4U73A

Hsmetap(f309m) in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u73A00
2GU4A 2HOWA 2GU6A 1WY2A 5JHUA 1R5HA 1Y1NA 2B3KA 4U6WA 1C22A 1R5GA 1YJ3A 2MATA 3MR1A 4FO7A 4U76A 2GG5A 2EA2A 1M35A 2BH3A 3CB6A 4S00A 2BWTA 3FMRA 4A6VA 4U6JA 4IKTA 1BOAA 3Q6DA 1YW9A 2BWUA 3IG4A 4RZYA 2GA2A 1JAWA 2EVOA 2GG7A 4IDYA 1XNZA 3PKEA 1YVMA 2G6PA 3FM3A 5E5BA 2P98A 3S6BA 2EVCA 4U71A 4U73A 4U6EA 1WBQA 2BWWA 2V6CA 2BWVA 2Q92A 4IPAA 2GGBA 2NQ7A 2P99A 1A16A 3PKCA 2GG0A 5FCHA 1B6AA 4FO8A 4KM3A 2BHBA 2BWXA 1KQ9A 2GGCA 4FUKA 4IKRA 2IW2A 4U75A 4IU6A 4Z7MA 2ADUA 1WLRA 1B59A 3FMQA 4S01A 4QR8A 4S2TP 2DFIA 3TB5A 4B28A 4U6ZA 3D27A 4FLIA 1QXYA 1QXWA 5CLSA 4FLLA 1KQ0A 2OKNA 4EGEA 2Q93A 4R60A 1BN5A 4PNCA 4RZZA 1CHMA 2BWYA 5D6FA 3BITA 1C23A 4A6WA 1PV9A 2ZSGA 2GG3A 2GZ5A 2V3XA 2V3YA 3BIPA 1QXZA 1QZYA 5CIKA 4U6CA 2BHCA 2EA4A 2Q96A 3RORA 2GU5A 5CDEA 4FKCA 2GG8A 1WKMA 2EVMA 2V3ZA 3IU9A 5JFRA 1XGMA 2BHDA 1YW7A 1WN1A 2BWSA 2GG9A 2P9AA 3IU7A 2BB7A 4PV4A 3CTZA 4ZWPA 5CE6A 1N51A 4U69A 3PKDA 2Q94A 3PKAA 1O0XA 4U1BA 5CDVA 1MATA 2BHAA 3MX6A 4HXXA 4IKUA 1XGSA 4IKSA 2NQ6A 2GTXA 1C24A 3CB5A 5D6EA 3PKBA 5JI6A 1C27A 4S2RP 1W7VA 4MATA 4OOKA 3L24A 1XGOA 4RGZ1 3L7GA 2GU7A 2Q95A 1C21A 1YW8A 3RVAA 1WL6A 1R58A 1W2MA 4ZWUA 5CNXA 3IU8A 2B3LA 2BN7A 4ZWOA 5FCFA 2GG2A 4ZNGA 4FLJA 3TAVA 4IF7A 4U70A 1KP0A 3BIQA 4IECA 2Q8KA 5CDLA 2B3HA 3MATA 2OAZA 4JUQA 1XGNA 4FLKA 1WL9A
chains in the Genus database with same CATH superfamily
2GU4A 2HOWA 2GU6A 1WY2A 5JHUA 1R5HA 1Y1NA 2B3KA 4U6WA 1C22A 1R5GA 1YJ3A 2MATA 3MR1A 4FO7A 4U76A 2GG5A 2EA2A 1M35A 2BH3A 3CB6A 4S00A 2BWTA 3FMRA 4A6VA 4U6JA 4IKTA 1BOAA 3Q6DA 1YW9A 2BWUA 3IG4A 4RZYA 2GA2A 1JAWA 2EVOA 2GG7A 4IDYA 1XNZA 3PKEA 1YVMA 2G6PA 3FM3A 5E5BA 2P98A 3S6BA 2EVCA 4U71A 4U73A 4U6EA 1WBQA 2BWWA 2V6CA 2BWVA 2Q92A 4IPAA 2GGBA 2NQ7A 2P99A 1A16A 3PKCA 2GG0A 5FCHA 1B6AA 4FO8A 4KM3A 2BHBA 2BWXA 1KQ9A 2GGCA 4FUKA 4IKRA 2IW2A 4U75A 4IU6A 4Z7MA 2ADUA 1WLRA 1B59A 3FMQA 4S01A 4QR8A 4S2TP 2DFIA 3TB5A 4B28A 4U6ZA 3D27A 4FLIA 1QXYA 1QXWA 5CLSA 4FLLA 1KQ0A 