4IKSA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(6-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iksA00
4IECA 4R60A 4U6JA 2GU7A 2GG2A 1C23A 1YW9A 2GG7A 2B3HA 1R5GA 4B28A 2GU4A 2OKNA 3FMQA 3MATA 4IU6A 2Q96A 3PKEA 4U71A 4FO8A 5D6FA 2BWVA 5FCFA 4OOKA 4QR8A 1A16A 2V3YA 5CE6A 4IDYA 4RZZA 5CLSA 5CNXA 3IU9A 1BN5A 5JFRA 3BIPA 4U70A 3BITA 2BHDA 4Z7MA 4U73A 2EVMA 1KP0A 4U76A 2GG0A 2NQ6A 2GGBA 2BWWA 1C21A 2EA2A 4JUQA 4RZYA 4U6CA 3S6BA 2BWUA 1XGNA 2BWYA 1WL9A 2ZSGA 4IKRA 4U6WA 3FMRA 4U6ZA 4FLKA 3RORA 4U6EA 4FLJA 4PV4A 4IPAA 5E5BA 3IG4A 3FM3A 1YJ3A 1KQ0A 1Y1NA 4ZWOA 2Q8KA 1YVMA 1B6AA 4U69A 3D27A 3CTZA 1PV9A 1XNZA 1WN1A 1QZYA 2BWXA 3PKAA 4FKCA 3MX6A 2P98A 3TB5A 1KQ9A 2MATA 2Q95A 4FLLA 5CDLA 1M35A 1QXWA 4ZWUA 3PKDA 1W2MA 1WBQA 4S2RP 3CB6A 2Q94A 1BOAA 4IF7A 2V6CA 2V3ZA 4IKUA 1N51A 2BWTA 3BIQA 2BB7A 2BH3A 2HOWA 3MR1A 2EVOA 2P99A 2P9AA 1R5HA 4PNCA 1R58A 4FO7A 1CHMA 5JI6A 2Q93A 1WL6A 3TAVA 4EGEA 2EA4A 1W7VA 1XGMA 3L7GA 1O0XA 1B59A 2NQ7A 2EVCA 3L24A 4HXXA 1C24A 3IU7A 4FLIA 2B3KA 4A6VA 1WY2A 2GG5A 2BHBA 3CB5A 3PKBA 3PKCA 4FUKA 1JAWA 4KM3A 2OAZA 4MATA 3RVAA 5JHUA 4S2TP 4A6WA 1C27A 1XGOA 4IKTA 1MATA 2BN7A 4S00A 2BWSA 2GZ5A 4U75A 1C22A 2G6PA 3IU8A 2IW2A 4ZNGA 5D6EA 2GU6A 5FCHA 2B3LA 5CDVA 1WKMA 3Q6DA 1WLRA 1XGSA 4IKSA 2ADUA 1QXZA 2GG8A 2GG9A 2GU5A 5CIKA 1YW7A 1QXYA 4U1BA 5CDEA 2GG3A 2DFIA 4RGZ1 2GGCA 4ZWPA 2Q92A 2BHAA 2V3XA 4S01A 1YW8A 2BHCA 2GA2A 2GTXA
chains in the Genus database with same CATH superfamily
4IECA 4R60A 4U6JA 2GU7A 2GG2A 1C23A 1YW9A 2GG7A 2B3HA 1R5GA 4B28A 2GU4A 2OKNA 3FMQA 3MATA 4IU6A 2Q96A 3PKEA 4U71A 4FO8A 5D6FA 2BWVA 5FCFA 4OOKA 4QR8A 1A16A 2V3YA 5CE6A 4IDYA 4RZZA 5CLSA 5CNXA 3IU9A 1BN5A 5JFRA 3BIPA 4U70A 3BITA 2BHDA 4Z7MA 4U73A 2EVMA 1KP0A 4U76A 2GG0A 2NQ6A 2GGBA 2BWWA 1C21A 2EA2A 4JUQA 4RZYA 4U6CA 3S6BA 2BWUA 1XGNA 2BWYA 1WL9A 2ZSGA 4IKRA 4U6WA 3FMRA 4U6ZA 4FLKA 3RORA 4U6EA 4FLJA 4PV4A 4IPAA 5E5BA 3IG4A 3FM3A 1YJ3A 1KQ0A 1Y1NA 4ZWOA 2Q8KA 1YVMA 1B6AA 4U69A 3D27A 3CTZA 1PV9A 1XNZA 1WN1A 1QZYA 2BWXA 3PKAA 4FKCA 