4U73A

Hsmetap(f309m) in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u73A00
2BWWA 2P99A 1C22A 1KQ9A 3FMQA 4S2RP 4FUKA 2GA2A 2GU6A 4IKTA 2Q95A 4IECA 5D6FA 1R58A 4U6ZA 1XNZA 5CNXA 1YVMA 2ZSGA 2EVOA 2BWXA 1YJ3A 3MATA 4EGEA 2GG5A 2BHDA 1R5GA 4ZNGA 5FCFA 4FLJA 1B59A 4RZYA 2BHAA 2Q94A 3IU8A 1C21A 2NQ6A 1QXYA 4A6VA 2BWYA 3Q6DA 4U70A 2BN7A 1YW8A 1B6AA 4S01A 2GZ5A 3TAVA 2GG2A 4PNCA 1CHMA 1WKMA 2OKNA 4R60A 2BB7A 2BHBA 3FMRA 4U76A 1XGSA 3CTZA 1QXWA 2GG7A 2V6CA 4KM3A 3RORA 4IKSA 2B3LA 4IPAA 1YW9A 2V3YA 3MR1A 5CLSA 3BIQA 3IU9A 4U73A 2GG9A 4U6WA 1WL6A 1PV9A 2IW2A 1KQ0A 2BWUA 2OAZA 5JFRA 3CB6A 1C24A 5D6EA 2GU4A 4S00A 1C23A 4HXXA 4PV4A 5E5BA 1M35A 4FLKA 2B3HA 4MATA 2MATA 3PKBA 4FLLA 1Y1NA 2GG3A 2GGCA 3D27A 3MX6A 4IKUA 1BN5A 2GU7A 5CDEA 4U6JA 2V3ZA 4A6WA 5CIKA 1N51A 1W7VA 3BITA 2ADUA 4FO8A 3IU7A 1KP0A 1YW7A 1XGNA 2GTXA 2GU5A 2Q96A 1C27A 1MATA 2EA4A 2P9AA 1WBQA 2Q92A 2DFIA 1W2MA 4FKCA 1BOAA 4ZWOA 1A16A 1XGOA 3PKCA 2Q93A 2GG0A 5CDLA 4RGZ1 2HOWA 2B3KA 1R5HA 4U6CA 3PKEA 1WL9A 2BWTA 2EVCA 4U1BA 1XGMA 4RZZA 4ZWPA 2BH3A 4IDYA 5CE6A 1O0XA 4U69A 3RVAA 3L24A 4FLIA 4QR8A 4IF7A 3CB5A 4B28A 1QXZA 1QZYA 1WY2A 2G6PA 4U75A 3BIPA 5CDVA 5JI6A 4FO7A 2EVMA 2Q8KA 4U6EA 4IKRA 1WN1A 3S6BA 2NQ7A 4IU6A 3L7GA 4S2TP 2BHCA 2BWVA 2GG8A 4Z7MA 4OOKA 4U71A 3IG4A 5FCHA 2P98A 3PKDA 2BWSA 4JUQA 2GGBA 3TB5A 3PKAA 5JHUA 4ZWUA 2V3XA 1WLRA 1JAWA 2EA2A 3FM3A
chains in the Genus database with same CATH superfamily
2BWWA 2P99A 1C22A 1KQ9A 3FMQA 4S2RP 4FUKA 2GA2A 2GU6A 4IKTA 2Q95A 4IECA 5D6FA 1R58A 4U6ZA 1XNZA 5CNXA 1YVMA 2ZSGA 2EVOA 2BWXA 1YJ3A 3MATA 4EGEA 2GG5A 2BHDA 1R5GA 4ZNGA 5FCFA 4FLJA 1B59A 4RZYA 2BHAA 2Q94A 3IU8A 1C21A 2NQ6A 1QXYA 4A6VA 2BWYA 3Q6DA 4U70A 2BN7A 1YW8A 1B6AA 4S01A 2GZ5A 3TAVA 2GG2A 4PNCA 1CHMA 1WKMA 2OKNA 4R60A 2BB7A 2BHBA 3FMRA 4U76A 1XGSA 3CTZA 1QXWA 2GG7A 2V6CA 4KM3A 3RORA 4IKSA 2B3LA 4IPAA 1YW9A 2V3YA 3MR1A 5CLSA 3BIQA 3IU9A 4U73A 2GG9A 4U6WA 1WL6A 1PV9A 2IW2A 1KQ0A 2BWUA 2OAZA 5JFRA 3CB6A 1C24A 5D6EA 2GU4A 4S00A 1C23A 4HXXA 4PV4A 5E5BA 1M35A 