2OKNA 4EGEA 2Q93A 4R60A 1BN5A 4PNCA 4RZZA 1CHMA 2BWYA 5D6FA 3BITA 1C23A 4A6WA 1PV9A 2ZSGA 2GG3A 2GZ5A 2V3XA 2V3YA 3BIPA 1QXZA 1QZYA 5CIKA 4U6CA 2BHCA 2EA4A 2Q96A 3RORA 2GU5A 5CDEA 4FKCA 2GG8A 1WKMA 2EVMA 2V3ZA 3IU9A 5JFRA 1XGMA 2BHDA 1YW7A 1WN1A 2BWSA 2GG9A 2P9AA 3IU7A 2BB7A 4PV4A 3CTZA 4ZWPA 5CE6A 1N51A 4U69A 3PKDA 2Q94A 3PKAA 1O0XA 4U1BA 5CDVA 1MATA 2BHAA 3MX6A 4HXXA 4IKUA 1XGSA 4IKSA 2NQ6A 2GTXA 1C24A 3CB5A 5D6EA 3PKBA 5JI6A 1C27A 4S2RP 1W7VA 4MATA 4OOKA 3L24A 1XGOA 4RGZ1 3L7GA 2GU7A 2Q95A 1C21A 1YW8A 3RVAA 1WL6A 1R58A 1W2MA 4ZWUA 5CNXA 3IU8A 2B3LA 2BN7A 4ZWOA 5FCFA 2GG2A 4ZNGA 4FLJA 3TAVA 4IF7A 4U70A 1KP0A 3BIQA 4IECA 2Q8KA 5CDLA 2B3HA 3MATA 2OAZA 4JUQA 1XGNA 4FLKA 1WL9A
chains in the Genus database with same CATH topology
2GU4A 2HOWA 2GU6A 1WY2A 5JHUA 1R5HA 1Y1NA 2B3KA 4U6WA 1C22A 1R5GA 1YJ3A 2MATA 3MR1A 4FO7A 4U76A 2GG5A 2EA2A 1M35A 2BH3A 3CB6A 4S00A 2BWTA 3FMRA 4A6VA 4U6JA 4IKTA 1BOAA 3Q6DA 1YW9A 2BWUA 3IG4A 4RZYA 2GA2A 1JAWA 2EVOA 2GG7A 4IDYA 1XNZA 3PKEA 1YVMA 2G6PA 3FM3A 5E5BA 2P98A 3S6BA 2EVCA 4U71A 4U73A 4U6EA 1WBQA 2BWWA 2V6CA 2BWVA 2Q92A 4IPAA 2GGBA 2NQ7A 2P99A 1A16A 3PKCA 2GG0A 5FCHA 1B6AA 4FO8A 4KM3A 2BHBA 2BWXA 1KQ9A 2GGCA 4FUKA 4IKRA 2IW2A 4U75A 4IU6A 4Z7MA 2ADUA 1WLRA 1B59A 3FMQA 4S01A 4QR8A 4S2TP 2DFIA 3TB5A 4B28A 4U6ZA 3D27A 4FLIA 1QXYA 1QXWA 5CLSA 4FLLA 1KQ0A 2OKNA 4EGEA 2Q93A 4R60A 1BN5A 4PNCA 4RZZA 1CHMA 2BWYA 5D6FA 3BITA 1C23A 4A6WA 1PV9A 2ZSGA 2GG3A 2GZ5A 2V3XA 2V3YA 3BIPA 1QXZA 1QZYA 5CIKA 4U6CA 2BHCA 2EA4A 2Q96A 3RORA 2GU5A 5CDEA 4FKCA 2GG8A 1WKMA 2EVMA 2V3ZA 3IU9A 5JFRA 1XGMA 2BHDA 1YW7A 1WN1A 2BWSA 2GG9A 2P9AA 3IU7A 2BB7A 4PV4A 3CTZA 4ZWPA 5CE6A 1N51A 4U69A 3PKDA 2Q94A 3PKAA 1O0XA 4U1BA 5CDVA 1MATA 2BHAA 3MX6A 4HXXA 4IKUA 1XGSA 4IKSA 2NQ6A 2GTXA 1C24A 3CB5A 5D6EA 3PKBA 5JI6A 1C27A 4S2RP 1W7VA 4MATA 4OOKA 3L24A 1XGOA 4RGZ1 3L7GA 2GU7A 2Q95A 1C21A 1YW8A 3RVAA 1WL6A 1R58A 1W2MA 4ZWUA 5CNXA 3IU8A 2B3LA 2BN7A 4ZWOA 5FCFA 2GG2A 4ZNGA 4FLJA 3TAVA 4IF7A 4U70A 1KP0A 3BIQA 4IECA 2Q8KA 5CDLA 2B3HA 3MATA 