2Q92A

E. coli methionine aminopeptidase mn-form with inhibitor b23
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q92A00
2HOWA 5FCHA 2GG3A 3RORA 4U6CA 4ZWUA 2B3HA 5CNXA 2EA4A 4S01A 3IU7A 1B6AA 1WL9A 4ZNGA 4FLKA 1R5HA 2GGCA 2OAZA 1A16A 3IG4A 5JI6A 2BWVA 3CB5A 1R5GA 3CB6A 3BIPA 4FLIA 1JAWA 3MX6A 1QXWA 2BH3A 2IW2A 4FLLA 4U6ZA 4IKTA 2GU6A 4ZWOA 2BWSA 2GA2A 4ZWPA 2Q8KA 1WN1A 2BHCA 4A6VA 5CDEA 4JUQA 4HXXA 2Q92A 4MATA 4A6WA 1N51A 1W7VA 1Y1NA 2EVMA 1XGMA 4IPAA 1MATA 1XGOA 1PV9A 2EVCA 2GG0A 4OOKA 1R58A 1KQ0A 2GU5A 2V6CA 3FM3A 1XGSA 4U76A 3IU9A 1YW9A 4IKSA 4IECA 1BOAA 2V3YA 4FKCA 1C24A 2V3XA 3PKBA 2BB7A 2GTXA 4R60A 5JHUA 2BHDA 1WBQA 1B59A 2BHAA 4S00A 4B28A 2BWTA 4RZYA 5D6EA 5FCFA 3CTZA 5JFRA 4U6WA 2GU4A 2G6PA 1C21A 3BITA 3D27A 3Q6DA 3L7GA 4FO8A 2P9AA 1QXZA 2P99A 1YJ3A 5CE6A 3MATA 2Q96A 5E5BA 2BWXA 3FMRA 1WKMA 1WLRA 2BHBA 4FUKA 3PKCA 4PV4A 2ADUA 2BWYA 4U71A 2EVOA 2GG2A 4S2RP 1XNZA 4RZZA 1YVMA 1YW8A 1YW7A 2ZSGA 3S6BA 2DFIA 4S2TP 2B3LA 1KQ9A 2GG9A 2NQ6A 3IU8A 4U6EA 1O0XA 4FLJA 1QZYA 1XGNA 4IF7A 1WL6A 1CHMA 1WY2A 4QR8A 2BN7A 1QXYA 2NQ7A 3RVAA 4Z7MA 2GG7A 2Q93A 3TAVA 3TB5A 4U73A 2BWWA 1KP0A 3L24A 2BWUA 1M35A 4IKRA 3BIQA 4U6JA 5CLSA 2GG5A 2MATA 1C23A 4IDYA 4PNCA 4FO7A 5CIKA 4IKUA 4U70A 1C27A 5D6FA 4EGEA 1BN5A 2GGBA 2V3ZA 1W2MA 2Q94A 4RGZ1 3PKEA 5CDLA 4U75A 3PKAA 4U1BA 2GG8A 4KM3A 2GU7A 2GZ5A 3FMQA 4IU6A 2EA2A 4U69A 5CDVA 1C22A 2B3KA 2Q95A 3MR1A 3PKDA 2P98A 2OKNA
chains in the Genus database with same CATH superfamily
2HOWA 5FCHA 2GG3A 3RORA 4U6CA 4ZWUA 2B3HA 5CNXA 2EA4A 4S01A 3IU7A 1B6AA 1WL9A 4ZNGA 4FLKA 1R5HA 2GGCA 2OAZA 1A16A 3IG4A 5JI6A 2BWVA 3CB5A 1R5GA 3CB6A 3BIPA 4FLIA 1JAWA 3MX6A 1QXWA 2BH3A 2IW2A 4FLLA 4U6ZA 4IKTA 2GU6A 4ZWOA 2BWSA 2GA2A 4ZWPA 2Q8KA 1WN1A 2BHCA 4A6VA 5CDEA 4JUQA 4HXXA 2Q92A 4MATA 4A6WA 1N51A 1W7VA 1Y1NA 2EVMA 1XGMA 4IPAA 1MATA 1XGOA 1PV9A 2EVCA 2GG0A 4OOKA 1R58A 1KQ0A 2GU5A 2V6CA 3FM3A 1XGSA 4U76A 3IU9A 1YW9A 4IKSA 4IECA 1BOAA 2V3YA 4FKCA 1C24A 2V3XA 3PKBA 2BB7A 2GTXA 4R60A 5JHUA 2BHDA 1WBQA 1B59A 2BHAA 4S00A 