2Q92A

E. coli methionine aminopeptidase mn-form with inhibitor b23
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q92A00
4U71A 4FO8A 2GA2A 1BOAA 3FM3A 1CHMA 1KP0A 3TB5A 2EVOA 2BWXA 4S01A 2P98A 2Q8KA 1KQ0A 3S6BA 2GTXA 1B59A 1YJ3A 4B28A 3IU9A 4FLJA 1W2MA 1W7VA 1QXYA 4FUKA 2BHAA 2BB7A 4FLLA 4IKUA 2BWWA 2GG0A 2GG5A 4QR8A 2EVCA 2V3ZA 2P9AA 3MR1A 4ZWPA 4IDYA 2GZ5A 2GG8A 2DFIA 2Q95A 2OKNA 4U69A 2V6CA 1BN5A 4U75A 4ZWUA 1R5GA 1YW9A 2IW2A 2V3XA 4U73A 4IKSA 1YW8A 3RORA 1KQ9A 3PKEA 3CTZA 5CIKA 3FMQA 4MATA 2OAZA 1QZYA 1WL9A 2Q92A 3PKDA 2GG2A 4U6CA 1C23A 1R5HA 4S2RP 2GU4A 2BN7A 5CE6A 4JUQA 3CB5A 1YW7A 2BWYA 5D6FA 5JI6A 4ZNGA 4IECA 2BWUA 4IKTA 4S2TP 3Q6DA 2BHDA 1WL6A 4RZYA 4IKRA 1R58A 2EA4A 5CNXA 2GG7A 4A6WA 1C22A 2HOWA 3FMRA 2ZSGA 5CDEA 1QXWA 4Z7MA 1WBQA 2G6PA 1JAWA 1YVMA 1XGOA 3BITA 4EGEA 4OOKA 5D6EA 1XGNA 2Q94A 2Q93A 2P99A 3BIPA 4A6VA 1WY2A 2GGBA 4S00A 1WN1A 2GU6A 5CDVA 1PV9A 2BH3A 2B3KA 3TAVA 3MATA 2EA2A 1Y1NA 2GGCA 5FCFA 1QXZA 5E5BA 1N51A 2GG3A 5FCHA 2BHCA 1WKMA 1XNZA 1B6AA 4PNCA 1XGMA 3CB6A 5CDLA 1C27A 4HXXA 3PKCA 1O0XA 2MATA 3PKBA 4FO7A 2V3YA 2NQ7A 4KM3A 2ADUA 5JHUA 3D27A 3L7GA 4U76A 2BHBA 5JFRA 3PKAA 1MATA 4U70A 4FLKA 2BWSA 2NQ6A 4PV4A 4U1BA 5CLSA 2EVMA 2GU7A 4U6EA 3IU7A 4ZWOA 1C24A 1WLRA 4RZZA 4U6ZA 4IF7A 3IU8A 4U6JA 2BWVA 1M35A 2B3HA 3RVAA 1C21A 2GG9A 2Q96A 4RGZ1 3L24A 1A16A 2BWTA 3BIQA 4FLIA 4R60A 3IG4A 1XGSA 3MX6A 4IPAA 4IU6A 4U6WA 2B3LA 2GU5A 4FKCA
chains in the Genus database with same CATH superfamily
4U71A 4FO8A 2GA2A 1BOAA 3FM3A 1CHMA 1KP0A 3TB5A 2EVOA 2BWXA 4S01A 2P98A 2Q8KA 1KQ0A 3S6BA 2GTXA 1B59A 1YJ3A 4B28A 3IU9A 4FLJA 1W2MA 1W7VA 1QXYA 4FUKA 2BHAA 2BB7A 4FLLA 4IKUA 2BWWA 2GG0A 2GG5A 4QR8A 2EVCA 2V3ZA 2P9AA 3MR1A 4ZWPA 4IDYA 2GZ5A 2GG8A 2DFIA 2Q95A 2OKNA 4U69A 2V6CA 1BN5A 4U75A 4ZWUA 1R5GA 1YW9A 2IW2A 2V3XA 4U73A 4IKSA 1YW8A 3RORA 1KQ9A 3PKEA 3CTZA 5CIKA 3FMQA 4MATA 2OAZA 1QZYA 1WL9A 2Q92A 3PKDA 2GG2A 4U6CA 1C23A 1R5HA 4S2RP 2GU4A 2BN7A 5CE6A 4JUQA 3CB5A 1YW7A 2BWYA 5D6FA 5JI6A 4ZNGA 4IECA 2BWUA 4IKTA 4S2TP 3Q6DA 