4FLKA 2B3HA 4MATA 2MATA 3PKBA 4FLLA 1Y1NA 2GG3A 2GGCA 3D27A 3MX6A 4IKUA 1BN5A 2GU7A 5CDEA 4U6JA 2V3ZA 4A6WA 5CIKA 1N51A 1W7VA 3BITA 2ADUA 4FO8A 3IU7A 1KP0A 1YW7A 1XGNA 2GTXA 2GU5A 2Q96A 1C27A 1MATA 2EA4A 2P9AA 1WBQA 2Q92A 2DFIA 1W2MA 4FKCA 1BOAA 4ZWOA 1A16A 1XGOA 3PKCA 2Q93A 2GG0A 5CDLA 4RGZ1 2HOWA 2B3KA 1R5HA 4U6CA 3PKEA 1WL9A 2BWTA 2EVCA 4U1BA 1XGMA 4RZZA 4ZWPA 2BH3A 4IDYA 5CE6A 1O0XA 4U69A 3RVAA 3L24A 4FLIA 4QR8A 4IF7A 3CB5A 4B28A 1QXZA 1QZYA 1WY2A 2G6PA 4U75A 3BIPA 5CDVA 5JI6A 4FO7A 2EVMA 2Q8KA 4U6EA 4IKRA 1WN1A 3S6BA 2NQ7A 4IU6A 3L7GA 4S2TP 2BHCA 2BWVA 2GG8A 4Z7MA 4OOKA 4U71A 3IG4A 5FCHA 2P98A 3PKDA 2BWSA 4JUQA 2GGBA 3TB5A 3PKAA 5JHUA 4ZWUA 2V3XA 1WLRA 1JAWA 2EA2A 3FM3A
chains in the Genus database with same CATH topology
2BWWA 2P99A 1C22A 1KQ9A 3FMQA 4S2RP 4FUKA 2GA2A 2GU6A 4IKTA 2Q95A 4IECA 5D6FA 1R58A 4U6ZA 1XNZA 5CNXA 1YVMA 2ZSGA 2EVOA 2BWXA 1YJ3A 3MATA 4EGEA 2GG5A 2BHDA 1R5GA 4ZNGA 5FCFA 4FLJA 1B59A 4RZYA 2BHAA 2Q94A 3IU8A 1C21A 2NQ6A 1QXYA 4A6VA 2BWYA 3Q6DA 4U70A 2BN7A 1YW8A 1B6AA 4S01A 2GZ5A 3TAVA 2GG2A 4PNCA 1CHMA 1WKMA 2OKNA 4R60A 2BB7A 2BHBA 3FMRA 4U76A 1XGSA 3CTZA 1QXWA 2GG7A 2V6CA 4KM3A 3RORA 4IKSA 2B3LA 4IPAA 1YW9A 2V3YA 3MR1A 5CLSA 3BIQA 3IU9A 4U73A 2GG9A 4U6WA 1WL6A 1PV9A 2IW2A 1KQ0A 2BWUA 2OAZA 5JFRA 3CB6A 1C24A 5D6EA 2GU4A 4S00A 1C23A 4HXXA 4PV4A 5E5BA 1M35A 4FLKA 2B3HA 4MATA 2MATA 3PKBA 4FLLA 1Y1NA 2GG3A 2GGCA 3D27A 3MX6A 4IKUA 1BN5A 2GU7A 5CDEA 4U6JA 2V3ZA 4A6WA 5CIKA 1N51A 1W7VA 3BITA 2ADUA 4FO8A 3IU7A 1KP0A 1YW7A 1XGNA 2GTXA 2GU5A 2Q96A 1C27A 1MATA 2EA4A 2P9AA 1WBQA 2Q92A 2DFIA 1W2MA 4FKCA 1BOAA 4ZWOA 1A16A 1XGOA 3PKCA 2Q93A 2GG0A 5CDLA 4RGZ1 2HOWA 2B3KA 1R5HA 4U6CA 3PKEA 1WL9A 2BWTA 2EVCA 4U1BA 1XGMA 4RZZA 4ZWPA 2BH3A 4IDYA 5CE6A 1O0XA 4U69A 3RVAA 3L24A 4FLIA 4QR8A 4IF7A 3CB5A 4B28A 1QXZA 1QZYA 1WY2A 2G6PA 4U75A 3BIPA 5CDVA 5JI6A 4FO7A 2EVMA 2Q8KA 4U6EA 4IKRA 1WN1A 3S6BA 2NQ7A 4IU6A 3L7GA 4S2TP 2BHCA 2BWVA 2GG8A 4Z7MA 4OOKA 4U71A 3IG4A 5FCHA 2P98A 3PKDA 2BWSA 4JUQA 2GGBA 3TB5A 3PKAA 5JHUA 4ZWUA 