4B28A 2BWTA 4RZYA 5D6EA 5FCFA 3CTZA 5JFRA 4U6WA 2GU4A 2G6PA 1C21A 3BITA 3D27A 3Q6DA 3L7GA 4FO8A 2P9AA 1QXZA 2P99A 1YJ3A 5CE6A 3MATA 2Q96A 5E5BA 2BWXA 3FMRA 1WKMA 1WLRA 2BHBA 4FUKA 3PKCA 4PV4A 2ADUA 2BWYA 4U71A 2EVOA 2GG2A 4S2RP 1XNZA 4RZZA 1YVMA 1YW8A 1YW7A 2ZSGA 3S6BA 2DFIA 4S2TP 2B3LA 1KQ9A 2GG9A 2NQ6A 3IU8A 4U6EA 1O0XA 4FLJA 1QZYA 1XGNA 4IF7A 1WL6A 1CHMA 1WY2A 4QR8A 2BN7A 1QXYA 2NQ7A 3RVAA 4Z7MA 2GG7A 2Q93A 3TAVA 3TB5A 4U73A 2BWWA 1KP0A 3L24A 2BWUA 1M35A 4IKRA 3BIQA 4U6JA 5CLSA 2GG5A 2MATA 1C23A 4IDYA 4PNCA 4FO7A 5CIKA 4IKUA 4U70A 1C27A 5D6FA 4EGEA 1BN5A 2GGBA 2V3ZA 1W2MA 2Q94A 4RGZ1 3PKEA 5CDLA 4U75A 3PKAA 4U1BA 2GG8A 4KM3A 2GU7A 2GZ5A 3FMQA 4IU6A 2EA2A 4U69A 5CDVA 1C22A 2B3KA 2Q95A 3MR1A 3PKDA 2P98A 2OKNA
chains in the Genus database with same CATH topology
2HOWA 5FCHA 2GG3A 3RORA 4U6CA 4ZWUA 2B3HA 5CNXA 2EA4A 4S01A 3IU7A 1B6AA 1WL9A 4ZNGA 4FLKA 1R5HA 2GGCA 2OAZA 1A16A 3IG4A 5JI6A 2BWVA 3CB5A 1R5GA 3CB6A 3BIPA 4FLIA 1JAWA 3MX6A 1QXWA 2BH3A 2IW2A 4FLLA 4U6ZA 4IKTA 2GU6A 4ZWOA 2BWSA 2GA2A 4ZWPA 2Q8KA 1WN1A 2BHCA 4A6VA 5CDEA 4JUQA 4HXXA 2Q92A 4MATA 4A6WA 1N51A 1W7VA 1Y1NA 2EVMA 1XGMA 4IPAA 1MATA 1XGOA 1PV9A 2EVCA 2GG0A 4OOKA 1R58A 1KQ0A 2GU5A 2V6CA 3FM3A 1XGSA 4U76A 3IU9A 1YW9A 4IKSA 4IECA 1BOAA 2V3YA 4FKCA 1C24A 2V3XA 3PKBA 2BB7A 2GTXA 4R60A 5JHUA 2BHDA 1WBQA 1B59A 2BHAA 4S00A 4B28A 2BWTA 4RZYA 5D6EA 5FCFA 3CTZA 5JFRA 4U6WA 2GU4A 2G6PA 1C21A 3BITA 3D27A 3Q6DA 3L7GA 4FO8A 2P9AA 1QXZA 2P99A 1YJ3A 5CE6A 3MATA 2Q96A 5E5BA 2BWXA 3FMRA 1WKMA 1WLRA 2BHBA 4FUKA 3PKCA 4PV4A 2ADUA 2BWYA 4U71A 2EVOA 2GG2A 4S2RP 1XNZA 4RZZA 1YVMA 1YW8A 1YW7A 2ZSGA 3S6BA 2DFIA 4S2TP 2B3LA 1KQ9A 2GG9A 2NQ6A 3IU8A 4U6EA 1O0XA 4FLJA 1QZYA 1XGNA 4IF7A 1WL6A 1CHMA 1WY2A 4QR8A 2BN7A 1QXYA 2NQ7A 3RVAA 4Z7MA 2GG7A 2Q93A 3TAVA 3TB5A 4U73A 2BWWA 1KP0A 3L24A 2BWUA 1M35A 4IKRA 3BIQA 4U6JA 5CLSA 2GG5A 2MATA 1C23A 4IDYA 4PNCA 4FO7A 5CIKA 4IKUA 4U70A 1C27A 5D6FA 4EGEA 1BN5A 2GGBA 2V3ZA 1W2MA 2Q94A 4RGZ1 3PKEA 5CDLA 4U75A 3PKAA 4U1BA 2GG8A 4KM3A 2GU7A 2GZ5A 3FMQA 4IU6A 