3MX6A 2P98A 3TB5A 1KQ9A 2MATA 2Q95A 4FLLA 5CDLA 1M35A 1QXWA 4ZWUA 3PKDA 1W2MA 1WBQA 4S2RP 3CB6A 2Q94A 1BOAA 4IF7A 2V6CA 2V3ZA 4IKUA 1N51A 2BWTA 3BIQA 2BB7A 2BH3A 2HOWA 3MR1A 2EVOA 2P99A 2P9AA 1R5HA 4PNCA 1R58A 4FO7A 1CHMA 5JI6A 2Q93A 1WL6A 3TAVA 4EGEA 2EA4A 1W7VA 1XGMA 3L7GA 1O0XA 1B59A 2NQ7A 2EVCA 3L24A 4HXXA 1C24A 3IU7A 4FLIA 2B3KA 4A6VA 1WY2A 2GG5A 2BHBA 3CB5A 3PKBA 3PKCA 4FUKA 1JAWA 4KM3A 2OAZA 4MATA 3RVAA 5JHUA 4S2TP 4A6WA 1C27A 1XGOA 4IKTA 1MATA 2BN7A 4S00A 2BWSA 2GZ5A 4U75A 1C22A 2G6PA 3IU8A 2IW2A 4ZNGA 5D6EA 2GU6A 5FCHA 2B3LA 5CDVA 1WKMA 3Q6DA 1WLRA 1XGSA 4IKSA 2ADUA 1QXZA 2GG8A 2GG9A 2GU5A 5CIKA 1YW7A 1QXYA 4U1BA 5CDEA 2GG3A 2DFIA 4RGZ1 2GGCA 4ZWPA 2Q92A 2BHAA 2V3XA 4S01A 1YW8A 2BHCA 2GA2A 2GTXA
chains in the Genus database with same CATH topology
4IECA 4R60A 4U6JA 2GU7A 2GG2A 1C23A 1YW9A 2GG7A 2B3HA 1R5GA 4B28A 2GU4A 2OKNA 3FMQA 3MATA 4IU6A 2Q96A 3PKEA 4U71A 4FO8A 5D6FA 2BWVA 5FCFA 4OOKA 4QR8A 1A16A 2V3YA 5CE6A 4IDYA 4RZZA 5CLSA 5CNXA 3IU9A 1BN5A 5JFRA 3BIPA 4U70A 3BITA 2BHDA 4Z7MA 4U73A 2EVMA 1KP0A 4U76A 2GG0A 2NQ6A 2GGBA 2BWWA 1C21A 2EA2A 4JUQA 4RZYA 4U6CA 3S6BA 2BWUA 1XGNA 2BWYA 1WL9A 2ZSGA 4IKRA 4U6WA 3FMRA 4U6ZA 4FLKA 3RORA 4U6EA 4FLJA 4PV4A 4IPAA 5E5BA 3IG4A 3FM3A 1YJ3A 1KQ0A 1Y1NA 4ZWOA 2Q8KA 1YVMA 1B6AA 4U69A 3D27A 3CTZA 1PV9A 1XNZA 1WN1A 1QZYA 2BWXA 3PKAA 4FKCA 3MX6A 2P98A 3TB5A 1KQ9A 2MATA 2Q95A 4FLLA 5CDLA 1M35A 1QXWA 4ZWUA 3PKDA 1W2MA 1WBQA 4S2RP 3CB6A 2Q94A 1BOAA 4IF7A 2V6CA 2V3ZA 4IKUA 1N51A 2BWTA 3BIQA 2BB7A 2BH3A 2HOWA 3MR1A 2EVOA 2P99A 2P9AA 1R5HA 4PNCA 1R58A 4FO7A 1CHMA 5JI6A 2Q93A 1WL6A 3TAVA 4EGEA 2EA4A 1W7VA 1XGMA 3L7GA 1O0XA 1B59A 2NQ7A 2EVCA 3L24A 4HXXA 1C24A 3IU7A 4FLIA 2B3KA 4A6VA 1WY2A 2GG5A 2BHBA 3CB5A 3PKBA 3PKCA 4FUKA 1JAWA 4KM3A 2OAZA 4MATA 3RVAA 5JHUA 4S2TP 4A6WA 1C27A 1XGOA 4IKTA 1MATA 2BN7A 4S00A 2BWSA 2GZ5A 4U75A 1C22A 2G6PA 3IU8A 2IW2A 4ZNGA 5D6EA 2GU6A 5FCHA 2B3LA 5CDVA 1WKMA 3Q6DA 1WLRA 1XGSA 4IKSA 2ADUA 1QXZA 2GG8A 2GG9A 2GU5A 5CIKA 1YW7A 1QXYA 4U1BA 5CDEA 2GG3A 2DFIA 4RGZ1 2GGCA 