2Q92A

E. coli methionine aminopeptidase mn-form with inhibitor b23
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q92A00
1Y1NA 4A6VA 2P98A 4FO7A 1MATA 4HXXA 3RORA 2B3HA 1B6AA 4PV4A 2P99A 2EA2A 2DFIA 2GG5A 2GU7A 3L24A 3PKBA 2Q8KA 4R60A 1XGSA 2OAZA 4IKUA 1YW8A 1C27A 4FLJA 3CB5A 1XGMA 1KP0A 5JI6A 1BN5A 4QR8A 4U69A 1WL9A 1PV9A 2BWWA 4RGZ1 5D6EA 2ADUA 2EVCA 3CB6A 4FLKA 4ZNGA 1R58A 2GGBA 4IU6A 1XGOA 2V3XA 3PKEA 2B3KA 3BITA 1QXZA 3FMRA 4OOKA 3BIPA 1WBQA 3CTZA 2Q94A 2GG9A 1WY2A 4U6EA 1YJ3A 1R5HA 1WKMA 3D27A 2ZSGA 4ZWUA 2BWXA 4IKRA 1QXWA 1C23A 5JFRA 3TB5A 4PNCA 2NQ7A 1N51A 2GG8A 3IU9A 4RZZA 4U6CA 1W2MA 4IKSA 3IU7A 2BHCA 1BOAA 1QZYA 2GTXA 5CLSA 3MR1A 2GG7A 3IU8A 3MATA 3PKDA 2BHBA 2GG0A 2Q95A 2EVOA 4IECA 5D6FA 5CDLA 3FMQA 4S2RP 2GA2A 4U70A 2BWTA 2IW2A 4RZYA 1C24A 4U73A 1O0XA 1WN1A 2EVMA 4U75A 4EGEA 4FLIA 4FO8A 5CNXA 4S01A 4S00A 1M35A 4FLLA 1A16A 1WLRA 2BH3A 5CDEA 1W7VA 2Q93A 1CHMA 3PKCA 2BHAA 3MX6A 5FCHA 1WL6A 4ZWPA 4U6JA 1B59A 4JUQA 2G6PA 4Z7MA 1R5GA 2GG3A 1JAWA 2V3ZA 1YW7A 1KQ0A 4IPAA 4IDYA 5E5BA 1C22A 2GU6A 3TAVA 4FUKA 2BB7A 3L7GA 5FCFA 1YVMA 3BIQA 3RVAA 4U6WA 2BHDA 1XNZA 2Q96A 2GG2A 4U71A 5CDVA 3IG4A 2B3LA 4U1BA 4B28A 1QXYA 4IF7A 1XGNA 2GGCA 2GZ5A 3Q6DA 2P9AA 2EA4A 4ZWOA 2BWUA 4KM3A 2MATA 2Q92A 2BN7A 2V6CA 4U76A 2NQ6A 3FM3A 2BWYA 1C21A 4FKCA 1YW9A 2BWSA 4A6WA 3S6BA 2GU5A 1KQ9A 2BWVA 5CE6A 2GU4A 2V3YA 3PKAA 4MATA 5CIKA 4S2TP 4IKTA 2OKNA 5JHUA 4U6ZA 2HOWA
chains in the Genus database with same CATH superfamily
1Y1NA 4A6VA 2P98A 4FO7A 1MATA 4HXXA 3RORA 2B3HA 1B6AA 4PV4A 2P99A 2EA2A 2DFIA 2GG5A 2GU7A 3L24A 3PKBA 2Q8KA 4R60A 1XGSA 2OAZA 4IKUA 1YW8A 1C27A 4FLJA 3CB5A 1XGMA 1KP0A 5JI6A 1BN5A 4QR8A 4U69A 1WL9A 1PV9A 2BWWA 4RGZ1 5D6EA 2ADUA 2EVCA 3CB6A 4FLKA 4ZNGA 1R58A 2GGBA 4IU6A 1XGOA 2V3XA 3PKEA 2B3KA 3BITA 1QXZA 3FMRA 4OOKA 3BIPA 1WBQA 3CTZA 2Q94A 2GG9A 1WY2A 4U6EA 1YJ3A 1R5HA 1WKMA 3D27A 2ZSGA 4ZWUA 2BWXA 4IKRA 1QXWA 1C23A 5JFRA 3TB5A 4PNCA 2NQ7A 1N51A 2GG8A 3IU9A 4RZZA 4U6CA 1W2MA 4IKSA 3IU7A 2BHCA 1BOAA 1QZYA 2GTXA 5CLSA 3MR1A 