2EA2A 4U69A 5CDVA 1C22A 2B3KA 2Q95A 3MR1A 3PKDA 2P98A 2OKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOW A;  5FCH A;  2GG3 A;  3ROR A;  4U6C A;  4ZWU A;  2B3H A;  5CNX A;  2EA4 A;  4S01 A;  3IU7 A;  1B6A A;  1WL9 A;  4ZNG A;  4FLK A;  1R5H A;  2GGC A;  2OAZ A;  1A16 A;  3IG4 A;  5JI6 A;  2BWV A;  3CB5 A;  1R5G A;  3CB6 A;  3BIP A;  4FLI A;  1JAW A;  3MX6 A;  1QXW A;  2BH3 A;  2IW2 A;  4FLL A;  4U6Z A;  4IKT A;  2GU6 A;  4ZWO A;  2BWS A;  2GA2 A;  4ZWP A;  2Q8K A;  1WN1 A;  2BHC A;  4A6V A;  5CDE A;  4JUQ A;  4HXX A;  2Q92 A;  4MAT A;  4A6W A;  1N51 A;  1W7V A;  1Y1N A;  2EVM A;  1XGM A;  4IPA A;  1MAT A;  1XGO A;  1PV9 A;  2EVC A;  2GG0 A;  4OOK A;  1R58 A;  1KQ0 A;  2GU5 A;  2V6C A;  3FM3 A;  1XGS A;  4U76 A;  3IU9 A;  1YW9 A;  4IKS A;  4IEC A;  1BOA A;  2V3Y A;  4FKC A;  1C24 A;  2V3X A;  3PKB A;  2BB7 A;  2GTX A;  4R60 A;  5JHU A;  2BHD A;  1WBQ A;  1B59 A;  2BHA A;  4S00 A;  4B28 A;  2BWT A;  4RZY A;  5D6E A;  5FCF A;  3CTZ A;  5JFR A;  4U6W A;  2GU4 A;  2G6P A;  1C21 A;  3BIT A;  3D27 A;  3Q6D A;  3L7G A;  4FO8 A;  2P9A A;  1QXZ A;  2P99 A;  1YJ3 A;  5CE6 A;  3MAT A;  2Q96 A;  5E5B A;  2BWX A;  3FMR A;  1WKM A;  1WLR A;  2BHB A;  4FUK A;  3PKC A;  4PV4 A;  2ADU A;  2BWY A;  4U71 A;  2EVO A;  2GG2 A;  4S2R P;  1XNZ A;  4RZZ A;  1YVM A;  1YW8 A;  1YW7 A;  2ZSG A;  3S6B A;  2DFI A;  4S2T P;  2B3L A;  1KQ9 A;  2GG9 A;  2NQ6 A;  3IU8 A;  4U6E A;  1O0X A;  4FLJ A;  1QZY A;  1XGN A;  4IF7 A;  1WL6 A;  1CHM A;  1WY2 A;  4QR8 A;  2BN7 A;  1QXY A;  2NQ7 A;  3RVA A;  4Z7M A;  2GG7 A;  2Q93 A;  3TAV A;  3TB5 A;  4U73 A;  2BWW A;  1KP0 A;  3L24 A;  2BWU A;  1M35 A;  4IKR A;  3BIQ A;  4U6J A;  5CLS A;  2GG5 A;  2MAT A;  1C23 A;  4IDY A;  4PNC A;  4FO7 A;  5CIK A;  4IKU A;  4U70 A;  1C27 A;  5D6F A;  4EGE A;  1BN5 A;  2GGB A;  2V3Z A;  1W2M A;  2Q94 A;  4RGZ 1;  3PKE A;  5CDL A;  4U75 A;  3PKA A;  4U1B A;  2GG8 A;  4KM3 A;  2GU7 A;  2GZ5 A;  3FMQ A;  4IU6 A;  2EA2 A;  4U69 A;  5CDV A;  1C22 A;  2B3K A;  2Q95 A;  3MR1 A;  3PKD A;  2P98 A;  2OKN A; 
