VA 2Q93A 2G6PA 3Q6DA 4A6WA 4QR8A 5CDEA 4FKCA 4IU6A 4U73A 1JAWA 4FO7A 5JI6A 2HOWA 2NQ6A 5CE6A 5CNXA 4RZYA 4S2TP 1C21A 1CHMA 2Q96A 4S01A 1MATA 1YW9A 1QXWA 2EA2A 3TB5A 4R60A 2V3YA 1C23A 4IKTA 3MR1A 5CDLA 1YW8A 1YW7A 2GU5A 4PV4A 1YVMA 1WY2A 4RGZ1 1BOAA 2BHDA 4U6ZA 5E5BA 1XNZA 4FLJA 4JUQA 2BWVA 4FLIA 5CIKA 1WKMA 1N51A 4U1BA 4IECA 2BHBA 2Q95A 3BITA 4U71A 1WL9A 1C22A 2BWWA 2BN7A 2BWYA 2GGCA 3IU7A 4B28A 2EVCA 2GG0A 4U76A 3IU9A 5FCFA 3S6BA 3PKBA 1O0XA 3FM3A 2GG8A 2BH3A 2GGBA 4ZWUA 4KM3A 4U6EA 2GTXA 3CTZA 2GG2A 2V6CA 4MATA 4S2RP 3BIPA 2EA4A 2Q92A 1Y1NA 2IW2A 2Q8KA 2B3KA 3IG4A 2GG3A 2GU7A 4Z7MA 1YJ3A 4ZWOA 3IU8A 2P99A 1R58A 2GZ5A 1QXZA 4U69A 3MATA 1XGMA 4S00A 2ADUA 2EVMA 3D27A 1W2MA 4FO8A 3CB6A 4A6VA 4IKSA 2BHCA 4IKRA 4FLLA 4HXXA 1C24A 2P9AA 5FCHA 5JFRA 3PKEA 5CDVA 4PNCA 1QZYA 1R5HA 1WLRA 3L24A 2BWUA 4EGEA 4ZWPA 5D6EA 4IF7A 4FLKA 5JHUA 4IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN5 A;  1XGO A;  3BIQ A;  3PKC A;  1QXY A;  4OOK A;  3PKA A;  3TAV A;  4RZZ A;  1XGN A;  3ROR A;  3PKD A;  4ZNG A;  1WN1 A;  2V3X A;  4IDY A;  1M35 A;  5CLS A;  1WL6 A;  2MAT A;  1B59 A;  2GU4 A;  1R5G A;  2NQ7 A;  3L7G A;  5D6F A;  4U6C A;  2BHA A;  2OAZ A;  3FMQ A;  2GG5 A;  2DFI A;  2GU6 A;  1WBQ A;  1KQ0 A;  1B6A A;  1KP0 A;  3CB5 A;  1KQ9 A;  3RVA A;  4U6W A;  2V3Z A;  3FMR A;  2B3L A;  1XGS A;  4U70 A;  2OKN A;  3MX6 A;  2BWS A;  2EVO A;  4FUK A;  2BB7 A;  2BWX A;  2B3H A;  1A16 A;  4U75 A;  4U6J A;  2P98 A;  2GG7 A;  2Q94 A;  2GA2 A;  4IKU A;  2GG9 A;  1C27 A;  2BWT A;  1PV9 A;  2ZSG A;  1W7V A;  2Q93 A;  2G6P A;  3Q6D A;  4A6W A;  4QR8 A;  5CDE A;  4FKC A;  4IU6 A;  4U73 A;  1JAW A;  4FO7 A;  5JI6 A;  2HOW A;  2NQ6 A;  5CE6 A;  5CNX A;  4RZY A;  4S2T P;  1C21 A;  1CHM A;  2Q96 A;  4S01 A;  1MAT A;  1YW9 A;  1QXW A;  2EA2 A;  3TB5 A;  4R60 A;  2V3Y A;  1C23 A;  4IKT A;  3MR1 A;  5CDL A;  1YW8 A;  1YW7 A;  2GU5 A;  4PV4 A;  1YVM A;  1WY2 A;  4RGZ 1;  1BOA A;  2BHD A;  4U6Z A;  5E5B A;  1XNZ A;  4FLJ A;  4JUQ A;  2BWV A;  4FLI A;  5CIK A;  1WKM A;  1N51 A;  4U1B A;  4IEC A;  2BHB A;  2Q95 A;  3BIT A;  4U71 A;  1WL9 A;  1C22 A;  2BWW A;  2BN7 A;  2BWY A;  2GGC A;  3IU7 A;  4B28 A;  2EVC A;  2GG0 A;  4U76 A;  3IU9 A;  5FCF A;  3S6B A;  3PKB A;  1O0X A;  3FM3 A;  2GG8 A;  2BH3 A;  2GGB A;  4ZWU A;  4KM3 A;  