2OAZA 4JUQA 1XGNA 4FLKA 1WL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU4 A;  2HOW A;  2GU6 A;  1WY2 A;  5JHU A;  1R5H A;  1Y1N A;  2B3K A;  4U6W A;  1C22 A;  1R5G A;  1YJ3 A;  2MAT A;  3MR1 A;  4FO7 A;  4U76 A;  2GG5 A;  2EA2 A;  1M35 A;  2BH3 A;  3CB6 A;  4S00 A;  2BWT A;  3FMR A;  4A6V A;  4U6J A;  4IKT A;  1BOA A;  3Q6D A;  1YW9 A;  2BWU A;  3IG4 A;  4RZY A;  2GA2 A;  1JAW A;  2EVO A;  2GG7 A;  4IDY A;  1XNZ A;  3PKE A;  1YVM A;  2G6P A;  3FM3 A;  5E5B A;  2P98 A;  3S6B A;  2EVC A;  4U71 A;  4U73 A;  4U6E A;  1WBQ A;  2BWW A;  2V6C A;  2BWV A;  2Q92 A;  4IPA A;  2GGB A;  2NQ7 A;  2P99 A;  1A16 A;  3PKC A;  2GG0 A;  5FCH A;  1B6A A;  4FO8 A;  4KM3 A;  2BHB A;  2BWX A;  1KQ9 A;  2GGC A;  4FUK A;  4IKR A;  2IW2 A;  4U75 A;  4IU6 A;  4Z7M A;  2ADU A;  1WLR A;  1B59 A;  3FMQ A;  4S01 A;  4QR8 A;  4S2T P;  2DFI A;  3TB5 A;  4B28 A;  4U6Z A;  3D27 A;  4FLI A;  1QXY A;  1QXW A;  5CLS A;  4FLL A;  1KQ0 A;  2OKN A;  4EGE A;  2Q93 A;  4R60 A;  1BN5 A;  4PNC A;  4RZZ A;  1CHM A;  2BWY A;  5D6F A;  3BIT A;  1C23 A;  4A6W A;  1PV9 A;  2ZSG A;  2GG3 A;  2GZ5 A;  2V3X A;  2V3Y A;  3BIP A;  1QXZ A;  1QZY A;  5CIK A;  4U6C A;  2BHC A;  2EA4 A;  2Q96 A;  3ROR A;  2GU5 A;  5CDE A;  4FKC A;  2GG8 A;  1WKM A;  2EVM A;  2V3Z A;  3IU9 A;  5JFR A;  1XGM A;  2BHD A;  1YW7 A;  1WN1 A;  2BWS A;  2GG9 A;  2P9A A;  3IU7 A;  2BB7 A;  4PV4 A;  3CTZ A;  4ZWP A;  5CE6 A;  1N51 A;  4U69 A;  3PKD A;  2Q94 A;  3PKA A;  1O0X A;  4U1B A;  5CDV A;  1MAT A;  2BHA A;  3MX6 A;  4HXX A;  4IKU A;  1XGS A;  4IKS A;  2NQ6 A;  2GTX A;  1C24 A;  3CB5 A;  5D6E A;  3PKB A;  5JI6 A;  1C27 A;  4S2R P;  1W7V A;  4MAT A;  4OOK A;  3L24 A;  1XGO A;  4RGZ 1;  3L7G A;  2GU7 A;  2Q95 A;  1C21 A;  1YW8 A;  3RVA A;  1WL6 A;  1R58 A;  1W2M A;  4ZWU A;  5CNX A;  3IU8 A;  2B3L A;  2BN7 A;  4ZWO A;  5FCF A;  2GG2 A;  4ZNG A;  4FLJ A;  3TAV A;  4IF7 A;  4U70 A;  1KP0 A;  3BIQ A;  4IEC A;  2Q8K A;  5CDL A;  2B3H A;  3MAT A;  2OAZ A;  4JUQ A;  1XGN A;  4FLK A;  1WL9 A; 
