4U73A

Hsmetap(f309m) in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u73A00
4IKTA 3TB5A 2B3HA 1JAWA 1KQ9A 2G6PA 2HOWA 5JI6A 2ADUA 2NQ6A 4U1BA 5FCHA 1MATA 2GG0A 2Q8KA 4R60A 1WN1A 1C24A 2B3KA 2MATA 2OAZA 4FO7A 2Q95A 3FMRA 4ZWPA 2GU6A 2EA2A 5CDVA 3IG4A 3CB5A 5CDEA 3PKDA 2EVCA 3PKBA 2GG7A 4U6WA 2GG5A 4FLJA 4IDYA 1N51A 3MATA 3FM3A 4U6ZA 4ZWUA 2BN7A 2GG3A 2EA4A 4IPAA 4FO8A 2GGBA 5CE6A 3D27A 1PV9A 3FMQA 1C21A 1W7VA 5D6EA 3BITA 3Q6DA 4ZNGA 4S01A 2BB7A 1WBQA 2Q94A 4EGEA 1Y1NA 2DFIA 2Q92A 2V6CA 2BWSA 1KP0A 2GGCA 2NQ7A 4PNCA 1WY2A 5FCFA 4U73A 2BHCA 3IU7A 2BWWA 1B6AA 4FLKA 4RGZ1 4U6CA 2BH3A 2P9AA 3CTZA 4HXXA 4S2RP 4S2TP 4U69A 4RZYA 4U71A 4OOKA 4MATA 1KQ0A 4FKCA 5CIKA 3RVAA 4A6VA 4U75A 3IU9A 3BIPA 2Q93A 2GTXA 4KM3A 3IU8A 2P99A 1W2MA 5CDLA 2V3XA 1R58A 1QXZA 4JUQA 2IW2A 4FUKA 2BWYA 4U6JA 1BOAA 1BN5A 4IU6A 1YW7A 3CB6A 1YW8A 4U70A 3MX6A 2GZ5A 4FLIA 4S00A 2GG8A 3MR1A 1WKMA 1A16A 2BWUA 4IECA 1QXWA 2EVMA 1C27A 4U6EA 1R5GA 1O0XA 4B28A 2BHDA 4A6WA 3TAVA 1WLRA 2GG9A 1XGSA 2GU5A 5E5BA 3PKAA 2OKNA 2ZSGA 4IF7A 5JHUA 3RORA 2GU7A 4IKRA 4RZZA 1B59A 1CHMA 1QZYA 1M35A 2GG2A 3S6BA 1WL6A 1YJ3A 5JFRA 2BWTA 1XNZA 4QR8A 2GA2A 2BWVA 4ZWOA 2V3YA 1QXYA 3PKEA 3PKCA 5D6FA 2V3ZA 2Q96A 1C23A 1XGMA 4Z7MA 1C22A 5CNXA 2EVOA 3L24A 3L7GA 1R5HA 3BIQA 1XGNA 2GU4A 2P98A 4FLLA 4IKUA 4PV4A 4IKSA 2BWXA 1YVMA 5CLSA 1WL9A 1YW9A 2B3LA 2BHAA 4U76A 1XGOA 2BHBA
chains in the Genus database with same CATH superfamily
4IKTA 3TB5A 2B3HA 1JAWA 1KQ9A 2G6PA 2HOWA 5JI6A 2ADUA 2NQ6A 4U1BA 5FCHA 1MATA 2GG0A 2Q8KA 4R60A 1WN1A 1C24A 2B3KA 2MATA 2OAZA 4FO7A 2Q95A 3FMRA 4ZWPA 2GU6A 2EA2A 5CDVA 3IG4A 3CB5A 5CDEA 3PKDA 2EVCA 3PKBA 2GG7A 4U6WA 2GG5A 4FLJA 4IDYA 1N51A 3MATA 3FM3A 4U6ZA 4ZWUA 2BN7A 2GG3A 2EA4A 4IPAA 4FO8A 2GGBA 5CE6A 3D27A 1PV9A 3FMQA 1C21A 1W7VA 5D6EA 3BITA 3Q6DA 4ZNGA 4S01A 2BB7A 1WBQA 2Q94A 4EGEA 1Y1NA 2DFIA 2Q92A 2V6CA 2BWSA 1KP0A 2GGCA 2NQ7A 4PNCA 1WY2A 5FCFA 4U73A 2BHCA 3IU7A 2BWWA 1B6AA 4FLKA 4RGZ1 4U6CA 2BH3A 2P9AA 3CTZA 4HXXA 4S2RP 4S2TP 4U69A 4RZYA 4U71A 4OOKA 