2V3XA 1WLRA 1JAWA 2EA2A 3FM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWW A;  2P99 A;  1C22 A;  1KQ9 A;  3FMQ A;  4S2R P;  4FUK A;  2GA2 A;  2GU6 A;  4IKT A;  2Q95 A;  4IEC A;  5D6F A;  1R58 A;  4U6Z A;  1XNZ A;  5CNX A;  1YVM A;  2ZSG A;  2EVO A;  2BWX A;  1YJ3 A;  3MAT A;  4EGE A;  2GG5 A;  2BHD A;  1R5G A;  4ZNG A;  5FCF A;  4FLJ A;  1B59 A;  4RZY A;  2BHA A;  2Q94 A;  3IU8 A;  1C21 A;  2NQ6 A;  1QXY A;  4A6V A;  2BWY A;  3Q6D A;  4U70 A;  2BN7 A;  1YW8 A;  1B6A A;  4S01 A;  2GZ5 A;  3TAV A;  2GG2 A;  4PNC A;  1CHM A;  1WKM A;  2OKN A;  4R60 A;  2BB7 A;  2BHB A;  3FMR A;  4U76 A;  1XGS A;  3CTZ A;  1QXW A;  2GG7 A;  2V6C A;  4KM3 A;  3ROR A;  4IKS A;  2B3L A;  4IPA A;  1YW9 A;  2V3Y A;  3MR1 A;  5CLS A;  3BIQ A;  3IU9 A;  4U73 A;  2GG9 A;  4U6W A;  1WL6 A;  1PV9 A;  2IW2 A;  1KQ0 A;  2BWU A;  2OAZ A;  5JFR A;  3CB6 A;  1C24 A;  5D6E A;  2GU4 A;  4S00 A;  1C23 A;  4HXX A;  4PV4 A;  5E5B A;  1M35 A;  4FLK A;  2B3H A;  4MAT A;  2MAT A;  3PKB A;  4FLL A;  1Y1N A;  2GG3 A;  2GGC A;  3D27 A;  3MX6 A;  4IKU A;  1BN5 A;  2GU7 A;  5CDE A;  4U6J A;  2V3Z A;  4A6W A;  5CIK A;  1N51 A;  1W7V A;  3BIT A;  2ADU A;  4FO8 A;  3IU7 A;  1KP0 A;  1YW7 A;  1XGN A;  2GTX A;  2GU5 A;  2Q96 A;  1C27 A;  1MAT A;  2EA4 A;  2P9A A;  1WBQ A;  2Q92 A;  2DFI A;  1W2M A;  4FKC A;  1BOA A;  4ZWO A;  1A16 A;  1XGO A;  3PKC A;  2Q93 A;  2GG0 A;  5CDL A;  4RGZ 1;  2HOW A;  2B3K A;  1R5H A;  4U6C A;  3PKE A;  1WL9 A;  2BWT A;  2EVC A;  4U1B A;  1XGM A;  4RZZ A;  4ZWP A;  2BH3 A;  4IDY A;  5CE6 A;  1O0X A;  4U69 A;  3RVA A;  3L24 A;  4FLI A;  4QR8 A;  4IF7 A;  3CB5 A;  4B28 A;  1QXZ A;  1QZY A;  1WY2 A;  2G6P A;  4U75 A;  3BIP A;  5CDV A;  5JI6 A;  4FO7 A;  2EVM A;  2Q8K A;  4U6E A;  4IKR A;  1WN1 A;  3S6B A;  2NQ7 A;  4IU6 A;  3L7G A;  4S2T P;  2BHC A;  2BWV A;  2GG8 A;  4Z7M A;  4OOK A;  4U71 A;  3IG4 A;  5FCH A;  2P98 A;  3PKD A;  2BWS A;  4JUQ A;  2GGB A;  3TB5 A;  3PKA A;  5JHU A;  4ZWU A;  2V3X A;  1WLR A;  1JAW A;  2EA2 A;  3FM3 A; 
