2Q92A

E. coli methionine aminopeptidase mn-form with inhibitor b23
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q92A00
3BIQA 2BWTA 2HOWA 4QR8A 2B3KA 1CHMA 1WL9A 2G6PA 2GA2A 2V3YA 4HXXA 4IF7A 4IKSA 4S01A 4FUKA 3Q6DA 4ZNGA 2NQ7A 3MATA 1O0XA 4IDYA 1R58A 1C21A 5D6EA 4FLLA 2GU6A 4EGEA 1A16A 3BIPA 4U75A 1R5GA 1MATA 3L24A 3S6BA 1BOAA 1XGOA 3TAVA 4IECA 1C27A 2BHAA 1YW8A 3IG4A 4A6VA 2GG8A 3L7GA 5CIKA 2B3HA 2BB7A 1C22A 2IW2A 1WKMA 2NQ6A 2OAZA 4PNCA 4S2TP 4JUQA 2BN7A 4IU6A 2Q93A 2EVCA 3RORA 2BWUA 5CDEA 1QXYA 1B59A 1WLRA 3IU9A 3TB5A 1M35A 1YW7A 2GG9A 2V3XA 4U6JA 4IKTA 2P98A 3CTZA 3MX6A 1PV9A 1XGMA 3PKDA 4U73A 1XGSA 5CDLA 2V3ZA 5CNXA 4PV4A 2MATA 5E5BA 3FM3A 2EVMA 4FLIA 1BN5A 2BHBA 5CDVA 4ZWUA 1W7VA 4FO7A 1B6AA 1YW9A 3CB5A 4FKCA 4OOKA 4U70A 2Q8KA 1C23A 4Z7MA 4RGZ1 3IU7A 3FMRA 2B3LA 1YJ3A 4KM3A 1KQ0A 1QXZA 2BHCA 5JHUA 4U71A 5FCHA 3MR1A 2GU4A 2BWWA 2EVOA 3PKBA 2GU5A 1WY2A 2GZ5A 2V6CA 1WBQA 2BH3A 4B28A 4IPAA 4S2RP 5CE6A 2GGBA 2GG7A 1YVMA 3FMQA 2GG5A 4S00A 2EA4A 3IU8A 3D27A 4U6CA 2BWSA 3PKEA 4A6WA 4ZWOA 2Q92A 2BHDA 3PKCA 5D6FA 1KP0A 2ADUA 2P9AA 2DFIA 2BWVA 1WL6A 2EA2A 4ZWPA 2Q96A 4IKUA 4FO8A 4FLKA 3CB6A 1Y1NA 2ZSGA 2GGCA 5CLSA 2GG2A 1WN1A 3PKAA 2GU7A 2P99A 1QZYA 4U6ZA 2GTXA 1QXWA 2Q95A 4FLJA 1XNZA 1W2MA 2OKNA 4IKRA 1R5HA 4U76A 1JAWA 4MATA 4U1BA 4RZZA 1N51A 2GG0A 2Q94A 4R60A 1C24A 4U6EA 4U69A 4U6WA 2BWXA 2BWYA 1KQ9A 3RVAA 5JFRA 3BITA 5FCFA 5JI6A 4RZYA 1XGNA 2GG3A
chains in the Genus database with same CATH superfamily
3BIQA 2BWTA 2HOWA 4QR8A 2B3KA 1CHMA 1WL9A 2G6PA 2GA2A 2V3YA 4HXXA 4IF7A 4IKSA 4S01A 4FUKA 3Q6DA 4ZNGA 2NQ7A 3MATA 1O0XA 4IDYA 1R58A 1C21A 5D6EA 4FLLA 2GU6A 4EGEA 1A16A 3BIPA 4U75A 1R5GA 1MATA 3L24A 3S6BA 1BOAA 1XGOA 3TAVA 4IECA 1C27A 2BHAA 1YW8A 3IG4A 4A6VA 2GG8A 3L7GA 5CIKA 2B3HA 2BB7A 1C22A 2IW2A 1WKMA 2NQ6A 2OAZA 4PNCA 4S2TP 4JUQA 2BN7A 4IU6A 2Q93A 2EVCA 3RORA 2BWUA 5CDEA 1QXYA 1B59A 1WLRA 3IU9A 3TB5A 1M35A 1YW7A 2GG9A 2V3XA 4U6JA 4IKTA 2P98A 3CTZA 3MX6A 1PV9A 1XGMA 3PKDA 4U73A 1XGSA 5CDLA 2V3ZA 5CNXA 4PV4A 2MATA 5E5BA 