4MATA 1KQ0A 4FKCA 5CIKA 3RVAA 4A6VA 4U75A 3IU9A 3BIPA 2Q93A 2GTXA 4KM3A 3IU8A 2P99A 1W2MA 5CDLA 2V3XA 1R58A 1QXZA 4JUQA 2IW2A 4FUKA 2BWYA 4U6JA 1BOAA 1BN5A 4IU6A 1YW7A 3CB6A 1YW8A 4U70A 3MX6A 2GZ5A 4FLIA 4S00A 2GG8A 3MR1A 1WKMA 1A16A 2BWUA 4IECA 1QXWA 2EVMA 1C27A 4U6EA 1R5GA 1O0XA 4B28A 2BHDA 4A6WA 3TAVA 1WLRA 2GG9A 1XGSA 2GU5A 5E5BA 3PKAA 2OKNA 2ZSGA 4IF7A 5JHUA 3RORA 2GU7A 4IKRA 4RZZA 1B59A 1CHMA 1QZYA 1M35A 2GG2A 3S6BA 1WL6A 1YJ3A 5JFRA 2BWTA 1XNZA 4QR8A 2GA2A 2BWVA 4ZWOA 2V3YA 1QXYA 3PKEA 3PKCA 5D6FA 2V3ZA 2Q96A 1C23A 1XGMA 4Z7MA 1C22A 5CNXA 2EVOA 3L24A 3L7GA 1R5HA 3BIQA 1XGNA 2GU4A 2P98A 4FLLA 4IKUA 4PV4A 4IKSA 2BWXA 1YVMA 5CLSA 1WL9A 1YW9A 2B3LA 2BHAA 4U76A 1XGOA 2BHBA
chains in the Genus database with same CATH topology
4IKTA 3TB5A 2B3HA 1JAWA 1KQ9A 2G6PA 2HOWA 5JI6A 2ADUA 2NQ6A 4U1BA 5FCHA 1MATA 2GG0A 2Q8KA 4R60A 1WN1A 1C24A 2B3KA 2MATA 2OAZA 4FO7A 2Q95A 3FMRA 4ZWPA 2GU6A 2EA2A 5CDVA 3IG4A 3CB5A 5CDEA 3PKDA 2EVCA 3PKBA 2GG7A 4U6WA 2GG5A 4FLJA 4IDYA 1N51A 3MATA 3FM3A 4U6ZA 4ZWUA 2BN7A 2GG3A 2EA4A 4IPAA 4FO8A 2GGBA 5CE6A 3D27A 1PV9A 3FMQA 1C21A 1W7VA 5D6EA 3BITA 3Q6DA 4ZNGA 4S01A 2BB7A 1WBQA 2Q94A 4EGEA 1Y1NA 2DFIA 2Q92A 2V6CA 2BWSA 1KP0A 2GGCA 2NQ7A 4PNCA 1WY2A 5FCFA 4U73A 2BHCA 3IU7A 2BWWA 1B6AA 4FLKA 4RGZ1 4U6CA 2BH3A 2P9AA 3CTZA 4HXXA 4S2RP 4S2TP 4U69A 4RZYA 4U71A 4OOKA 4MATA 1KQ0A 4FKCA 5CIKA 3RVAA 4A6VA 4U75A 3IU9A 3BIPA 2Q93A 2GTXA 4KM3A 3IU8A 2P99A 1W2MA 5CDLA 2V3XA 1R58A 1QXZA 4JUQA 2IW2A 4FUKA 2BWYA 4U6JA 1BOAA 1BN5A 4IU6A 1YW7A 3CB6A 1YW8A 4U70A 3MX6A 2GZ5A 4FLIA 4S00A 2GG8A 3MR1A 1WKMA 1A16A 2BWUA 4IECA 1QXWA 2EVMA 1C27A 4U6EA 1R5GA 1O0XA 4B28A 2BHDA 4A6WA 3TAVA 1WLRA 2GG9A 1XGSA 2GU5A 5E5BA 3PKAA 2OKNA 2ZSGA 4IF7A 5JHUA 3RORA 2GU7A 4IKRA 4RZZA 1B59A 1CHMA 1QZYA 1M35A 2GG2A 3S6BA 1WL6A 1YJ3A 5JFRA 2BWTA 1XNZA 4QR8A 2GA2A 2BWVA 4ZWOA 2V3YA 1QXYA 3PKEA 3PKCA 5D6FA 2V3ZA 2Q96A 1C23A 1XGMA 4Z7MA 1C22A 5CNXA 2EVOA 3L24A 3L7GA 1R5HA 3BIQA 1XGNA 2GU4A 2P98A 4FLLA 4IKUA 4PV4A 4IKSA 2BWXA 1YVMA 5CLSA 1WL9A 