2BHDA 1WL6A 4RZYA 4IKRA 1R58A 2EA4A 5CNXA 2GG7A 4A6WA 1C22A 2HOWA 3FMRA 2ZSGA 5CDEA 1QXWA 4Z7MA 1WBQA 2G6PA 1JAWA 1YVMA 1XGOA 3BITA 4EGEA 4OOKA 5D6EA 1XGNA 2Q94A 2Q93A 2P99A 3BIPA 4A6VA 1WY2A 2GGBA 4S00A 1WN1A 2GU6A 5CDVA 1PV9A 2BH3A 2B3KA 3TAVA 3MATA 2EA2A 1Y1NA 2GGCA 5FCFA 1QXZA 5E5BA 1N51A 2GG3A 5FCHA 2BHCA 1WKMA 1XNZA 1B6AA 4PNCA 1XGMA 3CB6A 5CDLA 1C27A 4HXXA 3PKCA 1O0XA 2MATA 3PKBA 4FO7A 2V3YA 2NQ7A 4KM3A 2ADUA 5JHUA 3D27A 3L7GA 4U76A 2BHBA 5JFRA 3PKAA 1MATA 4U70A 4FLKA 2BWSA 2NQ6A 4PV4A 4U1BA 5CLSA 2EVMA 2GU7A 4U6EA 3IU7A 4ZWOA 1C24A 1WLRA 4RZZA 4U6ZA 4IF7A 3IU8A 4U6JA 2BWVA 1M35A 2B3HA 3RVAA 1C21A 2GG9A 2Q96A 4RGZ1 3L24A 1A16A 2BWTA 3BIQA 4FLIA 4R60A 3IG4A 1XGSA 3MX6A 4IPAA 4IU6A 4U6WA 2B3LA 2GU5A 4FKCA
chains in the Genus database with same CATH topology
4U71A 4FO8A 2GA2A 1BOAA 3FM3A 1CHMA 1KP0A 3TB5A 2EVOA 2BWXA 4S01A 2P98A 2Q8KA 1KQ0A 3S6BA 2GTXA 1B59A 1YJ3A 4B28A 3IU9A 4FLJA 1W2MA 1W7VA 1QXYA 4FUKA 2BHAA 2BB7A 4FLLA 4IKUA 2BWWA 2GG0A 2GG5A 4QR8A 2EVCA 2V3ZA 2P9AA 3MR1A 4ZWPA 4IDYA 2GZ5A 2GG8A 2DFIA 2Q95A 2OKNA 4U69A 2V6CA 1BN5A 4U75A 4ZWUA 1R5GA 1YW9A 2IW2A 2V3XA 4U73A 4IKSA 1YW8A 3RORA 1KQ9A 3PKEA 3CTZA 5CIKA 3FMQA 4MATA 2OAZA 1QZYA 1WL9A 2Q92A 3PKDA 2GG2A 4U6CA 1C23A 1R5HA 4S2RP 2GU4A 2BN7A 5CE6A 4JUQA 3CB5A 1YW7A 2BWYA 5D6FA 5JI6A 4ZNGA 4IECA 2BWUA 4IKTA 4S2TP 3Q6DA 2BHDA 1WL6A 4RZYA 4IKRA 1R58A 2EA4A 5CNXA 2GG7A 4A6WA 1C22A 2HOWA 3FMRA 2ZSGA 5CDEA 1QXWA 4Z7MA 1WBQA 2G6PA 1JAWA 1YVMA 1XGOA 3BITA 4EGEA 4OOKA 5D6EA 1XGNA 2Q94A 2Q93A 2P99A 3BIPA 4A6VA 1WY2A 2GGBA 4S00A 1WN1A 2GU6A 5CDVA 1PV9A 2BH3A 2B3KA 3TAVA 3MATA 2EA2A 1Y1NA 2GGCA 5FCFA 1QXZA 5E5BA 1N51A 2GG3A 5FCHA 2BHCA 1WKMA 1XNZA 1B6AA 4PNCA 1XGMA 3CB6A 5CDLA 1C27A 4HXXA 3PKCA 1O0XA 2MATA 3PKBA 4FO7A 2V3YA 2NQ7A 4KM3A 2ADUA 5JHUA 3D27A 3L7GA 4U76A 2BHBA 5JFRA 3PKAA 1MATA 4U70A 4FLKA 2BWSA 2NQ6A 4PV4A 4U1BA 5CLSA 2EVMA 2GU7A 4U6EA 3IU7A 4ZWOA 1C24A 1WLRA 4RZZA 4U6ZA 4IF7A 3IU8A 4U6JA 2BWVA 1M35A 2B3HA 3RVAA 1C21A 2GG9A 2Q96A 4RGZ1 3L24A 1A16A 2BWTA 3BIQA 4FLIA 