4U73A

Hsmetap(f309m) in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u73A00
3BIQA 1WL6A 1YJ3A 4ZWPA 1C21A 4IPAA 2BWVA 2GGCA 2V3YA 4Z7MA 1QZYA 4IKSA 2NQ7A 4RZYA 2BWTA 1YW9A 5JHUA 2EA4A 1JAWA 3IG4A 1XGNA 1QXZA 2BHDA 2BWUA 2EVCA 4FLLA 1XGOA 1C24A 4JUQA 1B6AA 3FM3A 4IU6A 5CDLA 4IDYA 4A6WA 1O0XA 1MATA 2GU4A 2DFIA 3CB5A 4EGEA 2Q8KA 3D27A 2EA2A 4OOKA 1R58A 3L7GA 2Q95A 1WBQA 1QXWA 2BWWA 3IU8A 4ZWUA 5CDEA 2BN7A 4FO8A 2GU7A 4PV4A 3TB5A 2GU6A 3MX6A 5D6EA 2BWXA 2BB7A 4U69A 1KP0A 1YVMA 4HXXA 1W7VA 2OKNA 2GGBA 4U75A 1C27A 2Q94A 4U6WA 2EVMA 2MATA 2GA2A 3MATA 4IF7A 2BWYA 4MATA 1YW7A 1WY2A 3PKAA 2EVOA 1M35A 1WLRA 4U71A 1A16A 2GG2A 1WKMA 2P99A 1C23A 3PKDA 2BHAA 4QR8A 4U73A 3MR1A 1KQ9A 4U6JA 1N51A 1WN1A 3RORA 2P98A 2BH3A 2GG0A 4FLJA 4B28A 3FMQA 1CHMA 2GZ5A 2GG5A 5D6FA 3CTZA 2Q93A 2Q92A 1R5GA 1XGMA 2ZSGA 4S00A 4ZWOA 4IKRA 5CE6A 1YW8A 4U6CA 3PKCA 2B3LA 4S2TP 4U6EA 4ZNGA 5E5BA 5CLSA 4U6ZA 4FKCA 1BOAA 4R60A 2GG8A 5FCFA 2G6PA 2BHCA 4FLIA 4S01A 2V6CA 4RZZA 3IU7A 4RGZ1 5JI6A 1WL9A 2NQ6A 4FO7A 2GU5A 5CIKA 4A6VA 1W2MA 2GTXA 3BIPA 2OAZA 4IECA 5CDVA 1QXYA 1XNZA 1C22A 2Q96A 2HOWA 2IW2A 1KQ0A 4IKUA 4KM3A 2BHBA 5FCHA 2B3KA 1B59A 4U70A 1BN5A 1PV9A 1XGSA 2B3HA 2V3ZA 4IKTA 3RVAA 3TAVA 3Q6DA 3FMRA 2GG9A 3CB6A 1R5HA 2BWSA 2P9AA 5CNXA 3L24A 4PNCA 3PKBA 4U76A 3S6BA 2ADUA 4U1BA 2GG3A 4S2RP 3PKEA 5JFRA 3BITA 2V3XA 3IU9A 1Y1NA 4FUKA 4FLKA 2GG7A
chains in the Genus database with same CATH superfamily
3BIQA 1WL6A 1YJ3A 4ZWPA 1C21A 4IPAA 2BWVA 2GGCA 2V3YA 4Z7MA 1QZYA 4IKSA 2NQ7A 4RZYA 2BWTA 1YW9A 5JHUA 2EA4A 1JAWA 3IG4A 1XGNA 1QXZA 2BHDA 2BWUA 2EVCA 4FLLA 1XGOA 1C24A 4JUQA 1B6AA 3FM3A 4IU6A 5CDLA 4IDYA 4A6WA 1O0XA 1MATA 2GU4A 2DFIA 3CB5A 4EGEA 2Q8KA 3D27A 2EA2A 4OOKA 1R58A 3L7GA 2Q95A 1WBQA 1QXWA 2BWWA 3IU8A 4ZWUA 5CDEA 2BN7A 4FO8A 2GU7A 4PV4A 