3FM3A 2EVMA 4FLIA 1BN5A 2BHBA 5CDVA 4ZWUA 1W7VA 4FO7A 1B6AA 1YW9A 3CB5A 4FKCA 4OOKA 4U70A 2Q8KA 1C23A 4Z7MA 4RGZ1 3IU7A 3FMRA 2B3LA 1YJ3A 4KM3A 1KQ0A 1QXZA 2BHCA 5JHUA 4U71A 5FCHA 3MR1A 2GU4A 2BWWA 2EVOA 3PKBA 2GU5A 1WY2A 2GZ5A 2V6CA 1WBQA 2BH3A 4B28A 4IPAA 4S2RP 5CE6A 2GGBA 2GG7A 1YVMA 3FMQA 2GG5A 4S00A 2EA4A 3IU8A 3D27A 4U6CA 2BWSA 3PKEA 4A6WA 4ZWOA 2Q92A 2BHDA 3PKCA 5D6FA 1KP0A 2ADUA 2P9AA 2DFIA 2BWVA 1WL6A 2EA2A 4ZWPA 2Q96A 4IKUA 4FO8A 4FLKA 3CB6A 1Y1NA 2ZSGA 2GGCA 5CLSA 2GG2A 1WN1A 3PKAA 2GU7A 2P99A 1QZYA 4U6ZA 2GTXA 1QXWA 2Q95A 4FLJA 1XNZA 1W2MA 2OKNA 4IKRA 1R5HA 4U76A 1JAWA 4MATA 4U1BA 4RZZA 1N51A 2GG0A 2Q94A 4R60A 1C24A 4U6EA 4U69A 4U6WA 2BWXA 2BWYA 1KQ9A 3RVAA 5JFRA 3BITA 5FCFA 5JI6A 4RZYA 1XGNA 2GG3A
chains in the Genus database with same CATH topology
3BIQA 2BWTA 2HOWA 4QR8A 2B3KA 1CHMA 1WL9A 2G6PA 2GA2A 2V3YA 4HXXA 4IF7A 4IKSA 4S01A 4FUKA 3Q6DA 4ZNGA 2NQ7A 3MATA 1O0XA 4IDYA 1R58A 1C21A 5D6EA 4FLLA 2GU6A 4EGEA 1A16A 3BIPA 4U75A 1R5GA 1MATA 3L24A 3S6BA 1BOAA 1XGOA 3TAVA 4IECA 1C27A 2BHAA 1YW8A 3IG4A 4A6VA 2GG8A 3L7GA 5CIKA 2B3HA 2BB7A 1C22A 2IW2A 1WKMA 2NQ6A 2OAZA 4PNCA 4S2TP 4JUQA 2BN7A 4IU6A 2Q93A 2EVCA 3RORA 2BWUA 5CDEA 1QXYA 1B59A 1WLRA 3IU9A 3TB5A 1M35A 1YW7A 2GG9A 2V3XA 4U6JA 4IKTA 2P98A 3CTZA 3MX6A 1PV9A 1XGMA 3PKDA 4U73A 1XGSA 5CDLA 2V3ZA 5CNXA 4PV4A 2MATA 5E5BA 3FM3A 2EVMA 4FLIA 1BN5A 2BHBA 5CDVA 4ZWUA 1W7VA 4FO7A 1B6AA 1YW9A 3CB5A 4FKCA 4OOKA 4U70A 2Q8KA 1C23A 4Z7MA 4RGZ1 3IU7A 3FMRA 2B3LA 1YJ3A 4KM3A 1KQ0A 1QXZA 2BHCA 5JHUA 4U71A 5FCHA 3MR1A 2GU4A 2BWWA 2EVOA 3PKBA 2GU5A 1WY2A 2GZ5A 2V6CA 1WBQA 2BH3A 4B28A 4IPAA 4S2RP 5CE6A 2GGBA 2GG7A 1YVMA 3FMQA 2GG5A 4S00A 2EA4A 3IU8A 3D27A 4U6CA 2BWSA 3PKEA 4A6WA 4ZWOA 2Q92A 2BHDA 3PKCA 5D6FA 1KP0A 2ADUA 2P9AA 2DFIA 2BWVA 1WL6A 2EA2A 4ZWPA 2Q96A 4IKUA 4FO8A 4FLKA 3CB6A 1Y1NA 2ZSGA 2GGCA 5CLSA 2GG2A 1WN1A 3PKAA 2GU7A 2P99A 1QZYA 4U6ZA 2GTXA 1QXWA 2Q95A 4FLJA 1XNZA 1W2MA 2OKNA 4IKRA 1R5HA 4U76A 1JAWA 4MATA 4U1BA 4RZZA 1N51A 2GG0A 2Q94A 4R60A 1C24A 4U6EA 4U69A 4U6WA 2BWXA 