1YW9A 2B3LA 2BHAA 4U76A 1XGOA 2BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKT A;  3TB5 A;  2B3H A;  1JAW A;  1KQ9 A;  2G6P A;  2HOW A;  5JI6 A;  2ADU A;  2NQ6 A;  4U1B A;  5FCH A;  1MAT A;  2GG0 A;  2Q8K A;  4R60 A;  1WN1 A;  1C24 A;  2B3K A;  2MAT A;  2OAZ A;  4FO7 A;  2Q95 A;  3FMR A;  4ZWP A;  2GU6 A;  2EA2 A;  5CDV A;  3IG4 A;  3CB5 A;  5CDE A;  3PKD A;  2EVC A;  3PKB A;  2GG7 A;  4U6W A;  2GG5 A;  4FLJ A;  4IDY A;  1N51 A;  3MAT A;  3FM3 A;  4U6Z A;  4ZWU A;  2BN7 A;  2GG3 A;  2EA4 A;  4IPA A;  4FO8 A;  2GGB A;  5CE6 A;  3D27 A;  1PV9 A;  3FMQ A;  1C21 A;  1W7V A;  5D6E A;  3BIT A;  3Q6D A;  4ZNG A;  4S01 A;  2BB7 A;  1WBQ A;  2Q94 A;  4EGE A;  1Y1N A;  2DFI A;  2Q92 A;  2V6C A;  2BWS A;  1KP0 A;  2GGC A;  2NQ7 A;  4PNC A;  1WY2 A;  5FCF A;  4U73 A;  2BHC A;  3IU7 A;  2BWW A;  1B6A A;  4FLK A;  4RGZ 1;  4U6C A;  2BH3 A;  2P9A A;  3CTZ A;  4HXX A;  4S2R P;  4S2T P;  4U69 A;  4RZY A;  4U71 A;  4OOK A;  4MAT A;  1KQ0 A;  4FKC A;  5CIK A;  3RVA A;  4A6V A;  4U75 A;  3IU9 A;  3BIP A;  2Q93 A;  2GTX A;  4KM3 A;  3IU8 A;  2P99 A;  1W2M A;  5CDL A;  2V3X A;  1R58 A;  1QXZ A;  4JUQ A;  2IW2 A;  4FUK A;  2BWY A;  4U6J A;  1BOA A;  1BN5 A;  4IU6 A;  1YW7 A;  3CB6 A;  1YW8 A;  4U70 A;  3MX6 A;  2GZ5 A;  4FLI A;  4S00 A;  2GG8 A;  3MR1 A;  1WKM A;  1A16 A;  2BWU A;  4IEC A;  1QXW A;  2EVM A;  1C27 A;  4U6E A;  1R5G A;  1O0X A;  4B28 A;  2BHD A;  4A6W A;  3TAV A;  1WLR A;  2GG9 A;  1XGS A;  2GU5 A;  5E5B A;  3PKA A;  2OKN A;  2ZSG A;  4IF7 A;  5JHU A;  3ROR A;  2GU7 A;  4IKR A;  4RZZ A;  1B59 A;  1CHM A;  1QZY A;  1M35 A;  2GG2 A;  3S6B A;  1WL6 A;  1YJ3 A;  5JFR A;  2BWT A;  1XNZ A;  4QR8 A;  2GA2 A;  2BWV A;  4ZWO A;  2V3Y A;  1QXY A;  3PKE A;  3PKC A;  5D6F A;  2V3Z A;  2Q96 A;  1C23 A;  1XGM A;  4Z7M A;  1C22 A;  5CNX A;  2EVO A;  3L24 A;  3L7G A;  1R5H A;  3BIQ A;  1XGN A;  2GU4 A;  2P98 A;  4FLL A;  4IKU A;  4PV4 A;  4IKS A;  2BWX A;  1YVM A;  5CLS A;  1WL9 A;  1YW9 A;  2B3L A;  2BHA A;  4U76 A;  1XGO A;  2BHB A; 