4R60A 3IG4A 1XGSA 3MX6A 4IPAA 4IU6A 4U6WA 2B3LA 2GU5A 4FKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U71 A;  4FO8 A;  2GA2 A;  1BOA A;  3FM3 A;  1CHM A;  1KP0 A;  3TB5 A;  2EVO A;  2BWX A;  4S01 A;  2P98 A;  2Q8K A;  1KQ0 A;  3S6B A;  2GTX A;  1B59 A;  1YJ3 A;  4B28 A;  3IU9 A;  4FLJ A;  1W2M A;  1W7V A;  1QXY A;  4FUK A;  2BHA A;  2BB7 A;  4FLL A;  4IKU A;  2BWW A;  2GG0 A;  2GG5 A;  4QR8 A;  2EVC A;  2V3Z A;  2P9A A;  3MR1 A;  4ZWP A;  4IDY A;  2GZ5 A;  2GG8 A;  2DFI A;  2Q95 A;  2OKN A;  4U69 A;  2V6C A;  1BN5 A;  4U75 A;  4ZWU A;  1R5G A;  1YW9 A;  2IW2 A;  2V3X A;  4U73 A;  4IKS A;  1YW8 A;  3ROR A;  1KQ9 A;  3PKE A;  3CTZ A;  5CIK A;  3FMQ A;  4MAT A;  2OAZ A;  1QZY A;  1WL9 A;  2Q92 A;  3PKD A;  2GG2 A;  4U6C A;  1C23 A;  1R5H A;  4S2R P;  2GU4 A;  2BN7 A;  5CE6 A;  4JUQ A;  3CB5 A;  1YW7 A;  2BWY A;  5D6F A;  5JI6 A;  4ZNG A;  4IEC A;  2BWU A;  4IKT A;  4S2T P;  3Q6D A;  2BHD A;  1WL6 A;  4RZY A;  4IKR A;  1R58 A;  2EA4 A;  5CNX A;  2GG7 A;  4A6W A;  1C22 A;  2HOW A;  3FMR A;  2ZSG A;  5CDE A;  1QXW A;  4Z7M A;  1WBQ A;  2G6P A;  1JAW A;  1YVM A;  1XGO A;  3BIT A;  4EGE A;  4OOK A;  5D6E A;  1XGN A;  2Q94 A;  2Q93 A;  2P99 A;  3BIP A;  4A6V A;  1WY2 A;  2GGB A;  4S00 A;  1WN1 A;  2GU6 A;  5CDV A;  1PV9 A;  2BH3 A;  2B3K A;  3TAV A;  3MAT A;  2EA2 A;  1Y1N A;  2GGC A;  5FCF A;  1QXZ A;  5E5B A;  1N51 A;  2GG3 A;  5FCH A;  2BHC A;  1WKM A;  1XNZ A;  1B6A A;  4PNC A;  1XGM A;  3CB6 A;  5CDL A;  1C27 A;  4HXX A;  3PKC A;  1O0X A;  2MAT A;  3PKB A;  4FO7 A;  2V3Y A;  2NQ7 A;  4KM3 A;  2ADU A;  5JHU A;  3D27 A;  3L7G A;  4U76 A;  2BHB A;  5JFR A;  3PKA A;  1MAT A;  4U70 A;  4FLK A;  2BWS A;  2NQ6 A;  4PV4 A;  4U1B A;  5CLS A;  2EVM A;  2GU7 A;  4U6E A;  3IU7 A;  4ZWO A;  1C24 A;  1WLR A;  4RZZ A;  4U6Z A;  4IF7 A;  3IU8 A;  4U6J A;  2BWV A;  1M35 A;  2B3H A;  3RVA A;  1C21 A;  2GG9 A;  2Q96 A;  4RGZ 1;  3L24 A;  1A16 A;  2BWT A;  3BIQ A;  4FLI A;  4R60 A;  3IG4 A;  1XGS A;  3MX6 A;  4IPA A;  4IU6 A;  4U6W A;  2B3L A;  2GU5 A;  4FKC A; 
