2Q92A

E. coli methionine aminopeptidase mn-form with inhibitor b23
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q92A00
2GA2A 5CNXA 1WN1A 4U76A 4FKCA 1C27A 4HXXA 3FMQA 1KQ9A 2Q95A 3RVAA 1N51A 4FLIA 1WLRA 1Y1NA 4QR8A 3FM3A 4S00A 3PKBA 4S2RP 1BOAA 4Z7MA 1YW7A 2EA4A 2BHCA 1QXWA 2GZ5A 4KM3A 2ADUA 4IKTA 4B28A 2GG3A 2BWTA 2V3ZA 2HOWA 1YW9A 1A16A 5FCHA 2ZSGA 4FLJA 2GG8A 4IDYA 2GU4A 1C23A 3IG4A 2B3KA 4ZNGA 2Q8KA 4JUQA 3FMRA 1JAWA 1YW8A 1CHMA 3MATA 2GG2A 4IKRA 2Q94A 2V3YA 4PNCA 3D27A 1PV9A 1R58A 2Q96A 3BIQA 2BHAA 2Q93A 2EVOA 2NQ7A 1B59A 2OKNA 2GTXA 3CTZA 2GG0A 1C22A 1YVMA 3PKDA 1C21A 4FLKA 5CDEA 4S01A 3TB5A 4U6CA 4FUKA 4R60A 3MX6A 1WKMA 2GGBA 2GG5A 1B6AA 4U69A 1R5HA 3CB6A 3MR1A 3PKCA 5CDLA 1XGMA 4OOKA 5JHUA 5CDVA 3PKEA 1O0XA 2NQ6A 4FLLA 3IU8A 1M35A 1KP0A 4A6WA 2GG9A 1QZYA 2BB7A 4IKSA 1KQ0A 4RGZ1 1WBQA 2DFIA 2BWVA 5FCFA 2GU5A 2P9AA 2IW2A 2B3HA 3CB5A 5D6EA 5CLSA 3L24A 4IECA 2V6CA 4U1BA 4U6ZA 1WY2A 4MATA 5JFRA 4RZYA 1YJ3A 4RZZA 4PV4A 4IF7A 3RORA 1MATA 2BN7A 2BWYA 4U75A 1QXZA 3S6BA 3PKAA 1C24A 2BWUA 5CIKA 1BN5A 4U6JA 2GGCA 3BIPA 4IPAA 2GU7A 1W2MA 1XGSA 2Q92A 1R5GA 1XGNA 2EVCA 4FO7A 4ZWOA 3TAVA 4U70A 2OAZA 2BHBA 5JI6A 4S2TP 2BWSA 2GU6A 5CE6A 4IKUA 1XNZA 3Q6DA 2MATA 3IU7A 4U71A 4ZWPA 3IU9A 2BWXA 2P98A 4FO8A 2BHDA 4A6VA 4U6EA 1QXYA 1XGOA 3L7GA 5E5BA 2BH3A 4U6WA 5D6FA 2EVMA 2GG7A 2V3XA 2BWWA 2B3LA 2P99A 4EGEA 4U73A 1W7VA 1WL6A 4IU6A 2G6PA 3BITA 4ZWUA 2EA2A 1WL9A
chains in the Genus database with same CATH superfamily
2GA2A 5CNXA 1WN1A 4U76A 4FKCA 1C27A 4HXXA 3FMQA 1KQ9A 2Q95A 3RVAA 1N51A 4FLIA 1WLRA 1Y1NA 4QR8A 3FM3A 4S00A 3PKBA 4S2RP 1BOAA 4Z7MA 1YW7A 2EA4A 2BHCA 1QXWA 2GZ5A 4KM3A 2ADUA 4IKTA 4B28A 2GG3A 2BWTA 2V3ZA 2HOWA 1YW9A 1A16A 5FCHA 2ZSGA 4FLJA 2GG8A 4IDYA 2GU4A 1C23A 3IG4A 2B3KA 4ZNGA 2Q8KA 4JUQA 3FMRA 1JAWA 1YW8A 1CHMA 3MATA 2GG2A 4IKRA 2Q94A 2V3YA 4PNCA 3D27A 1PV9A 1R58A 2Q96A 3BIQA 2BHAA 2Q93A 2EVOA 2NQ7A 1B59A 2OKNA 2GTXA 3CTZA 2GG0A 1C22A 1YVMA 3PKDA 1C21A 4FLKA 5CDEA 4S01A 3TB5A 4U6CA 4FUKA 4R60A 3MX6A 1WKMA 2GGBA 2GG5A 