4ZWPA 2Q92A 2BHAA 2V3XA 4S01A 1YW8A 2BHCA 2GA2A 2GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEC A;  4R60 A;  4U6J A;  2GU7 A;  2GG2 A;  1C23 A;  1YW9 A;  2GG7 A;  2B3H A;  1R5G A;  4B28 A;  2GU4 A;  2OKN A;  3FMQ A;  3MAT A;  4IU6 A;  2Q96 A;  3PKE A;  4U71 A;  4FO8 A;  5D6F A;  2BWV A;  5FCF A;  4OOK A;  4QR8 A;  1A16 A;  2V3Y A;  5CE6 A;  4IDY A;  4RZZ A;  5CLS A;  5CNX A;  3IU9 A;  1BN5 A;  5JFR A;  3BIP A;  4U70 A;  3BIT A;  2BHD A;  4Z7M A;  4U73 A;  2EVM A;  1KP0 A;  4U76 A;  2GG0 A;  2NQ6 A;  2GGB A;  2BWW A;  1C21 A;  2EA2 A;  4JUQ A;  4RZY A;  4U6C A;  3S6B A;  2BWU A;  1XGN A;  2BWY A;  1WL9 A;  2ZSG A;  4IKR A;  4U6W A;  3FMR A;  4U6Z A;  4FLK A;  3ROR A;  4U6E A;  4FLJ A;  4PV4 A;  4IPA A;  5E5B A;  3IG4 A;  3FM3 A;  1YJ3 A;  1KQ0 A;  1Y1N A;  4ZWO A;  2Q8K A;  1YVM A;  1B6A A;  4U69 A;  3D27 A;  3CTZ A;  1PV9 A;  1XNZ A;  1WN1 A;  1QZY A;  2BWX A;  3PKA A;  4FKC A;  3MX6 A;  2P98 A;  3TB5 A;  1KQ9 A;  2MAT A;  2Q95 A;  4FLL A;  5CDL A;  1M35 A;  1QXW A;  4ZWU A;  3PKD A;  1W2M A;  1WBQ A;  4S2R P;  3CB6 A;  2Q94 A;  1BOA A;  4IF7 A;  2V6C A;  2V3Z A;  4IKU A;  1N51 A;  2BWT A;  3BIQ A;  2BB7 A;  2BH3 A;  2HOW A;  3MR1 A;  2EVO A;  2P99 A;  2P9A A;  1R5H A;  4PNC A;  1R58 A;  4FO7 A;  1CHM A;  5JI6 A;  2Q93 A;  1WL6 A;  3TAV A;  4EGE A;  2EA4 A;  1W7V A;  1XGM A;  3L7G A;  1O0X A;  1B59 A;  2NQ7 A;  2EVC A;  3L24 A;  4HXX A;  1C24 A;  3IU7 A;  4FLI A;  2B3K A;  4A6V A;  1WY2 A;  2GG5 A;  2BHB A;  3CB5 A;  3PKB A;  3PKC A;  4FUK A;  1JAW A;  4KM3 A;  2OAZ A;  4MAT A;  3RVA A;  5JHU A;  4S2T P;  4A6W A;  1C27 A;  1XGO A;  4IKT A;  1MAT A;  2BN7 A;  4S00 A;  2BWS A;  2GZ5 A;  4U75 A;  1C22 A;  2G6P A;  3IU8 A;  2IW2 A;  4ZNG A;  5D6E A;  2GU6 A;  5FCH A;  2B3L A;  5CDV A;  1WKM A;  3Q6D A;  1WLR A;  1XGS A;  4IKS A;  2ADU A;  1QXZ A;  2GG8 A;  2GG9 A;  2GU5 A;  5CIK A;  1YW7 A;  1QXY A;  4U1B A;  5CDE A;  2GG3 A;  2DFI A;  4RGZ 1;  2GGC A;  4ZWP A;  2Q92 A;  2BHA A;  2V3X A;  4S01 A;  1YW8 A;  2BHC A;  2GA2 A;  2GTX A; 