#chains in the Genus database with same CATH topology
 4U71 A;  4FO8 A;  2GA2 A;  1BOA A;  3FM3 A;  1CHM A;  1KP0 A;  3TB5 A;  2EVO A;  2BWX A;  4S01 A;  2P98 A;  2Q8K A;  1KQ0 A;  3S6B A;  2GTX A;  1B59 A;  1YJ3 A;  4B28 A;  3IU9 A;  4FLJ A;  1W2M A;  1W7V A;  1QXY A;  4FUK A;  2BHA A;  2BB7 A;  4FLL A;  4IKU A;  2BWW A;  2GG0 A;  2GG5 A;  4QR8 A;  2EVC A;  2V3Z A;  2P9A A;  3MR1 A;  4ZWP A;  4IDY A;  2GZ5 A;  2GG8 A;  2DFI A;  2Q95 A;  2OKN A;  4U69 A;  2V6C A;  1BN5 A;  4U75 A;  4ZWU A;  1R5G A;  1YW9 A;  2IW2 A;  2V3X A;  4U73 A;  4IKS A;  1YW8 A;  3ROR A;  1KQ9 A;  3PKE A;  3CTZ A;  5CIK A;  3FMQ A;  4MAT A;  2OAZ A;  1QZY A;  1WL9 A;  2Q92 A;  3PKD A;  2GG2 A;  4U6C A;  1C23 A;  1R5H A;  4S2R P;  2GU4 A;  2BN7 A;  5CE6 A;  4JUQ A;  3CB5 A;  1YW7 A;  2BWY A;  5D6F A;  5JI6 A;  4ZNG A;  4IEC A;  2BWU A;  4IKT A;  4S2T P;  3Q6D A;  2BHD A;  1WL6 A;  4RZY A;  4IKR A;  1R58 A;  2EA4 A;  5CNX A;  2GG7 A;  4A6W A;  1C22 A;  2HOW A;  3FMR A;  2ZSG A;  5CDE A;  1QXW A;  4Z7M A;  1WBQ A;  2G6P A;  1JAW A;  1YVM A;  1XGO A;  3BIT A;  4EGE A;  4OOK A;  5D6E A;  1XGN A;  2Q94 A;  2Q93 A;  2P99 A;  3BIP A;  4A6V A;  1WY2 A;  2GGB A;  4S00 A;  1WN1 A;  2GU6 A;  5CDV A;  1PV9 A;  2BH3 A;  2B3K A;  3TAV A;  3MAT A;  2EA2 A;  1Y1N A;  2GGC A;  5FCF A;  1QXZ A;  5E5B A;  1N51 A;  2GG3 A;  5FCH A;  2BHC A;  1WKM A;  1XNZ A;  1B6A A;  4PNC A;  1XGM A;  3CB6 A;  5CDL A;  1C27 A;  4HXX A;  3PKC A;  1O0X A;  2MAT A;  3PKB A;  4FO7 A;  2V3Y A;  2NQ7 A;  4KM3 A;  2ADU A;  5JHU A;  3D27 A;  3L7G A;  4U76 A;  2BHB A;  5JFR A;  3PKA A;  1MAT A;  4U70 A;  4FLK A;  2BWS A;  2NQ6 A;  4PV4 A;  4U1B A;  5CLS A;  2EVM A;  2GU7 A;  4U6E A;  3IU7 A;  4ZWO A;  1C24 A;  1WLR A;  4RZZ A;  4U6Z A;  4IF7 A;  3IU8 A;  4U6J A;  2BWV A;  1M35 A;  2B3H A;  3RVA A;  1C21 A;  2GG9 A;  2Q96 A;  4RGZ 1;  3L24 A;  1A16 A;  2BWT A;  3BIQ A;  4FLI A;  4R60 A;  3IG4 A;  1XGS A;  3MX6 A;  4IPA A;  4IU6 A;  4U6W A;  2B3L A;  2GU5 A;  4FKC A; 