#chains in the Genus database with same CATH topology
 2HOW A;  5FCH A;  2GG3 A;  3ROR A;  4U6C A;  4ZWU A;  2B3H A;  5CNX A;  2EA4 A;  4S01 A;  3IU7 A;  1B6A A;  1WL9 A;  4ZNG A;  4FLK A;  1R5H A;  2GGC A;  2OAZ A;  1A16 A;  3IG4 A;  5JI6 A;  2BWV A;  3CB5 A;  1R5G A;  3CB6 A;  3BIP A;  4FLI A;  1JAW A;  3MX6 A;  1QXW A;  2BH3 A;  2IW2 A;  4FLL A;  4U6Z A;  4IKT A;  2GU6 A;  4ZWO A;  2BWS A;  2GA2 A;  4ZWP A;  2Q8K A;  1WN1 A;  2BHC A;  4A6V A;  5CDE A;  4JUQ A;  4HXX A;  2Q92 A;  4MAT A;  4A6W A;  1N51 A;  1W7V A;  1Y1N A;  2EVM A;  1XGM A;  4IPA A;  1MAT A;  1XGO A;  1PV9 A;  2EVC A;  2GG0 A;  4OOK A;  1R58 A;  1KQ0 A;  2GU5 A;  2V6C A;  3FM3 A;  1XGS A;  4U76 A;  3IU9 A;  1YW9 A;  4IKS A;  4IEC A;  1BOA A;  2V3Y A;  4FKC A;  1C24 A;  2V3X A;  3PKB A;  2BB7 A;  2GTX A;  4R60 A;  5JHU A;  2BHD A;  1WBQ A;  1B59 A;  2BHA A;  4S00 A;  4B28 A;  2BWT A;  4RZY A;  5D6E A;  5FCF A;  3CTZ A;  5JFR A;  4U6W A;  2GU4 A;  2G6P A;  1C21 A;  3BIT A;  3D27 A;  3Q6D A;  3L7G A;  4FO8 A;  2P9A A;  1QXZ A;  2P99 A;  1YJ3 A;  5CE6 A;  3MAT A;  2Q96 A;  5E5B A;  2BWX A;  3FMR A;  1WKM A;  1WLR A;  2BHB A;  4FUK A;  3PKC A;  4PV4 A;  2ADU A;  2BWY A;  4U71 A;  2EVO A;  2GG2 A;  4S2R P;  1XNZ A;  4RZZ A;  1YVM A;  1YW8 A;  1YW7 A;  2ZSG A;  3S6B A;  2DFI A;  4S2T P;  2B3L A;  1KQ9 A;  2GG9 A;  2NQ6 A;  3IU8 A;  4U6E A;  1O0X A;  4FLJ A;  1QZY A;  1XGN A;  4IF7 A;  1WL6 A;  1CHM A;  1WY2 A;  4QR8 A;  2BN7 A;  1QXY A;  2NQ7 A;  3RVA A;  4Z7M A;  2GG7 A;  2Q93 A;  3TAV A;  3TB5 A;  4U73 A;  2BWW A;  1KP0 A;  3L24 A;  2BWU A;  1M35 A;  4IKR A;  3BIQ A;  4U6J A;  5CLS A;  2GG5 A;  2MAT A;  1C23 A;  4IDY A;  4PNC A;  4FO7 A;  5CIK A;  4IKU A;  4U70 A;  1C27 A;  5D6F A;  4EGE A;  1BN5 A;  2GGB A;  2V3Z A;  1W2M A;  2Q94 A;  4RGZ 1;  3PKE A;  5CDL A;  4U75 A;  3PKA A;  4U1B A;  2GG8 A;  4KM3 A;  2GU7 A;  2GZ5 A;  3FMQ A;  4IU6 A;  2EA2 A;  4U69 A;  5CDV A;  1C22 A;  2B3K A;  2Q95 A;  3MR1 A;  3PKD A;  2P98 A;  2OKN A; 