#chains in the Genus database with same CATH topology
 2GU4 A;  2HOW A;  2GU6 A;  1WY2 A;  5JHU A;  1R5H A;  1Y1N A;  2B3K A;  4U6W A;  1C22 A;  1R5G A;  1YJ3 A;  2MAT A;  3MR1 A;  4FO7 A;  4U76 A;  2GG5 A;  2EA2 A;  1M35 A;  2BH3 A;  3CB6 A;  4S00 A;  2BWT A;  3FMR A;  4A6V A;  4U6J A;  4IKT A;  1BOA A;  3Q6D A;  1YW9 A;  2BWU A;  3IG4 A;  4RZY A;  2GA2 A;  1JAW A;  2EVO A;  2GG7 A;  4IDY A;  1XNZ A;  3PKE A;  1YVM A;  2G6P A;  3FM3 A;  5E5B A;  2P98 A;  3S6B A;  2EVC A;  4U71 A;  4U73 A;  4U6E A;  1WBQ A;  2BWW A;  2V6C A;  2BWV A;  2Q92 A;  4IPA A;  2GGB A;  2NQ7 A;  2P99 A;  1A16 A;  3PKC A;  2GG0 A;  5FCH A;  1B6A A;  4FO8 A;  4KM3 A;  2BHB A;  2BWX A;  1KQ9 A;  2GGC A;  4FUK A;  4IKR A;  2IW2 A;  4U75 A;  4IU6 A;  4Z7M A;  2ADU A;  1WLR A;  1B59 A;  3FMQ A;  4S01 A;  4QR8 A;  4S2T P;  2DFI A;  3TB5 A;  4B28 A;  4U6Z A;  3D27 A;  4FLI A;  1QXY A;  1QXW A;  5CLS A;  4FLL A;  1KQ0 A;  2OKN A;  4EGE A;  2Q93 A;  4R60 A;  1BN5 A;  4PNC A;  4RZZ A;  1CHM A;  2BWY A;  5D6F A;  3BIT A;  1C23 A;  4A6W A;  1PV9 A;  2ZSG A;  2GG3 A;  2GZ5 A;  2V3X A;  2V3Y A;  3BIP A;  1QXZ A;  1QZY A;  5CIK A;  4U6C A;  2BHC A;  2EA4 A;  2Q96 A;  3ROR A;  2GU5 A;  5CDE A;  4FKC A;  2GG8 A;  1WKM A;  2EVM A;  2V3Z A;  3IU9 A;  5JFR A;  1XGM A;  2BHD A;  1YW7 A;  1WN1 A;  2BWS A;  2GG9 A;  2P9A A;  3IU7 A;  2BB7 A;  4PV4 A;  3CTZ A;  4ZWP A;  5CE6 A;  1N51 A;  4U69 A;  3PKD A;  2Q94 A;  3PKA A;  1O0X A;  4U1B A;  5CDV A;  1MAT A;  2BHA A;  3MX6 A;  4HXX A;  4IKU A;  1XGS A;  4IKS A;  2NQ6 A;  2GTX A;  1C24 A;  3CB5 A;  5D6E A;  3PKB A;  5JI6 A;  1C27 A;  4S2R P;  1W7V A;  4MAT A;  4OOK A;  3L24 A;  1XGO A;  4RGZ 1;  3L7G A;  2GU7 A;  2Q95 A;  1C21 A;  1YW8 A;  3RVA A;  1WL6 A;  1R58 A;  1W2M A;  4ZWU A;  5CNX A;  3IU8 A;  2B3L A;  2BN7 A;  4ZWO A;  5FCF A;  2GG2 A;  4ZNG A;  4FLJ A;  3TAV A;  4IF7 A;  4U70 A;  1KP0 A;  3BIQ A;  4IEC A;  2Q8K A;  5CDL A;  2B3H A;  3MAT A;  2OAZ A;  4JUQ A;  1XGN A;  4FLK A;  1WL9 A; 