2BWYA 1KQ9A 3RVAA 5JFRA 3BITA 5FCFA 5JI6A 4RZYA 1XGNA 2GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIQ A;  2BWT A;  2HOW A;  4QR8 A;  2B3K A;  1CHM A;  1WL9 A;  2G6P A;  2GA2 A;  2V3Y A;  4HXX A;  4IF7 A;  4IKS A;  4S01 A;  4FUK A;  3Q6D A;  4ZNG A;  2NQ7 A;  3MAT A;  1O0X A;  4IDY A;  1R58 A;  1C21 A;  5D6E A;  4FLL A;  2GU6 A;  4EGE A;  1A16 A;  3BIP A;  4U75 A;  1R5G A;  1MAT A;  3L24 A;  3S6B A;  1BOA A;  1XGO A;  3TAV A;  4IEC A;  1C27 A;  2BHA A;  1YW8 A;  3IG4 A;  4A6V A;  2GG8 A;  3L7G A;  5CIK A;  2B3H A;  2BB7 A;  1C22 A;  2IW2 A;  1WKM A;  2NQ6 A;  2OAZ A;  4PNC A;  4S2T P;  4JUQ A;  2BN7 A;  4IU6 A;  2Q93 A;  2EVC A;  3ROR A;  2BWU A;  5CDE A;  1QXY A;  1B59 A;  1WLR A;  3IU9 A;  3TB5 A;  1M35 A;  1YW7 A;  2GG9 A;  2V3X A;  4U6J A;  4IKT A;  2P98 A;  3CTZ A;  3MX6 A;  1PV9 A;  1XGM A;  3PKD A;  4U73 A;  1XGS A;  5CDL A;  2V3Z A;  5CNX A;  4PV4 A;  2MAT A;  5E5B A;  3FM3 A;  2EVM A;  4FLI A;  1BN5 A;  2BHB A;  5CDV A;  4ZWU A;  1W7V A;  4FO7 A;  1B6A A;  1YW9 A;  3CB5 A;  4FKC A;  4OOK A;  4U70 A;  2Q8K A;  1C23 A;  4Z7M A;  4RGZ 1;  3IU7 A;  3FMR A;  2B3L A;  1YJ3 A;  4KM3 A;  1KQ0 A;  1QXZ A;  2BHC A;  5JHU A;  4U71 A;  5FCH A;  3MR1 A;  2GU4 A;  2BWW A;  2EVO A;  3PKB A;  2GU5 A;  1WY2 A;  2GZ5 A;  2V6C A;  1WBQ A;  2BH3 A;  4B28 A;  4IPA A;  4S2R P;  5CE6 A;  2GGB A;  2GG7 A;  1YVM A;  3FMQ A;  2GG5 A;  4S00 A;  2EA4 A;  3IU8 A;  3D27 A;  4U6C A;  2BWS A;  3PKE A;  4A6W A;  4ZWO A;  2Q92 A;  2BHD A;  3PKC A;  5D6F A;  1KP0 A;  2ADU A;  2P9A A;  2DFI A;  2BWV A;  1WL6 A;  2EA2 A;  4ZWP A;  2Q96 A;  4IKU A;  4FO8 A;  4FLK A;  3CB6 A;  1Y1N A;  2ZSG A;  2GGC A;  5CLS A;  2GG2 A;  1WN1 A;  3PKA A;  2GU7 A;  2P99 A;  1QZY A;  4U6Z A;  2GTX A;  1QXW A;  2Q95 A;  4FLJ A;  1XNZ A;  1W2M A;  2OKN A;  4IKR A;  1R5H A;  4U76 A;  1JAW A;  4MAT A;  4U1B A;  4RZZ A;  1N51 A;  2GG0 A;  2Q94 A;  4R60 A;  1C24 A;  4U6E A;  4U69 A;  4U6W A;  2BWX A;  2BWY A;  1KQ9 A;  3RVA A;  5JFR A;  3BIT A;  5FCF A;  5JI6 A;  4RZY A;  1XGN A;  2GG3 A; 