#chains in the Genus database with same CATH homology
 4U71 A;  4FO8 A;  2GA2 A;  1BOA A;  3FM3 A;  1CHM A;  1KP0 A;  3TB5 A;  2EVO A;  2BWX A;  4S01 A;  2P98 A;  2Q8K A;  1KQ0 A;  3S6B A;  2GTX A;  1B59 A;  1YJ3 A;  4B28 A;  3IU9 A;  4FLJ A;  1W2M A;  1W7V A;  1QXY A;  4FUK A;  2BHA A;  2BB7 A;  4FLL A;  4IKU A;  2BWW A;  2GG0 A;  2GG5 A;  4QR8 A;  2EVC A;  2V3Z A;  2P9A A;  3MR1 A;  4ZWP A;  4IDY A;  2GZ5 A;  2GG8 A;  2DFI A;  2Q95 A;  2OKN A;  4U69 A;  2V6C A;  1BN5 A;  4U75 A;  4ZWU A;  1R5G A;  1YW9 A;  2IW2 A;  2V3X A;  4U73 A;  4IKS A;  1YW8 A;  3ROR A;  1KQ9 A;  3PKE A;  3CTZ A;  5CIK A;  3FMQ A;  4MAT A;  2OAZ A;  1QZY A;  1WL9 A;  2Q92 A;  3PKD A;  2GG2 A;  4U6C A;  1C23 A;  1R5H A;  4S2R P;  2GU4 A;  2BN7 A;  5CE6 A;  4JUQ A;  3CB5 A;  1YW7 A;  2BWY A;  5D6F A;  5JI6 A;  4ZNG A;  4IEC A;  2BWU A;  4IKT A;  4S2T P;  3Q6D A;  2BHD A;  1WL6 A;  4RZY A;  4IKR A;  1R58 A;  2EA4 A;  5CNX A;  2GG7 A;  4A6W A;  1C22 A;  2HOW A;  3FMR A;  2ZSG A;  5CDE A;  1QXW A;  4Z7M A;  1WBQ A;  2G6P A;  1JAW A;  1YVM A;  1XGO A;  3BIT A;  4EGE A;  4OOK A;  5D6E A;  1XGN A;  2Q94 A;  2Q93 A;  2P99 A;  3BIP A;  4A6V A;  1WY2 A;  2GGB A;  4S00 A;  1WN1 A;  2GU6 A;  5CDV A;  1PV9 A;  2BH3 A;  2B3K A;  3TAV A;  3MAT A;  2EA2 A;  1Y1N A;  2GGC A;  5FCF A;  1QXZ A;  5E5B A;  1N51 A;  2GG3 A;  5FCH A;  2BHC A;  1WKM A;  1XNZ A;  1B6A A;  4PNC A;  1XGM A;  3CB6 A;  5CDL A;  1C27 A;  4HXX A;  3PKC A;  1O0X A;  2MAT A;  3PKB A;  4FO7 A;  2V3Y A;  2NQ7 A;  4KM3 A;  2ADU A;  5JHU A;  3D27 A;  3L7G A;  4U76 A;  2BHB A;  5JFR A;  3PKA A;  1MAT A;  4U70 A;  4FLK A;  2BWS A;  2NQ6 A;  4PV4 A;  4U1B A;  5CLS A;  2EVM A;  2GU7 A;  4U6E A;  3IU7 A;  4ZWO A;  1C24 A;  1WLR A;  4RZZ A;  4U6Z A;  4IF7 A;  3IU8 A;  4U6J A;  2BWV A;  1M35 A;  2B3H A;  3RVA A;  1C21 A;  2GG9 A;  2Q96 A;  4RGZ 1;  3L24 A;  1A16 A;  2BWT A;  3BIQ A;  4FLI A;  4R60 A;  3IG4 A;  1XGS A;  3MX6 A;  4IPA A;  4IU6 A;  4U6W A;  2B3L A;  2GU5 A;  4FKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...