1B6AA 4U69A 1R5HA 3CB6A 3MR1A 3PKCA 5CDLA 1XGMA 4OOKA 5JHUA 5CDVA 3PKEA 1O0XA 2NQ6A 4FLLA 3IU8A 1M35A 1KP0A 4A6WA 2GG9A 1QZYA 2BB7A 4IKSA 1KQ0A 4RGZ1 1WBQA 2DFIA 2BWVA 5FCFA 2GU5A 2P9AA 2IW2A 2B3HA 3CB5A 5D6EA 5CLSA 3L24A 4IECA 2V6CA 4U1BA 4U6ZA 1WY2A 4MATA 5JFRA 4RZYA 1YJ3A 4RZZA 4PV4A 4IF7A 3RORA 1MATA 2BN7A 2BWYA 4U75A 1QXZA 3S6BA 3PKAA 1C24A 2BWUA 5CIKA 1BN5A 4U6JA 2GGCA 3BIPA 4IPAA 2GU7A 1W2MA 1XGSA 2Q92A 1R5GA 1XGNA 2EVCA 4FO7A 4ZWOA 3TAVA 4U70A 2OAZA 2BHBA 5JI6A 4S2TP 2BWSA 2GU6A 5CE6A 4IKUA 1XNZA 3Q6DA 2MATA 3IU7A 4U71A 4ZWPA 3IU9A 2BWXA 2P98A 4FO8A 2BHDA 4A6VA 4U6EA 1QXYA 1XGOA 3L7GA 5E5BA 2BH3A 4U6WA 5D6FA 2EVMA 2GG7A 2V3XA 2BWWA 2B3LA 2P99A 4EGEA 4U73A 1W7VA 1WL6A 4IU6A 2G6PA 3BITA 4ZWUA 2EA2A 1WL9A
chains in the Genus database with same CATH topology
2GA2A 5CNXA 1WN1A 4U76A 4FKCA 1C27A 4HXXA 3FMQA 1KQ9A 2Q95A 3RVAA 1N51A 4FLIA 1WLRA 1Y1NA 4QR8A 3FM3A 4S00A 3PKBA 4S2RP 1BOAA 4Z7MA 1YW7A 2EA4A 2BHCA 1QXWA 2GZ5A 4KM3A 2ADUA 4IKTA 4B28A 2GG3A 2BWTA 2V3ZA 2HOWA 1YW9A 1A16A 5FCHA 2ZSGA 4FLJA 2GG8A 4IDYA 2GU4A 1C23A 3IG4A 2B3KA 4ZNGA 2Q8KA 4JUQA 3FMRA 1JAWA 1YW8A 1CHMA 3MATA 2GG2A 4IKRA 2Q94A 2V3YA 4PNCA 3D27A 1PV9A 1R58A 2Q96A 3BIQA 2BHAA 2Q93A 2EVOA 2NQ7A 1B59A 2OKNA 2GTXA 3CTZA 2GG0A 1C22A 1YVMA 3PKDA 1C21A 4FLKA 5CDEA 4S01A 3TB5A 4U6CA 4FUKA 4R60A 3MX6A 1WKMA 2GGBA 2GG5A 1B6AA 4U69A 1R5HA 3CB6A 3MR1A 3PKCA 5CDLA 1XGMA 4OOKA 5JHUA 5CDVA 3PKEA 1O0XA 2NQ6A 4FLLA 3IU8A 1M35A 1KP0A 4A6WA 2GG9A 1QZYA 2BB7A 4IKSA 1KQ0A 4RGZ1 1WBQA 2DFIA 2BWVA 5FCFA 2GU5A 2P9AA 2IW2A 2B3HA 3CB5A 5D6EA 5CLSA 3L24A 4IECA 2V6CA 4U1BA 4U6ZA 1WY2A 4MATA 5JFRA 4RZYA 1YJ3A 4RZZA 4PV4A 4IF7A 3RORA 1MATA 2BN7A 2BWYA 4U75A 1QXZA 3S6BA 3PKAA 1C24A 2BWUA 5CIKA 1BN5A 4U6JA 2GGCA 3BIPA 4IPAA 2GU7A 1W2MA 1XGSA 2Q92A 1R5GA 1XGNA 2EVCA 4FO7A 4ZWOA 3TAVA 4U70A 2OAZA 2BHBA 5JI6A 4S2TP 2BWSA 2GU6A 5CE6A 4IKUA 1XNZA 3Q6DA 2MATA 3IU7A 4U71A 4ZWPA 3IU9A 2BWXA 2P98A 4FO8A 2BHDA 4A6VA 4U6EA 1QXYA 1XGOA 3L7GA 5E5BA 2BH3A 4U6WA 5D6FA 2EVMA 2GG7A 2V3XA 2BWWA 2B3LA 2P99A 