#chains in the Genus database with same CATH topology
 3BIQ A;  2BWT A;  2HOW A;  4QR8 A;  2B3K A;  1CHM A;  1WL9 A;  2G6P A;  2GA2 A;  2V3Y A;  4HXX A;  4IF7 A;  4IKS A;  4S01 A;  4FUK A;  3Q6D A;  4ZNG A;  2NQ7 A;  3MAT A;  1O0X A;  4IDY A;  1R58 A;  1C21 A;  5D6E A;  4FLL A;  2GU6 A;  4EGE A;  1A16 A;  3BIP A;  4U75 A;  1R5G A;  1MAT A;  3L24 A;  3S6B A;  1BOA A;  1XGO A;  3TAV A;  4IEC A;  1C27 A;  2BHA A;  1YW8 A;  3IG4 A;  4A6V A;  2GG8 A;  3L7G A;  5CIK A;  2B3H A;  2BB7 A;  1C22 A;  2IW2 A;  1WKM A;  2NQ6 A;  2OAZ A;  4PNC A;  4S2T P;  4JUQ A;  2BN7 A;  4IU6 A;  2Q93 A;  2EVC A;  3ROR A;  2BWU A;  5CDE A;  1QXY A;  1B59 A;  1WLR A;  3IU9 A;  3TB5 A;  1M35 A;  1YW7 A;  2GG9 A;  2V3X A;  4U6J A;  4IKT A;  2P98 A;  3CTZ A;  3MX6 A;  1PV9 A;  1XGM A;  3PKD A;  4U73 A;  1XGS A;  5CDL A;  2V3Z A;  5CNX A;  4PV4 A;  2MAT A;  5E5B A;  3FM3 A;  2EVM A;  4FLI A;  1BN5 A;  2BHB A;  5CDV A;  4ZWU A;  1W7V A;  4FO7 A;  1B6A A;  1YW9 A;  3CB5 A;  4FKC A;  4OOK A;  4U70 A;  2Q8K A;  1C23 A;  4Z7M A;  4RGZ 1;  3IU7 A;  3FMR A;  2B3L A;  1YJ3 A;  4KM3 A;  1KQ0 A;  1QXZ A;  2BHC A;  5JHU A;  4U71 A;  5FCH A;  3MR1 A;  2GU4 A;  2BWW A;  2EVO A;  3PKB A;  2GU5 A;  1WY2 A;  2GZ5 A;  2V6C A;  1WBQ A;  2BH3 A;  4B28 A;  4IPA A;  4S2R P;  5CE6 A;  2GGB A;  2GG7 A;  1YVM A;  3FMQ A;  2GG5 A;  4S00 A;  2EA4 A;  3IU8 A;  3D27 A;  4U6C A;  2BWS A;  3PKE A;  4A6W A;  4ZWO A;  2Q92 A;  2BHD A;  3PKC A;  5D6F A;  1KP0 A;  2ADU A;  2P9A A;  2DFI A;  2BWV A;  1WL6 A;  2EA2 A;  4ZWP A;  2Q96 A;  4IKU A;  4FO8 A;  4FLK A;  3CB6 A;  1Y1N A;  2ZSG A;  2GGC A;  5CLS A;  2GG2 A;  1WN1 A;  3PKA A;  2GU7 A;  2P99 A;  1QZY A;  4U6Z A;  2GTX A;  1QXW A;  2Q95 A;  4FLJ A;  1XNZ A;  1W2M A;  2OKN A;  4IKR A;  1R5H A;  4U76 A;  1JAW A;  4MAT A;  4U1B A;  4RZZ A;  1N51 A;  2GG0 A;  2Q94 A;  4R60 A;  1C24 A;  4U6E A;  4U69 A;  4U6W A;  2BWX A;  2BWY A;  1KQ9 A;  3RVA A;  5JFR A;  3BIT A;  5FCF A;  5JI6 A;  4RZY A;  1XGN A;  2GG3 A; 