2GG7A 3IU8A 3MATA 3PKDA 2BHBA 2GG0A 2Q95A 2EVOA 4IECA 5D6FA 5CDLA 3FMQA 4S2RP 2GA2A 4U70A 2BWTA 2IW2A 4RZYA 1C24A 4U73A 1O0XA 1WN1A 2EVMA 4U75A 4EGEA 4FLIA 4FO8A 5CNXA 4S01A 4S00A 1M35A 4FLLA 1A16A 1WLRA 2BH3A 5CDEA 1W7VA 2Q93A 1CHMA 3PKCA 2BHAA 3MX6A 5FCHA 1WL6A 4ZWPA 4U6JA 1B59A 4JUQA 2G6PA 4Z7MA 1R5GA 2GG3A 1JAWA 2V3ZA 1YW7A 1KQ0A 4IPAA 4IDYA 5E5BA 1C22A 2GU6A 3TAVA 4FUKA 2BB7A 3L7GA 5FCFA 1YVMA 3BIQA 3RVAA 4U6WA 2BHDA 1XNZA 2Q96A 2GG2A 4U71A 5CDVA 3IG4A 2B3LA 4U1BA 4B28A 1QXYA 4IF7A 1XGNA 2GGCA 2GZ5A 3Q6DA 2P9AA 2EA4A 4ZWOA 2BWUA 4KM3A 2MATA 2Q92A 2BN7A 2V6CA 4U76A 2NQ6A 3FM3A 2BWYA 1C21A 4FKCA 1YW9A 2BWSA 4A6WA 3S6BA 2GU5A 1KQ9A 2BWVA 5CE6A 2GU4A 2V3YA 3PKAA 4MATA 5CIKA 4S2TP 4IKTA 2OKNA 5JHUA 4U6ZA 2HOWA
chains in the Genus database with same CATH topology
1Y1NA 4A6VA 2P98A 4FO7A 1MATA 4HXXA 3RORA 2B3HA 1B6AA 4PV4A 2P99A 2EA2A 2DFIA 2GG5A 2GU7A 3L24A 3PKBA 2Q8KA 4R60A 1XGSA 2OAZA 4IKUA 1YW8A 1C27A 4FLJA 3CB5A 1XGMA 1KP0A 5JI6A 1BN5A 4QR8A 4U69A 1WL9A 1PV9A 2BWWA 4RGZ1 5D6EA 2ADUA 2EVCA 3CB6A 4FLKA 4ZNGA 1R58A 2GGBA 4IU6A 1XGOA 2V3XA 3PKEA 2B3KA 3BITA 1QXZA 3FMRA 4OOKA 3BIPA 1WBQA 3CTZA 2Q94A 2GG9A 1WY2A 4U6EA 1YJ3A 1R5HA 1WKMA 3D27A 2ZSGA 4ZWUA 2BWXA 4IKRA 1QXWA 1C23A 5JFRA 3TB5A 4PNCA 2NQ7A 1N51A 2GG8A 3IU9A 4RZZA 4U6CA 1W2MA 4IKSA 3IU7A 2BHCA 1BOAA 1QZYA 2GTXA 5CLSA 3MR1A 2GG7A 3IU8A 3MATA 3PKDA 2BHBA 2GG0A 2Q95A 2EVOA 4IECA 5D6FA 5CDLA 3FMQA 4S2RP 2GA2A 4U70A 2BWTA 2IW2A 4RZYA 1C24A 4U73A 1O0XA 1WN1A 2EVMA 4U75A 4EGEA 4FLIA 4FO8A 5CNXA 4S01A 4S00A 1M35A 4FLLA 1A16A 1WLRA 2BH3A 5CDEA 1W7VA 2Q93A 1CHMA 3PKCA 2BHAA 3MX6A 5FCHA 1WL6A 4ZWPA 4U6JA 1B59A 4JUQA 2G6PA 4Z7MA 1R5GA 2GG3A 1JAWA 2V3ZA 1YW7A 1KQ0A 4IPAA 4IDYA 5E5BA 1C22A 2GU6A 3TAVA 4FUKA 2BB7A 3L7GA 5FCFA 1YVMA 3BIQA 3RVAA 4U6WA 2BHDA 1XNZA 2Q96A 2GG2A 4U71A 5CDVA 3IG4A 2B3LA 4U1BA 4B28A 1QXYA 4IF7A 1XGNA 2GGCA 2GZ5A 3Q6DA 2P9AA 2EA4A 4ZWOA 2BWUA 4KM3A 2MATA 2Q92A 2BN7A 2V6CA 4U76A 2NQ6A 3FM3A 2BWYA 1C21A 4FKCA 1YW9A 2BWSA 4A6WA 3S6BA 2GU5A 1KQ9A 2BWVA 5CE6A 2GU4A 