4EGEA 4U73A 1W7VA 1WL6A 4IU6A 2G6PA 3BITA 4ZWUA 2EA2A 1WL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA2 A;  5CNX A;  1WN1 A;  4U76 A;  4FKC A;  1C27 A;  4HXX A;  3FMQ A;  1KQ9 A;  2Q95 A;  3RVA A;  1N51 A;  4FLI A;  1WLR A;  1Y1N A;  4QR8 A;  3FM3 A;  4S00 A;  3PKB A;  4S2R P;  1BOA A;  4Z7M A;  1YW7 A;  2EA4 A;  2BHC A;  1QXW A;  2GZ5 A;  4KM3 A;  2ADU A;  4IKT A;  4B28 A;  2GG3 A;  2BWT A;  2V3Z A;  2HOW A;  1YW9 A;  1A16 A;  5FCH A;  2ZSG A;  4FLJ A;  2GG8 A;  4IDY A;  2GU4 A;  1C23 A;  3IG4 A;  2B3K A;  4ZNG A;  2Q8K A;  4JUQ A;  3FMR A;  1JAW A;  1YW8 A;  1CHM A;  3MAT A;  2GG2 A;  4IKR A;  2Q94 A;  2V3Y A;  4PNC A;  3D27 A;  1PV9 A;  1R58 A;  2Q96 A;  3BIQ A;  2BHA A;  2Q93 A;  2EVO A;  2NQ7 A;  1B59 A;  2OKN A;  2GTX A;  3CTZ A;  2GG0 A;  1C22 A;  1YVM A;  3PKD A;  1C21 A;  4FLK A;  5CDE A;  4S01 A;  3TB5 A;  4U6C A;  4FUK A;  4R60 A;  3MX6 A;  1WKM A;  2GGB A;  2GG5 A;  1B6A A;  4U69 A;  1R5H A;  3CB6 A;  3MR1 A;  3PKC A;  5CDL A;  1XGM A;  4OOK A;  5JHU A;  5CDV A;  3PKE A;  1O0X A;  2NQ6 A;  4FLL A;  3IU8 A;  1M35 A;  1KP0 A;  4A6W A;  2GG9 A;  1QZY A;  2BB7 A;  4IKS A;  1KQ0 A;  4RGZ 1;  1WBQ A;  2DFI A;  2BWV A;  5FCF A;  2GU5 A;  2P9A A;  2IW2 A;  2B3H A;  3CB5 A;  5D6E A;  5CLS A;  3L24 A;  4IEC A;  2V6C A;  4U1B A;  4U6Z A;  1WY2 A;  4MAT A;  5JFR A;  4RZY A;  1YJ3 A;  4RZZ A;  4PV4 A;  4IF7 A;  3ROR A;  1MAT A;  2BN7 A;  2BWY A;  4U75 A;  1QXZ A;  3S6B A;  3PKA A;  1C24 A;  2BWU A;  5CIK A;  1BN5 A;  4U6J A;  2GGC A;  3BIP A;  4IPA A;  2GU7 A;  1W2M A;  1XGS A;  2Q92 A;  1R5G A;  1XGN A;  2EVC A;  4FO7 A;  4ZWO A;  3TAV A;  4U70 A;  2OAZ A;  2BHB A;  5JI6 A;  4S2T P;  2BWS A;  2GU6 A;  5CE6 A;  4IKU A;  1XNZ A;  3Q6D A;  2MAT A;  3IU7 A;  4U71 A;  4ZWP A;  3IU9 A;  2BWX A;  2P98 A;  4FO8 A;  2BHD A;  4A6V A;  4U6E A;  1QXY A;  1XGO A;  3L7G A;  5E5B A;  2BH3 A;  4U6W A;  5D6F A;  2EVM A;  2GG7 A;  2V3X A;  2BWW A;  2B3L A;  2P99 A;  4EGE A;  4U73 A;  1W7V A;  1WL6 A;  4IU6 A;  2G6P A;  3BIT A;  4ZWU A;  2EA2 A;  1WL9 A; 