#chains in the Genus database with same CATH topology
 4IEC A;  4R60 A;  4U6J A;  2GU7 A;  2GG2 A;  1C23 A;  1YW9 A;  2GG7 A;  2B3H A;  1R5G A;  4B28 A;  2GU4 A;  2OKN A;  3FMQ A;  3MAT A;  4IU6 A;  2Q96 A;  3PKE A;  4U71 A;  4FO8 A;  5D6F A;  2BWV A;  5FCF A;  4OOK A;  4QR8 A;  1A16 A;  2V3Y A;  5CE6 A;  4IDY A;  4RZZ A;  5CLS A;  5CNX A;  3IU9 A;  1BN5 A;  5JFR A;  3BIP A;  4U70 A;  3BIT A;  2BHD A;  4Z7M A;  4U73 A;  2EVM A;  1KP0 A;  4U76 A;  2GG0 A;  2NQ6 A;  2GGB A;  2BWW A;  1C21 A;  2EA2 A;  4JUQ A;  4RZY A;  4U6C A;  3S6B A;  2BWU A;  1XGN A;  2BWY A;  1WL9 A;  2ZSG A;  4IKR A;  4U6W A;  3FMR A;  4U6Z A;  4FLK A;  3ROR A;  4U6E A;  4FLJ A;  4PV4 A;  4IPA A;  5E5B A;  3IG4 A;  3FM3 A;  1YJ3 A;  1KQ0 A;  1Y1N A;  4ZWO A;  2Q8K A;  1YVM A;  1B6A A;  4U69 A;  3D27 A;  3CTZ A;  1PV9 A;  1XNZ A;  1WN1 A;  1QZY A;  2BWX A;  3PKA A;  4FKC A;  3MX6 A;  2P98 A;  3TB5 A;  1KQ9 A;  2MAT A;  2Q95 A;  4FLL A;  5CDL A;  1M35 A;  1QXW A;  4ZWU A;  3PKD A;  1W2M A;  1WBQ A;  4S2R P;  3CB6 A;  2Q94 A;  1BOA A;  4IF7 A;  2V6C A;  2V3Z A;  4IKU A;  1N51 A;  2BWT A;  3BIQ A;  2BB7 A;  2BH3 A;  2HOW A;  3MR1 A;  2EVO A;  2P99 A;  2P9A A;  1R5H A;  4PNC A;  1R58 A;  4FO7 A;  1CHM A;  5JI6 A;  2Q93 A;  1WL6 A;  3TAV A;  4EGE A;  2EA4 A;  1W7V A;  1XGM A;  3L7G A;  1O0X A;  1B59 A;  2NQ7 A;  2EVC A;  3L24 A;  4HXX A;  1C24 A;  3IU7 A;  4FLI A;  2B3K A;  4A6V A;  1WY2 A;  2GG5 A;  2BHB A;  3CB5 A;  3PKB A;  3PKC A;  4FUK A;  1JAW A;  4KM3 A;  2OAZ A;  4MAT A;  3RVA A;  5JHU A;  4S2T P;  4A6W A;  1C27 A;  1XGO A;  4IKT A;  1MAT A;  2BN7 A;  4S00 A;  2BWS A;  2GZ5 A;  4U75 A;  1C22 A;  2G6P A;  3IU8 A;  2IW2 A;  4ZNG A;  5D6E A;  2GU6 A;  5FCH A;  2B3L A;  5CDV A;  1WKM A;  3Q6D A;  1WLR A;  1XGS A;  4IKS A;  2ADU A;  1QXZ A;  2GG8 A;  2GG9 A;  2GU5 A;  5CIK A;  1YW7 A;  1QXY A;  4U1B A;  5CDE A;  2GG3 A;  2DFI A;  4RGZ 1;  2GGC A;  4ZWP A;  2Q92 A;  2BHA A;  2V3X A;  4S01 A;  1YW8 A;  2BHC A;  2GA2 A;  2GTX A; 