2V3YA 3PKAA 4MATA 5CIKA 4S2TP 4IKTA 2OKNA 5JHUA 4U6ZA 2HOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1N A;  4A6V A;  2P98 A;  4FO7 A;  1MAT A;  4HXX A;  3ROR A;  2B3H A;  1B6A A;  4PV4 A;  2P99 A;  2EA2 A;  2DFI A;  2GG5 A;  2GU7 A;  3L24 A;  3PKB A;  2Q8K A;  4R60 A;  1XGS A;  2OAZ A;  4IKU A;  1YW8 A;  1C27 A;  4FLJ A;  3CB5 A;  1XGM A;  1KP0 A;  5JI6 A;  1BN5 A;  4QR8 A;  4U69 A;  1WL9 A;  1PV9 A;  2BWW A;  4RGZ 1;  5D6E A;  2ADU A;  2EVC A;  3CB6 A;  4FLK A;  4ZNG A;  1R58 A;  2GGB A;  4IU6 A;  1XGO A;  2V3X A;  3PKE A;  2B3K A;  3BIT A;  1QXZ A;  3FMR A;  4OOK A;  3BIP A;  1WBQ A;  3CTZ A;  2Q94 A;  2GG9 A;  1WY2 A;  4U6E A;  1YJ3 A;  1R5H A;  1WKM A;  3D27 A;  2ZSG A;  4ZWU A;  2BWX A;  4IKR A;  1QXW A;  1C23 A;  5JFR A;  3TB5 A;  4PNC A;  2NQ7 A;  1N51 A;  2GG8 A;  3IU9 A;  4RZZ A;  4U6C A;  1W2M A;  4IKS A;  3IU7 A;  2BHC A;  1BOA A;  1QZY A;  2GTX A;  5CLS A;  3MR1 A;  2GG7 A;  3IU8 A;  3MAT A;  3PKD A;  2BHB A;  2GG0 A;  2Q95 A;  2EVO A;  4IEC A;  5D6F A;  5CDL A;  3FMQ A;  4S2R P;  2GA2 A;  4U70 A;  2BWT A;  2IW2 A;  4RZY A;  1C24 A;  4U73 A;  1O0X A;  1WN1 A;  2EVM A;  4U75 A;  4EGE A;  4FLI A;  4FO8 A;  5CNX A;  4S01 A;  4S00 A;  1M35 A;  4FLL A;  1A16 A;  1WLR A;  2BH3 A;  5CDE A;  1W7V A;  2Q93 A;  1CHM A;  3PKC A;  2BHA A;  3MX6 A;  5FCH A;  1WL6 A;  4ZWP A;  4U6J A;  1B59 A;  4JUQ A;  2G6P A;  4Z7M A;  1R5G A;  2GG3 A;  1JAW A;  2V3Z A;  1YW7 A;  1KQ0 A;  4IPA A;  4IDY A;  5E5B A;  1C22 A;  2GU6 A;  3TAV A;  4FUK A;  2BB7 A;  3L7G A;  5FCF A;  1YVM A;  3BIQ A;  3RVA A;  4U6W A;  2BHD A;  1XNZ A;  2Q96 A;  2GG2 A;  4U71 A;  5CDV A;  3IG4 A;  2B3L A;  4U1B A;  4B28 A;  1QXY A;  4IF7 A;  1XGN A;  2GGC A;  2GZ5 A;  3Q6D A;  2P9A A;  2EA4 A;  4ZWO A;  2BWU A;  4KM3 A;  2MAT A;  2Q92 A;  2BN7 A;  2V6C A;  4U76 A;  2NQ6 A;  3FM3 A;  2BWY A;  1C21 A;  4FKC A;  1YW9 A;  2BWS A;  4A6W A;  3S6B A;  2GU5 A;  1KQ9 A;  2BWV A;  5CE6 A;  2GU4 A;  2V3Y A;  3PKA A;  4MAT A;  5CIK A;  4S2T P;  4IKT A;  2OKN A;  5JHU A;  4U6Z A;  2HOW A; 