#chains in the Genus database with same CATH topology
 2GA2 A;  5CNX A;  1WN1 A;  4U76 A;  4FKC A;  1C27 A;  4HXX A;  3FMQ A;  1KQ9 A;  2Q95 A;  3RVA A;  1N51 A;  4FLI A;  1WLR A;  1Y1N A;  4QR8 A;  3FM3 A;  4S00 A;  3PKB A;  4S2R P;  1BOA A;  4Z7M A;  1YW7 A;  2EA4 A;  2BHC A;  1QXW A;  2GZ5 A;  4KM3 A;  2ADU A;  4IKT A;  4B28 A;  2GG3 A;  2BWT A;  2V3Z A;  2HOW A;  1YW9 A;  1A16 A;  5FCH A;  2ZSG A;  4FLJ A;  2GG8 A;  4IDY A;  2GU4 A;  1C23 A;  3IG4 A;  2B3K A;  4ZNG A;  2Q8K A;  4JUQ A;  3FMR A;  1JAW A;  1YW8 A;  1CHM A;  3MAT A;  2GG2 A;  4IKR A;  2Q94 A;  2V3Y A;  4PNC A;  3D27 A;  1PV9 A;  1R58 A;  2Q96 A;  3BIQ A;  2BHA A;  2Q93 A;  2EVO A;  2NQ7 A;  1B59 A;  2OKN A;  2GTX A;  3CTZ A;  2GG0 A;  1C22 A;  1YVM A;  3PKD A;  1C21 A;  4FLK A;  5CDE A;  4S01 A;  3TB5 A;  4U6C A;  4FUK A;  4R60 A;  3MX6 A;  1WKM A;  2GGB A;  2GG5 A;  1B6A A;  4U69 A;  1R5H A;  3CB6 A;  3MR1 A;  3PKC A;  5CDL A;  1XGM A;  4OOK A;  5JHU A;  5CDV A;  3PKE A;  1O0X A;  2NQ6 A;  4FLL A;  3IU8 A;  1M35 A;  1KP0 A;  4A6W A;  2GG9 A;  1QZY A;  2BB7 A;  4IKS A;  1KQ0 A;  4RGZ 1;  1WBQ A;  2DFI A;  2BWV A;  5FCF A;  2GU5 A;  2P9A A;  2IW2 A;  2B3H A;  3CB5 A;  5D6E A;  5CLS A;  3L24 A;  4IEC A;  2V6C A;  4U1B A;  4U6Z A;  1WY2 A;  4MAT A;  5JFR A;  4RZY A;  1YJ3 A;  4RZZ A;  4PV4 A;  4IF7 A;  3ROR A;  1MAT A;  2BN7 A;  2BWY A;  4U75 A;  1QXZ A;  3S6B A;  3PKA A;  1C24 A;  2BWU A;  5CIK A;  1BN5 A;  4U6J A;  2GGC A;  3BIP A;  4IPA A;  2GU7 A;  1W2M A;  1XGS A;  2Q92 A;  1R5G A;  1XGN A;  2EVC A;  4FO7 A;  4ZWO A;  3TAV A;  4U70 A;  2OAZ A;  2BHB A;  5JI6 A;  4S2T P;  2BWS A;  2GU6 A;  5CE6 A;  4IKU A;  1XNZ A;  3Q6D A;  2MAT A;  3IU7 A;  4U71 A;  4ZWP A;  3IU9 A;  2BWX A;  2P98 A;  4FO8 A;  2BHD A;  4A6V A;  4U6E A;  1QXY A;  1XGO A;  3L7G A;  5E5B A;  2BH3 A;  4U6W A;  5D6F A;  2EVM A;  2GG7 A;  2V3X A;  2BWW A;  2B3L A;  2P99 A;  4EGE A;  4U73 A;  1W7V A;  1WL6 A;  4IU6 A;  2G6P A;  3BIT A;  4ZWU A;  2EA2 A;  1WL9 A; 