#chains in the Genus database with same CATH homology
 2GU4 A;  2HOW A;  2GU6 A;  1WY2 A;  5JHU A;  1R5H A;  1Y1N A;  2B3K A;  4U6W A;  1C22 A;  1R5G A;  1YJ3 A;  2MAT A;  3MR1 A;  4FO7 A;  4U76 A;  2GG5 A;  2EA2 A;  1M35 A;  2BH3 A;  3CB6 A;  4S00 A;  2BWT A;  3FMR A;  4A6V A;  4U6J A;  4IKT A;  1BOA A;  3Q6D A;  1YW9 A;  2BWU A;  3IG4 A;  4RZY A;  2GA2 A;  1JAW A;  2EVO A;  2GG7 A;  4IDY A;  1XNZ A;  3PKE A;  1YVM A;  2G6P A;  3FM3 A;  5E5B A;  2P98 A;  3S6B A;  2EVC A;  4U71 A;  4U73 A;  4U6E A;  1WBQ A;  2BWW A;  2V6C A;  2BWV A;  2Q92 A;  4IPA A;  2GGB A;  2NQ7 A;  2P99 A;  1A16 A;  3PKC A;  2GG0 A;  5FCH A;  1B6A A;  4FO8 A;  4KM3 A;  2BHB A;  2BWX A;  1KQ9 A;  2GGC A;  4FUK A;  4IKR A;  2IW2 A;  4U75 A;  4IU6 A;  4Z7M A;  2ADU A;  1WLR A;  1B59 A;  3FMQ A;  4S01 A;  4QR8 A;  4S2T P;  2DFI A;  3TB5 A;  4B28 A;  4U6Z A;  3D27 A;  4FLI A;  1QXY A;  1QXW A;  5CLS A;  4FLL A;  1KQ0 A;  2OKN A;  4EGE A;  2Q93 A;  4R60 A;  1BN5 A;  4PNC A;  4RZZ A;  1CHM A;  2BWY A;  5D6F A;  3BIT A;  1C23 A;  4A6W A;  1PV9 A;  2ZSG A;  2GG3 A;  2GZ5 A;  2V3X A;  2V3Y A;  3BIP A;  1QXZ A;  1QZY A;  5CIK A;  4U6C A;  2BHC A;  2EA4 A;  2Q96 A;  3ROR A;  2GU5 A;  5CDE A;  4FKC A;  2GG8 A;  1WKM A;  2EVM A;  2V3Z A;  3IU9 A;  5JFR A;  1XGM A;  2BHD A;  1YW7 A;  1WN1 A;  2BWS A;  2GG9 A;  2P9A A;  3IU7 A;  2BB7 A;  4PV4 A;  3CTZ A;  4ZWP A;  5CE6 A;  1N51 A;  4U69 A;  3PKD A;  2Q94 A;  3PKA A;  1O0X A;  4U1B A;  5CDV A;  1MAT A;  2BHA A;  3MX6 A;  4HXX A;  4IKU A;  1XGS A;  4IKS A;  2NQ6 A;  2GTX A;  1C24 A;  3CB5 A;  5D6E A;  3PKB A;  5JI6 A;  1C27 A;  4S2R P;  1W7V A;  4MAT A;  4OOK A;  3L24 A;  1XGO A;  4RGZ 1;  3L7G A;  2GU7 A;  2Q95 A;  1C21 A;  1YW8 A;  3RVA A;  1WL6 A;  1R58 A;  1W2M A;  4ZWU A;  5CNX A;  3IU8 A;  2B3L A;  2BN7 A;  4ZWO A;  5FCF A;  2GG2 A;  4ZNG A;  4FLJ A;  3TAV A;  4IF7 A;  4U70 A;  1KP0 A;  3BIQ A;  4IEC A;  2Q8K A;  5CDL A;  2B3H A;  3MAT A;  2OAZ A;  4JUQ A;  1XGN A;  4FLK A;  1WL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...