#chains in the Genus database with same CATH topology
 4IKT A;  3TB5 A;  2B3H A;  1JAW A;  1KQ9 A;  2G6P A;  2HOW A;  5JI6 A;  2ADU A;  2NQ6 A;  4U1B A;  5FCH A;  1MAT A;  2GG0 A;  2Q8K A;  4R60 A;  1WN1 A;  1C24 A;  2B3K A;  2MAT A;  2OAZ A;  4FO7 A;  2Q95 A;  3FMR A;  4ZWP A;  2GU6 A;  2EA2 A;  5CDV A;  3IG4 A;  3CB5 A;  5CDE A;  3PKD A;  2EVC A;  3PKB A;  2GG7 A;  4U6W A;  2GG5 A;  4FLJ A;  4IDY A;  1N51 A;  3MAT A;  3FM3 A;  4U6Z A;  4ZWU A;  2BN7 A;  2GG3 A;  2EA4 A;  4IPA A;  4FO8 A;  2GGB A;  5CE6 A;  3D27 A;  1PV9 A;  3FMQ A;  1C21 A;  1W7V A;  5D6E A;  3BIT A;  3Q6D A;  4ZNG A;  4S01 A;  2BB7 A;  1WBQ A;  2Q94 A;  4EGE A;  1Y1N A;  2DFI A;  2Q92 A;  2V6C A;  2BWS A;  1KP0 A;  2GGC A;  2NQ7 A;  4PNC A;  1WY2 A;  5FCF A;  4U73 A;  2BHC A;  3IU7 A;  2BWW A;  1B6A A;  4FLK A;  4RGZ 1;  4U6C A;  2BH3 A;  2P9A A;  3CTZ A;  4HXX A;  4S2R P;  4S2T P;  4U69 A;  4RZY A;  4U71 A;  4OOK A;  4MAT A;  1KQ0 A;  4FKC A;  5CIK A;  3RVA A;  4A6V A;  4U75 A;  3IU9 A;  3BIP A;  2Q93 A;  2GTX A;  4KM3 A;  3IU8 A;  2P99 A;  1W2M A;  5CDL A;  2V3X A;  1R58 A;  1QXZ A;  4JUQ A;  2IW2 A;  4FUK A;  2BWY A;  4U6J A;  1BOA A;  1BN5 A;  4IU6 A;  1YW7 A;  3CB6 A;  1YW8 A;  4U70 A;  3MX6 A;  2GZ5 A;  4FLI A;  4S00 A;  2GG8 A;  3MR1 A;  1WKM A;  1A16 A;  2BWU A;  4IEC A;  1QXW A;  2EVM A;  1C27 A;  4U6E A;  1R5G A;  1O0X A;  4B28 A;  2BHD A;  4A6W A;  3TAV A;  1WLR A;  2GG9 A;  1XGS A;  2GU5 A;  5E5B A;  3PKA A;  2OKN A;  2ZSG A;  4IF7 A;  5JHU A;  3ROR A;  2GU7 A;  4IKR A;  4RZZ A;  1B59 A;  1CHM A;  1QZY A;  1M35 A;  2GG2 A;  3S6B A;  1WL6 A;  1YJ3 A;  5JFR A;  2BWT A;  1XNZ A;  4QR8 A;  2GA2 A;  2BWV A;  4ZWO A;  2V3Y A;  1QXY A;  3PKE A;  3PKC A;  5D6F A;  2V3Z A;  2Q96 A;  1C23 A;  1XGM A;  4Z7M A;  1C22 A;  5CNX A;  2EVO A;  3L24 A;  3L7G A;  1R5H A;  3BIQ A;  1XGN A;  2GU4 A;  2P98 A;  4FLL A;  4IKU A;  4PV4 A;  4IKS A;  2BWX A;  1YVM A;  5CLS A;  1WL9 A;  1YW9 A;  2B3L A;  2BHA A;  4U76 A;  1XGO A;  2BHB A; 