#chains in the Genus database with same CATH topology
 2BWW A;  2P99 A;  1C22 A;  1KQ9 A;  3FMQ A;  4S2R P;  4FUK A;  2GA2 A;  2GU6 A;  4IKT A;  2Q95 A;  4IEC A;  5D6F A;  1R58 A;  4U6Z A;  1XNZ A;  5CNX A;  1YVM A;  2ZSG A;  2EVO A;  2BWX A;  1YJ3 A;  3MAT A;  4EGE A;  2GG5 A;  2BHD A;  1R5G A;  4ZNG A;  5FCF A;  4FLJ A;  1B59 A;  4RZY A;  2BHA A;  2Q94 A;  3IU8 A;  1C21 A;  2NQ6 A;  1QXY A;  4A6V A;  2BWY A;  3Q6D A;  4U70 A;  2BN7 A;  1YW8 A;  1B6A A;  4S01 A;  2GZ5 A;  3TAV A;  2GG2 A;  4PNC A;  1CHM A;  1WKM A;  2OKN A;  4R60 A;  2BB7 A;  2BHB A;  3FMR A;  4U76 A;  1XGS A;  3CTZ A;  1QXW A;  2GG7 A;  2V6C A;  4KM3 A;  3ROR A;  4IKS A;  2B3L A;  4IPA A;  1YW9 A;  2V3Y A;  3MR1 A;  5CLS A;  3BIQ A;  3IU9 A;  4U73 A;  2GG9 A;  4U6W A;  1WL6 A;  1PV9 A;  2IW2 A;  1KQ0 A;  2BWU A;  2OAZ A;  5JFR A;  3CB6 A;  1C24 A;  5D6E A;  2GU4 A;  4S00 A;  1C23 A;  4HXX A;  4PV4 A;  5E5B A;  1M35 A;  4FLK A;  2B3H A;  4MAT A;  2MAT A;  3PKB A;  4FLL A;  1Y1N A;  2GG3 A;  2GGC A;  3D27 A;  3MX6 A;  4IKU A;  1BN5 A;  2GU7 A;  5CDE A;  4U6J A;  2V3Z A;  4A6W A;  5CIK A;  1N51 A;  1W7V A;  3BIT A;  2ADU A;  4FO8 A;  3IU7 A;  1KP0 A;  1YW7 A;  1XGN A;  2GTX A;  2GU5 A;  2Q96 A;  1C27 A;  1MAT A;  2EA4 A;  2P9A A;  1WBQ A;  2Q92 A;  2DFI A;  1W2M A;  4FKC A;  1BOA A;  4ZWO A;  1A16 A;  1XGO A;  3PKC A;  2Q93 A;  2GG0 A;  5CDL A;  4RGZ 1;  2HOW A;  2B3K A;  1R5H A;  4U6C A;  3PKE A;  1WL9 A;  2BWT A;  2EVC A;  4U1B A;  1XGM A;  4RZZ A;  4ZWP A;  2BH3 A;  4IDY A;  5CE6 A;  1O0X A;  4U69 A;  3RVA A;  3L24 A;  4FLI A;  4QR8 A;  4IF7 A;  3CB5 A;  4B28 A;  1QXZ A;  1QZY A;  1WY2 A;  2G6P A;  4U75 A;  3BIP A;  5CDV A;  5JI6 A;  4FO7 A;  2EVM A;  2Q8K A;  4U6E A;  4IKR A;  1WN1 A;  3S6B A;  2NQ7 A;  4IU6 A;  3L7G A;  4S2T P;  2BHC A;  2BWV A;  2GG8 A;  4Z7M A;  4OOK A;  4U71 A;  3IG4 A;  5FCH A;  2P98 A;  3PKD A;  2BWS A;  4JUQ A;  2GGB A;  3TB5 A;  3PKA A;  5JHU A;  4ZWU A;  2V3X A;  1WLR A;  1JAW A;  2EA2 A;  3FM3 A; 