#chains in the Genus database with same CATH homology
 3BIQ A;  2BWT A;  2HOW A;  4QR8 A;  2B3K A;  1CHM A;  1WL9 A;  2G6P A;  2GA2 A;  2V3Y A;  4HXX A;  4IF7 A;  4IKS A;  4S01 A;  4FUK A;  3Q6D A;  4ZNG A;  2NQ7 A;  3MAT A;  1O0X A;  4IDY A;  1R58 A;  1C21 A;  5D6E A;  4FLL A;  2GU6 A;  4EGE A;  1A16 A;  3BIP A;  4U75 A;  1R5G A;  1MAT A;  3L24 A;  3S6B A;  1BOA A;  1XGO A;  3TAV A;  4IEC A;  1C27 A;  2BHA A;  1YW8 A;  3IG4 A;  4A6V A;  2GG8 A;  3L7G A;  5CIK A;  2B3H A;  2BB7 A;  1C22 A;  2IW2 A;  1WKM A;  2NQ6 A;  2OAZ A;  4PNC A;  4S2T P;  4JUQ A;  2BN7 A;  4IU6 A;  2Q93 A;  2EVC A;  3ROR A;  2BWU A;  5CDE A;  1QXY A;  1B59 A;  1WLR A;  3IU9 A;  3TB5 A;  1M35 A;  1YW7 A;  2GG9 A;  2V3X A;  4U6J A;  4IKT A;  2P98 A;  3CTZ A;  3MX6 A;  1PV9 A;  1XGM A;  3PKD A;  4U73 A;  1XGS A;  5CDL A;  2V3Z A;  5CNX A;  4PV4 A;  2MAT A;  5E5B A;  3FM3 A;  2EVM A;  4FLI A;  1BN5 A;  2BHB A;  5CDV A;  4ZWU A;  1W7V A;  4FO7 A;  1B6A A;  1YW9 A;  3CB5 A;  4FKC A;  4OOK A;  4U70 A;  2Q8K A;  1C23 A;  4Z7M A;  4RGZ 1;  3IU7 A;  3FMR A;  2B3L A;  1YJ3 A;  4KM3 A;  1KQ0 A;  1QXZ A;  2BHC A;  5JHU A;  4U71 A;  5FCH A;  3MR1 A;  2GU4 A;  2BWW A;  2EVO A;  3PKB A;  2GU5 A;  1WY2 A;  2GZ5 A;  2V6C A;  1WBQ A;  2BH3 A;  4B28 A;  4IPA A;  4S2R P;  5CE6 A;  2GGB A;  2GG7 A;  1YVM A;  3FMQ A;  2GG5 A;  4S00 A;  2EA4 A;  3IU8 A;  3D27 A;  4U6C A;  2BWS A;  3PKE A;  4A6W A;  4ZWO A;  2Q92 A;  2BHD A;  3PKC A;  5D6F A;  1KP0 A;  2ADU A;  2P9A A;  2DFI A;  2BWV A;  1WL6 A;  2EA2 A;  4ZWP A;  2Q96 A;  4IKU A;  4FO8 A;  4FLK A;  3CB6 A;  1Y1N A;  2ZSG A;  2GGC A;  5CLS A;  2GG2 A;  1WN1 A;  3PKA A;  2GU7 A;  2P99 A;  1QZY A;  4U6Z A;  2GTX A;  1QXW A;  2Q95 A;  4FLJ A;  1XNZ A;  1W2M A;  2OKN A;  4IKR A;  1R5H A;  4U76 A;  1JAW A;  4MAT A;  4U1B A;  4RZZ A;  1N51 A;  2GG0 A;  2Q94 A;  4R60 A;  1C24 A;  4U6E A;  4U69 A;  4U6W A;  2BWX A;  2BWY A;  1KQ9 A;  3RVA A;  5JFR A;  3BIT A;  5FCF A;  5JI6 A;  4RZY A;  1XGN A;  2GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...