4U6E A;  2GTX A;  3CTZ A;  2GG2 A;  2V6C A;  4MAT A;  4S2R P;  3BIP A;  2EA4 A;  2Q92 A;  1Y1N A;  2IW2 A;  2Q8K A;  2B3K A;  3IG4 A;  2GG3 A;  2GU7 A;  4Z7M A;  1YJ3 A;  4ZWO A;  3IU8 A;  2P99 A;  1R58 A;  2GZ5 A;  1QXZ A;  4U69 A;  3MAT A;  1XGM A;  4S00 A;  2ADU A;  2EVM A;  3D27 A;  1W2M A;  4FO8 A;  3CB6 A;  4A6V A;  4IKS A;  2BHC A;  4IKR A;  4FLL A;  4HXX A;  1C24 A;  2P9A A;  5FCH A;  5JFR A;  3PKE A;  5CDV A;  4PNC A;  1QZY A;  1R5H A;  1WLR A;  3L24 A;  2BWU A;  4EGE A;  4ZWP A;  5D6E A;  4IF7 A;  4FLK A;  5JHU A;  4IPA A; 
#chains in the Genus database with same CATH topology
 1BN5 A;  1XGO A;  3BIQ A;  3PKC A;  1QXY A;  4OOK A;  3PKA A;  3TAV A;  4RZZ A;  1XGN A;  3ROR A;  3PKD A;  4ZNG A;  1WN1 A;  2V3X A;  4IDY A;  1M35 A;  5CLS A;  1WL6 A;  2MAT A;  1B59 A;  2GU4 A;  1R5G A;  2NQ7 A;  3L7G A;  5D6F A;  4U6C A;  2BHA A;  2OAZ A;  3FMQ A;  2GG5 A;  2DFI A;  2GU6 A;  1WBQ A;  1KQ0 A;  1B6A A;  1KP0 A;  3CB5 A;  1KQ9 A;  3RVA A;  4U6W A;  2V3Z A;  3FMR A;  2B3L A;  1XGS A;  4U70 A;  2OKN A;  3MX6 A;  2BWS A;  2EVO A;  4FUK A;  2BB7 A;  2BWX A;  2B3H A;  1A16 A;  4U75 A;  4U6J A;  2P98 A;  2GG7 A;  2Q94 A;  2GA2 A;  4IKU A;  2GG9 A;  1C27 A;  2BWT A;  1PV9 A;  2ZSG A;  1W7V A;  2Q93 A;  2G6P A;  3Q6D A;  4A6W A;  4QR8 A;  5CDE A;  4FKC A;  4IU6 A;  4U73 A;  1JAW A;  4FO7 A;  5JI6 A;  2HOW A;  2NQ6 A;  5CE6 A;  5CNX A;  4RZY A;  4S2T P;  1C21 A;  1CHM A;  2Q96 A;  4S01 A;  1MAT A;  1YW9 A;  1QXW A;  2EA2 A;  3TB5 A;  4R60 A;  2V3Y A;  1C23 A;  4IKT A;  3MR1 A;  5CDL A;  1YW8 A;  1YW7 A;  2GU5 A;  4PV4 A;  1YVM A;  1WY2 A;  4RGZ 1;  1BOA A;  2BHD A;  4U6Z A;  5E5B A;  1XNZ A;  4FLJ A;  4JUQ A;  2BWV A;  4FLI A;  5CIK A;  1WKM A;  1N51 A;  4U1B A;  4IEC A;  2BHB A;  2Q95 A;  3BIT A;  4U71 A;  1WL9 A;  1C22 A;  2BWW A;  2BN7 A;  2BWY A;  2GGC A;  3IU7 A;  4B28 A;  2EVC A;  2GG0 A;  4U76 A;  3IU9 A;  5FCF A;  3S6B A;  3PKB A;  1O0X A;  3FM3 A;  2GG8 A;  2BH3 A;  2GGB A;  4ZWU A;  4KM3 A;  4U6E A;  2GTX A;  3CTZ A;  2GG2 A;  2V6C A;  4MAT A;  4S2R P;  3BIP A;  2EA4 A;  2Q92 A;  1Y1N A;  2IW2 A;  2Q8K A;  2B3K A;  3IG4 A;  2GG3 A;  2GU7 A;  4Z7M A;  1YJ3 A;  4ZWO A;  3IU8 A;  2P99 A;  1R58 A;  2GZ5 A;  1QXZ A;  4U69 A;  3MAT A;  1XGM A;  4S00 A;  2ADU A;  2EVM A;  3D27 A;  1W2M A;  4FO8 A;  3CB6 A;  4A6V A;  4IKS A;  2BHC A;  4IKR A;  4FLL A;  4HXX A;  1C24 A;  2P9A A;  5FCH A;  5JFR A;  3PKE A;  5CDV A;  4PNC A;  1QZY A;  1R5H A;  1WLR A;  3L24 A;  2BWU A;  4EGE A;  4ZWP A;  5D6E A;  4IF7 A;  4FLK A;  5JHU A;  4IPA A; 