#chains in the Genus database with same CATH topology
 1Y1N A;  4A6V A;  2P98 A;  4FO7 A;  1MAT A;  4HXX A;  3ROR A;  2B3H A;  1B6A A;  4PV4 A;  2P99 A;  2EA2 A;  2DFI A;  2GG5 A;  2GU7 A;  3L24 A;  3PKB A;  2Q8K A;  4R60 A;  1XGS A;  2OAZ A;  4IKU A;  1YW8 A;  1C27 A;  4FLJ A;  3CB5 A;  1XGM A;  1KP0 A;  5JI6 A;  1BN5 A;  4QR8 A;  4U69 A;  1WL9 A;  1PV9 A;  2BWW A;  4RGZ 1;  5D6E A;  2ADU A;  2EVC A;  3CB6 A;  4FLK A;  4ZNG A;  1R58 A;  2GGB A;  4IU6 A;  1XGO A;  2V3X A;  3PKE A;  2B3K A;  3BIT A;  1QXZ A;  3FMR A;  4OOK A;  3BIP A;  1WBQ A;  3CTZ A;  2Q94 A;  2GG9 A;  1WY2 A;  4U6E A;  1YJ3 A;  1R5H A;  1WKM A;  3D27 A;  2ZSG A;  4ZWU A;  2BWX A;  4IKR A;  1QXW A;  1C23 A;  5JFR A;  3TB5 A;  4PNC A;  2NQ7 A;  1N51 A;  2GG8 A;  3IU9 A;  4RZZ A;  4U6C A;  1W2M A;  4IKS A;  3IU7 A;  2BHC A;  1BOA A;  1QZY A;  2GTX A;  5CLS A;  3MR1 A;  2GG7 A;  3IU8 A;  3MAT A;  3PKD A;  2BHB A;  2GG0 A;  2Q95 A;  2EVO A;  4IEC A;  5D6F A;  5CDL A;  3FMQ A;  4S2R P;  2GA2 A;  4U70 A;  2BWT A;  2IW2 A;  4RZY A;  1C24 A;  4U73 A;  1O0X A;  1WN1 A;  2EVM A;  4U75 A;  4EGE A;  4FLI A;  4FO8 A;  5CNX A;  4S01 A;  4S00 A;  1M35 A;  4FLL A;  1A16 A;  1WLR A;  2BH3 A;  5CDE A;  1W7V A;  2Q93 A;  1CHM A;  3PKC A;  2BHA A;  3MX6 A;  5FCH A;  1WL6 A;  4ZWP A;  4U6J A;  1B59 A;  4JUQ A;  2G6P A;  4Z7M A;  1R5G A;  2GG3 A;  1JAW A;  2V3Z A;  1YW7 A;  1KQ0 A;  4IPA A;  4IDY A;  5E5B A;  1C22 A;  2GU6 A;  3TAV A;  4FUK A;  2BB7 A;  3L7G A;  5FCF A;  1YVM A;  3BIQ A;  3RVA A;  4U6W A;  2BHD A;  1XNZ A;  2Q96 A;  2GG2 A;  4U71 A;  5CDV A;  3IG4 A;  2B3L A;  4U1B A;  4B28 A;  1QXY A;  4IF7 A;  1XGN A;  2GGC A;  2GZ5 A;  3Q6D A;  2P9A A;  2EA4 A;  4ZWO A;  2BWU A;  4KM3 A;  2MAT A;  2Q92 A;  2BN7 A;  2V6C A;  4U76 A;  2NQ6 A;  3FM3 A;  2BWY A;  1C21 A;  4FKC A;  1YW9 A;  2BWS A;  4A6W A;  3S6B A;  2GU5 A;  1KQ9 A;  2BWV A;  5CE6 A;  2GU4 A;  2V3Y A;  3PKA A;  4MAT A;  5CIK A;  4S2T P;  4IKT A;  2OKN A;  5JHU A;  4U6Z A;  2HOW A; 