#chains in the Genus database with same CATH homology
 2GA2 A;  5CNX A;  1WN1 A;  4U76 A;  4FKC A;  1C27 A;  4HXX A;  3FMQ A;  1KQ9 A;  2Q95 A;  3RVA A;  1N51 A;  4FLI A;  1WLR A;  1Y1N A;  4QR8 A;  3FM3 A;  4S00 A;  3PKB A;  4S2R P;  1BOA A;  4Z7M A;  1YW7 A;  2EA4 A;  2BHC A;  1QXW A;  2GZ5 A;  4KM3 A;  2ADU A;  4IKT A;  4B28 A;  2GG3 A;  2BWT A;  2V3Z A;  2HOW A;  1YW9 A;  1A16 A;  5FCH A;  2ZSG A;  4FLJ A;  2GG8 A;  4IDY A;  2GU4 A;  1C23 A;  3IG4 A;  2B3K A;  4ZNG A;  2Q8K A;  4JUQ A;  3FMR A;  1JAW A;  1YW8 A;  1CHM A;  3MAT A;  2GG2 A;  4IKR A;  2Q94 A;  2V3Y A;  4PNC A;  3D27 A;  1PV9 A;  1R58 A;  2Q96 A;  3BIQ A;  2BHA A;  2Q93 A;  2EVO A;  2NQ7 A;  1B59 A;  2OKN A;  2GTX A;  3CTZ A;  2GG0 A;  1C22 A;  1YVM A;  3PKD A;  1C21 A;  4FLK A;  5CDE A;  4S01 A;  3TB5 A;  4U6C A;  4FUK A;  4R60 A;  3MX6 A;  1WKM A;  2GGB A;  2GG5 A;  1B6A A;  4U69 A;  1R5H A;  3CB6 A;  3MR1 A;  3PKC A;  5CDL A;  1XGM A;  4OOK A;  5JHU A;  5CDV A;  3PKE A;  1O0X A;  2NQ6 A;  4FLL A;  3IU8 A;  1M35 A;  1KP0 A;  4A6W A;  2GG9 A;  1QZY A;  2BB7 A;  4IKS A;  1KQ0 A;  4RGZ 1;  1WBQ A;  2DFI A;  2BWV A;  5FCF A;  2GU5 A;  2P9A A;  2IW2 A;  2B3H A;  3CB5 A;  5D6E A;  5CLS A;  3L24 A;  4IEC A;  2V6C A;  4U1B A;  4U6Z A;  1WY2 A;  4MAT A;  5JFR A;  4RZY A;  1YJ3 A;  4RZZ A;  4PV4 A;  4IF7 A;  3ROR A;  1MAT A;  2BN7 A;  2BWY A;  4U75 A;  1QXZ A;  3S6B A;  3PKA A;  1C24 A;  2BWU A;  5CIK A;  1BN5 A;  4U6J A;  2GGC A;  3BIP A;  4IPA A;  2GU7 A;  1W2M A;  1XGS A;  2Q92 A;  1R5G A;  1XGN A;  2EVC A;  4FO7 A;  4ZWO A;  3TAV A;  4U70 A;  2OAZ A;  2BHB A;  5JI6 A;  4S2T P;  2BWS A;  2GU6 A;  5CE6 A;  4IKU A;  1XNZ A;  3Q6D A;  2MAT A;  3IU7 A;  4U71 A;  4ZWP A;  3IU9 A;  2BWX A;  2P98 A;  4FO8 A;  2BHD A;  4A6V A;  4U6E A;  1QXY A;  1XGO A;  3L7G A;  5E5B A;  2BH3 A;  4U6W A;  5D6F A;  2EVM A;  2GG7 A;  2V3X A;  2BWW A;  2B3L A;  2P99 A;  4EGE A;  4U73 A;  1W7V A;  1WL6 A;  4IU6 A;  2G6P A;  3BIT A;  4ZWU A;  2EA2 A;  1WL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...