#chains in the Genus database with same CATH homology
 4IKT A;  3TB5 A;  2B3H A;  1JAW A;  1KQ9 A;  2G6P A;  2HOW A;  5JI6 A;  2ADU A;  2NQ6 A;  4U1B A;  5FCH A;  1MAT A;  2GG0 A;  2Q8K A;  4R60 A;  1WN1 A;  1C24 A;  2B3K A;  2MAT A;  2OAZ A;  4FO7 A;  2Q95 A;  3FMR A;  4ZWP A;  2GU6 A;  2EA2 A;  5CDV A;  3IG4 A;  3CB5 A;  5CDE A;  3PKD A;  2EVC A;  3PKB A;  2GG7 A;  4U6W A;  2GG5 A;  4FLJ A;  4IDY A;  1N51 A;  3MAT A;  3FM3 A;  4U6Z A;  4ZWU A;  2BN7 A;  2GG3 A;  2EA4 A;  4IPA A;  4FO8 A;  2GGB A;  5CE6 A;  3D27 A;  1PV9 A;  3FMQ A;  1C21 A;  1W7V A;  5D6E A;  3BIT A;  3Q6D A;  4ZNG A;  4S01 A;  2BB7 A;  1WBQ A;  2Q94 A;  4EGE A;  1Y1N A;  2DFI A;  2Q92 A;  2V6C A;  2BWS A;  1KP0 A;  2GGC A;  2NQ7 A;  4PNC A;  1WY2 A;  5FCF A;  4U73 A;  2BHC A;  3IU7 A;  2BWW A;  1B6A A;  4FLK A;  4RGZ 1;  4U6C A;  2BH3 A;  2P9A A;  3CTZ A;  4HXX A;  4S2R P;  4S2T P;  4U69 A;  4RZY A;  4U71 A;  4OOK A;  4MAT A;  1KQ0 A;  4FKC A;  5CIK A;  3RVA A;  4A6V A;  4U75 A;  3IU9 A;  3BIP A;  2Q93 A;  2GTX A;  4KM3 A;  3IU8 A;  2P99 A;  1W2M A;  5CDL A;  2V3X A;  1R58 A;  1QXZ A;  4JUQ A;  2IW2 A;  4FUK A;  2BWY A;  4U6J A;  1BOA A;  1BN5 A;  4IU6 A;  1YW7 A;  3CB6 A;  1YW8 A;  4U70 A;  3MX6 A;  2GZ5 A;  4FLI A;  4S00 A;  2GG8 A;  3MR1 A;  1WKM A;  1A16 A;  2BWU A;  4IEC A;  1QXW A;  2EVM A;  1C27 A;  4U6E A;  1R5G A;  1O0X A;  4B28 A;  2BHD A;  4A6W A;  3TAV A;  1WLR A;  2GG9 A;  1XGS A;  2GU5 A;  5E5B A;  3PKA A;  2OKN A;  2ZSG A;  4IF7 A;  5JHU A;  3ROR A;  2GU7 A;  4IKR A;  4RZZ A;  1B59 A;  1CHM A;  1QZY A;  1M35 A;  2GG2 A;  3S6B A;  1WL6 A;  1YJ3 A;  5JFR A;  2BWT A;  1XNZ A;  4QR8 A;  2GA2 A;  2BWV A;  4ZWO A;  2V3Y A;  1QXY A;  3PKE A;  3PKC A;  5D6F A;  2V3Z A;  2Q96 A;  1C23 A;  1XGM A;  4Z7M A;  1C22 A;  5CNX A;  2EVO A;  3L24 A;  3L7G A;  1R5H A;  3BIQ A;  1XGN A;  2GU4 A;  2P98 A;  4FLL A;  4IKU A;  4PV4 A;  4IKS A;  2BWX A;  1YVM A;  5CLS A;  1WL9 A;  1YW9 A;  2B3L A;  2BHA A;  4U76 A;  1XGO A;  2BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...