#chains in the Genus database with same CATH homology
 4IEC A;  4R60 A;  4U6J A;  2GU7 A;  2GG2 A;  1C23 A;  1YW9 A;  2GG7 A;  2B3H A;  1R5G A;  4B28 A;  2GU4 A;  2OKN A;  3FMQ A;  3MAT A;  4IU6 A;  2Q96 A;  3PKE A;  4U71 A;  4FO8 A;  5D6F A;  2BWV A;  5FCF A;  4OOK A;  4QR8 A;  1A16 A;  2V3Y A;  5CE6 A;  4IDY A;  4RZZ A;  5CLS A;  5CNX A;  3IU9 A;  1BN5 A;  5JFR A;  3BIP A;  4U70 A;  3BIT A;  2BHD A;  4Z7M A;  4U73 A;  2EVM A;  1KP0 A;  4U76 A;  2GG0 A;  2NQ6 A;  2GGB A;  2BWW A;  1C21 A;  2EA2 A;  4JUQ A;  4RZY A;  4U6C A;  3S6B A;  2BWU A;  1XGN A;  2BWY A;  1WL9 A;  2ZSG A;  4IKR A;  4U6W A;  3FMR A;  4U6Z A;  4FLK A;  3ROR A;  4U6E A;  4FLJ A;  4PV4 A;  4IPA A;  5E5B A;  3IG4 A;  3FM3 A;  1YJ3 A;  1KQ0 A;  1Y1N A;  4ZWO A;  2Q8K A;  1YVM A;  1B6A A;  4U69 A;  3D27 A;  3CTZ A;  1PV9 A;  1XNZ A;  1WN1 A;  1QZY A;  2BWX A;  3PKA A;  4FKC A;  3MX6 A;  2P98 A;  3TB5 A;  1KQ9 A;  2MAT A;  2Q95 A;  4FLL A;  5CDL A;  1M35 A;  1QXW A;  4ZWU A;  3PKD A;  1W2M A;  1WBQ A;  4S2R P;  3CB6 A;  2Q94 A;  1BOA A;  4IF7 A;  2V6C A;  2V3Z A;  4IKU A;  1N51 A;  2BWT A;  3BIQ A;  2BB7 A;  2BH3 A;  2HOW A;  3MR1 A;  2EVO A;  2P99 A;  2P9A A;  1R5H A;  4PNC A;  1R58 A;  4FO7 A;  1CHM A;  5JI6 A;  2Q93 A;  1WL6 A;  3TAV A;  4EGE A;  2EA4 A;  1W7V A;  1XGM A;  3L7G A;  1O0X A;  1B59 A;  2NQ7 A;  2EVC A;  3L24 A;  4HXX A;  1C24 A;  3IU7 A;  4FLI A;  2B3K A;  4A6V A;  1WY2 A;  2GG5 A;  2BHB A;  3CB5 A;  3PKB A;  3PKC A;  4FUK A;  1JAW A;  4KM3 A;  2OAZ A;  4MAT A;  3RVA A;  5JHU A;  4S2T P;  4A6W A;  1C27 A;  1XGO A;  4IKT A;  1MAT A;  2BN7 A;  4S00 A;  2BWS A;  2GZ5 A;  4U75 A;  1C22 A;  2G6P A;  3IU8 A;  2IW2 A;  4ZNG A;  5D6E A;  2GU6 A;  5FCH A;  2B3L A;  5CDV A;  1WKM A;  3Q6D A;  1WLR A;  1XGS A;  4IKS A;  2ADU A;  1QXZ A;  2GG8 A;  2GG9 A;  2GU5 A;  5CIK A;  1YW7 A;  1QXY A;  4U1B A;  5CDE A;  2GG3 A;  2DFI A;  4RGZ 1;  2GGC A;  4ZWP A;  2Q92 A;  2BHA A;  2V3X A;  4S01 A;  1YW8 A;  2BHC A;  2GA2 A;  2GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...