#chains in the Genus database with same CATH homology
 1Y1N A;  4A6V A;  2P98 A;  4FO7 A;  1MAT A;  4HXX A;  3ROR A;  2B3H A;  1B6A A;  4PV4 A;  2P99 A;  2EA2 A;  2DFI A;  2GG5 A;  2GU7 A;  3L24 A;  3PKB A;  2Q8K A;  4R60 A;  1XGS A;  2OAZ A;  4IKU A;  1YW8 A;  1C27 A;  4FLJ A;  3CB5 A;  1XGM A;  1KP0 A;  5JI6 A;  1BN5 A;  4QR8 A;  4U69 A;  1WL9 A;  1PV9 A;  2BWW A;  4RGZ 1;  5D6E A;  2ADU A;  2EVC A;  3CB6 A;  4FLK A;  4ZNG A;  1R58 A;  2GGB A;  4IU6 A;  1XGO A;  2V3X A;  3PKE A;  2B3K A;  3BIT A;  1QXZ A;  3FMR A;  4OOK A;  3BIP A;  1WBQ A;  3CTZ A;  2Q94 A;  2GG9 A;  1WY2 A;  4U6E A;  1YJ3 A;  1R5H A;  1WKM A;  3D27 A;  2ZSG A;  4ZWU A;  2BWX A;  4IKR A;  1QXW A;  1C23 A;  5JFR A;  3TB5 A;  4PNC A;  2NQ7 A;  1N51 A;  2GG8 A;  3IU9 A;  4RZZ A;  4U6C A;  1W2M A;  4IKS A;  3IU7 A;  2BHC A;  1BOA A;  1QZY A;  2GTX A;  5CLS A;  3MR1 A;  2GG7 A;  3IU8 A;  3MAT A;  3PKD A;  2BHB A;  2GG0 A;  2Q95 A;  2EVO A;  4IEC A;  5D6F A;  5CDL A;  3FMQ A;  4S2R P;  2GA2 A;  4U70 A;  2BWT A;  2IW2 A;  4RZY A;  1C24 A;  4U73 A;  1O0X A;  1WN1 A;  2EVM A;  4U75 A;  4EGE A;  4FLI A;  4FO8 A;  5CNX A;  4S01 A;  4S00 A;  1M35 A;  4FLL A;  1A16 A;  1WLR A;  2BH3 A;  5CDE A;  1W7V A;  2Q93 A;  1CHM A;  3PKC A;  2BHA A;  3MX6 A;  5FCH A;  1WL6 A;  4ZWP A;  4U6J A;  1B59 A;  4JUQ A;  2G6P A;  4Z7M A;  1R5G A;  2GG3 A;  1JAW A;  2V3Z A;  1YW7 A;  1KQ0 A;  4IPA A;  4IDY A;  5E5B A;  1C22 A;  2GU6 A;  3TAV A;  4FUK A;  2BB7 A;  3L7G A;  5FCF A;  1YVM A;  3BIQ A;  3RVA A;  4U6W A;  2BHD A;  1XNZ A;  2Q96 A;  2GG2 A;  4U71 A;  5CDV A;  3IG4 A;  2B3L A;  4U1B A;  4B28 A;  1QXY A;  4IF7 A;  1XGN A;  2GGC A;  2GZ5 A;  3Q6D A;  2P9A A;  2EA4 A;  4ZWO A;  2BWU A;  4KM3 A;  2MAT A;  2Q92 A;  2BN7 A;  2V6C A;  4U76 A;  2NQ6 A;  3FM3 A;  2BWY A;  1C21 A;  4FKC A;  1YW9 A;  2BWS A;  4A6W A;  3S6B A;  2GU5 A;  1KQ9 A;  2BWV A;  5CE6 A;  2GU4 A;  2V3Y A;  3PKA A;  4MAT A;  5CIK A;  4S2T P;  4IKT A;  2OKN A;  5JHU A;  4U6Z A;  2HOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...