#chains in the Genus database with same CATH homology
 2BWW A;  2P99 A;  1C22 A;  1KQ9 A;  3FMQ A;  4S2R P;  4FUK A;  2GA2 A;  2GU6 A;  4IKT A;  2Q95 A;  4IEC A;  5D6F A;  1R58 A;  4U6Z A;  1XNZ A;  5CNX A;  1YVM A;  2ZSG A;  2EVO A;  2BWX A;  1YJ3 A;  3MAT A;  4EGE A;  2GG5 A;  2BHD A;  1R5G A;  4ZNG A;  5FCF A;  4FLJ A;  1B59 A;  4RZY A;  2BHA A;  2Q94 A;  3IU8 A;  1C21 A;  2NQ6 A;  1QXY A;  4A6V A;  2BWY A;  3Q6D A;  4U70 A;  2BN7 A;  1YW8 A;  1B6A A;  4S01 A;  2GZ5 A;  3TAV A;  2GG2 A;  4PNC A;  1CHM A;  1WKM A;  2OKN A;  4R60 A;  2BB7 A;  2BHB A;  3FMR A;  4U76 A;  1XGS A;  3CTZ A;  1QXW A;  2GG7 A;  2V6C A;  4KM3 A;  3ROR A;  4IKS A;  2B3L A;  4IPA A;  1YW9 A;  2V3Y A;  3MR1 A;  5CLS A;  3BIQ A;  3IU9 A;  4U73 A;  2GG9 A;  4U6W A;  1WL6 A;  1PV9 A;  2IW2 A;  1KQ0 A;  2BWU A;  2OAZ A;  5JFR A;  3CB6 A;  1C24 A;  5D6E A;  2GU4 A;  4S00 A;  1C23 A;  4HXX A;  4PV4 A;  5E5B A;  1M35 A;  4FLK A;  2B3H A;  4MAT A;  2MAT A;  3PKB A;  4FLL A;  1Y1N A;  2GG3 A;  2GGC A;  3D27 A;  3MX6 A;  4IKU A;  1BN5 A;  2GU7 A;  5CDE A;  4U6J A;  2V3Z A;  4A6W A;  5CIK A;  1N51 A;  1W7V A;  3BIT A;  2ADU A;  4FO8 A;  3IU7 A;  1KP0 A;  1YW7 A;  1XGN A;  2GTX A;  2GU5 A;  2Q96 A;  1C27 A;  1MAT A;  2EA4 A;  2P9A A;  1WBQ A;  2Q92 A;  2DFI A;  1W2M A;  4FKC A;  1BOA A;  4ZWO A;  1A16 A;  1XGO A;  3PKC A;  2Q93 A;  2GG0 A;  5CDL A;  4RGZ 1;  2HOW A;  2B3K A;  1R5H A;  4U6C A;  3PKE A;  1WL9 A;  2BWT A;  2EVC A;  4U1B A;  1XGM A;  4RZZ A;  4ZWP A;  2BH3 A;  4IDY A;  5CE6 A;  1O0X A;  4U69 A;  3RVA A;  3L24 A;  4FLI A;  4QR8 A;  4IF7 A;  3CB5 A;  4B28 A;  1QXZ A;  1QZY A;  1WY2 A;  2G6P A;  4U75 A;  3BIP A;  5CDV A;  5JI6 A;  4FO7 A;  2EVM A;  2Q8K A;  4U6E A;  4IKR A;  1WN1 A;  3S6B A;  2NQ7 A;  4IU6 A;  3L7G A;  4S2T P;  2BHC A;  2BWV A;  2GG8 A;  4Z7M A;  4OOK A;  4U71 A;  3IG4 A;  5FCH A;  2P98 A;  3PKD A;  2BWS A;  4JUQ A;  2GGB A;  3TB5 A;  3PKA A;  5JHU A;  4ZWU A;  2V3X A;  1WLR A;  1JAW A;  2EA2 A;  3FM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...