#chains in the Genus database with same CATH homology
 2HOW A;  5FCH A;  2GG3 A;  3ROR A;  4U6C A;  4ZWU A;  2B3H A;  5CNX A;  2EA4 A;  4S01 A;  3IU7 A;  1B6A A;  1WL9 A;  4ZNG A;  4FLK A;  1R5H A;  2GGC A;  2OAZ A;  1A16 A;  3IG4 A;  5JI6 A;  2BWV A;  3CB5 A;  1R5G A;  3CB6 A;  3BIP A;  4FLI A;  1JAW A;  3MX6 A;  1QXW A;  2BH3 A;  2IW2 A;  4FLL A;  4U6Z A;  4IKT A;  2GU6 A;  4ZWO A;  2BWS A;  2GA2 A;  4ZWP A;  2Q8K A;  1WN1 A;  2BHC A;  4A6V A;  5CDE A;  4JUQ A;  4HXX A;  2Q92 A;  4MAT A;  4A6W A;  1N51 A;  1W7V A;  1Y1N A;  2EVM A;  1XGM A;  4IPA A;  1MAT A;  1XGO A;  1PV9 A;  2EVC A;  2GG0 A;  4OOK A;  1R58 A;  1KQ0 A;  2GU5 A;  2V6C A;  3FM3 A;  1XGS A;  4U76 A;  3IU9 A;  1YW9 A;  4IKS A;  4IEC A;  1BOA A;  2V3Y A;  4FKC A;  1C24 A;  2V3X A;  3PKB A;  2BB7 A;  2GTX A;  4R60 A;  5JHU A;  2BHD A;  1WBQ A;  1B59 A;  2BHA A;  4S00 A;  4B28 A;  2BWT A;  4RZY A;  5D6E A;  5FCF A;  3CTZ A;  5JFR A;  4U6W A;  2GU4 A;  2G6P A;  1C21 A;  3BIT A;  3D27 A;  3Q6D A;  3L7G A;  4FO8 A;  2P9A A;  1QXZ A;  2P99 A;  1YJ3 A;  5CE6 A;  3MAT A;  2Q96 A;  5E5B A;  2BWX A;  3FMR A;  1WKM A;  1WLR A;  2BHB A;  4FUK A;  3PKC A;  4PV4 A;  2ADU A;  2BWY A;  4U71 A;  2EVO A;  2GG2 A;  4S2R P;  1XNZ A;  4RZZ A;  1YVM A;  1YW8 A;  1YW7 A;  2ZSG A;  3S6B A;  2DFI A;  4S2T P;  2B3L A;  1KQ9 A;  2GG9 A;  2NQ6 A;  3IU8 A;  4U6E A;  1O0X A;  4FLJ A;  1QZY A;  1XGN A;  4IF7 A;  1WL6 A;  1CHM A;  1WY2 A;  4QR8 A;  2BN7 A;  1QXY A;  2NQ7 A;  3RVA A;  4Z7M A;  2GG7 A;  2Q93 A;  3TAV A;  3TB5 A;  4U73 A;  2BWW A;  1KP0 A;  3L24 A;  2BWU A;  1M35 A;  4IKR A;  3BIQ A;  4U6J A;  5CLS A;  2GG5 A;  2MAT A;  1C23 A;  4IDY A;  4PNC A;  4FO7 A;  5CIK A;  4IKU A;  4U70 A;  1C27 A;  5D6F A;  4EGE A;  1BN5 A;  2GGB A;  2V3Z A;  1W2M A;  2Q94 A;  4RGZ 1;  3PKE A;  5CDL A;  4U75 A;  3PKA A;  4U1B A;  2GG8 A;  4KM3 A;  2GU7 A;  2GZ5 A;  3FMQ A;  4IU6 A;  2EA2 A;  4U69 A;  5CDV A;  1C22 A;  2B3K A;  2Q95 A;  3MR1 A;  3PKD A;  2P98 A;  2OKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...