#chains in the Genus database with same CATH homology
 1BN5 A;  1XGO A;  3BIQ A;  3PKC A;  1QXY A;  4OOK A;  3PKA A;  3TAV A;  4RZZ A;  1XGN A;  3ROR A;  3PKD A;  4ZNG A;  1WN1 A;  2V3X A;  4IDY A;  1M35 A;  5CLS A;  1WL6 A;  2MAT A;  1B59 A;  2GU4 A;  1R5G A;  2NQ7 A;  3L7G A;  5D6F A;  4U6C A;  2BHA A;  2OAZ A;  3FMQ A;  2GG5 A;  2DFI A;  2GU6 A;  1WBQ A;  1KQ0 A;  1B6A A;  1KP0 A;  3CB5 A;  1KQ9 A;  3RVA A;  4U6W A;  2V3Z A;  3FMR A;  2B3L A;  1XGS A;  4U70 A;  2OKN A;  3MX6 A;  2BWS A;  2EVO A;  4FUK A;  2BB7 A;  2BWX A;  2B3H A;  1A16 A;  4U75 A;  4U6J A;  2P98 A;  2GG7 A;  2Q94 A;  2GA2 A;  4IKU A;  2GG9 A;  1C27 A;  2BWT A;  1PV9 A;  2ZSG A;  1W7V A;  2Q93 A;  2G6P A;  3Q6D A;  4A6W A;  4QR8 A;  5CDE A;  4FKC A;  4IU6 A;  4U73 A;  1JAW A;  4FO7 A;  5JI6 A;  2HOW A;  2NQ6 A;  5CE6 A;  5CNX A;  4RZY A;  4S2T P;  1C21 A;  1CHM A;  2Q96 A;  4S01 A;  1MAT A;  1YW9 A;  1QXW A;  2EA2 A;  3TB5 A;  4R60 A;  2V3Y A;  1C23 A;  4IKT A;  3MR1 A;  5CDL A;  1YW8 A;  1YW7 A;  2GU5 A;  4PV4 A;  1YVM A;  1WY2 A;  4RGZ 1;  1BOA A;  2BHD A;  4U6Z A;  5E5B A;  1XNZ A;  4FLJ A;  4JUQ A;  2BWV A;  4FLI A;  5CIK A;  1WKM A;  1N51 A;  4U1B A;  4IEC A;  2BHB A;  2Q95 A;  3BIT A;  4U71 A;  1WL9 A;  1C22 A;  2BWW A;  2BN7 A;  2BWY A;  2GGC A;  3IU7 A;  4B28 A;  2EVC A;  2GG0 A;  4U76 A;  3IU9 A;  5FCF A;  3S6B A;  3PKB A;  1O0X A;  3FM3 A;  2GG8 A;  2BH3 A;  2GGB A;  4ZWU A;  4KM3 A;  4U6E A;  2GTX A;  3CTZ A;  2GG2 A;  2V6C A;  4MAT A;  4S2R P;  3BIP A;  2EA4 A;  2Q92 A;  1Y1N A;  2IW2 A;  2Q8K A;  2B3K A;  3IG4 A;  2GG3 A;  2GU7 A;  4Z7M A;  1YJ3 A;  4ZWO A;  3IU8 A;  2P99 A;  1R58 A;  2GZ5 A;  1QXZ A;  4U69 A;  3MAT A;  1XGM A;  4S00 A;  2ADU A;  2EVM A;  3D27 A;  1W2M A;  4FO8 A;  3CB6 A;  4A6V A;  4IKS A;  2BHC A;  4IKR A;  4FLL A;  4HXX A;  1C24 A;  2P9A A;  5FCH A;  5JFR A;  3PKE A;  5CDV A;  4PNC A;  1QZY A;  1R5H A;  1WLR A;  3L24 A;  2BWU A;  4EGE A;  4ZWP A;  5D6E A;  4IF7 A;  4FLK A;  5JHU A;  4IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...