3TB5A 2GU6A 3MX6A 5D6EA 2BWXA 2BB7A 4U69A 1KP0A 1YVMA 4HXXA 1W7VA 2OKNA 2GGBA 4U75A 1C27A 2Q94A 4U6WA 2EVMA 2MATA 2GA2A 3MATA 4IF7A 2BWYA 4MATA 1YW7A 1WY2A 3PKAA 2EVOA 1M35A 1WLRA 4U71A 1A16A 2GG2A 1WKMA 2P99A 1C23A 3PKDA 2BHAA 4QR8A 4U73A 3MR1A 1KQ9A 4U6JA 1N51A 1WN1A 3RORA 2P98A 2BH3A 2GG0A 4FLJA 4B28A 3FMQA 1CHMA 2GZ5A 2GG5A 5D6FA 3CTZA 2Q93A 2Q92A 1R5GA 1XGMA 2ZSGA 4S00A 4ZWOA 4IKRA 5CE6A 1YW8A 4U6CA 3PKCA 2B3LA 4S2TP 4U6EA 4ZNGA 5E5BA 5CLSA 4U6ZA 4FKCA 1BOAA 4R60A 2GG8A 5FCFA 2G6PA 2BHCA 4FLIA 4S01A 2V6CA 4RZZA 3IU7A 4RGZ1 5JI6A 1WL9A 2NQ6A 4FO7A 2GU5A 5CIKA 4A6VA 1W2MA 2GTXA 3BIPA 2OAZA 4IECA 5CDVA 1QXYA 1XNZA 1C22A 2Q96A 2HOWA 2IW2A 1KQ0A 4IKUA 4KM3A 2BHBA 5FCHA 2B3KA 1B59A 4U70A 1BN5A 1PV9A 1XGSA 2B3HA 2V3ZA 4IKTA 3RVAA 3TAVA 3Q6DA 3FMRA 2GG9A 3CB6A 1R5HA 2BWSA 2P9AA 5CNXA 3L24A 4PNCA 3PKBA 4U76A 3S6BA 2ADUA 4U1BA 2GG3A 4S2RP 3PKEA 5JFRA 3BITA 2V3XA 3IU9A 1Y1NA 4FUKA 4FLKA 2GG7A
chains in the Genus database with same CATH topology
3BIQA 1WL6A 1YJ3A 4ZWPA 1C21A 4IPAA 2BWVA 2GGCA 2V3YA 4Z7MA 1QZYA 4IKSA 2NQ7A 4RZYA 2BWTA 1YW9A 5JHUA 2EA4A 1JAWA 3IG4A 1XGNA 1QXZA 2BHDA 2BWUA 2EVCA 4FLLA 1XGOA 1C24A 4JUQA 1B6AA 3FM3A 4IU6A 5CDLA 4IDYA 4A6WA 1O0XA 1MATA 2GU4A 2DFIA 3CB5A 4EGEA 2Q8KA 3D27A 2EA2A 4OOKA 1R58A 3L7GA 2Q95A 1WBQA 1QXWA 2BWWA 3IU8A 4ZWUA 5CDEA 2BN7A 4FO8A 2GU7A 4PV4A 3TB5A 2GU6A 3MX6A 5D6EA 2BWXA 2BB7A 4U69A 1KP0A 1YVMA 4HXXA 1W7VA 2OKNA 2GGBA 4U75A 1C27A 2Q94A 4U6WA 2EVMA 2MATA 2GA2A 3MATA 4IF7A 2BWYA 4MATA 1YW7A 1WY2A 3PKAA 2EVOA 1M35A 1WLRA 4U71A 1A16A 2GG2A 1WKMA 2P99A 1C23A 3PKDA 2BHAA 4QR8A 4U73A 3MR1A 1KQ9A 4U6JA 1N51A 1WN1A 3RORA 2P98A 2BH3A 2GG0A 4FLJA 4B28A 3FMQA 1CHMA 2GZ5A 2GG5A 5D6FA 3CTZA 2Q93A 2Q92A 1R5GA 1XGMA 2ZSGA 4S00A 4ZWOA 4IKRA 5CE6A 1YW8A 4U6CA 3PKCA 2B3LA 4S2TP 4U6EA 4ZNGA 5E5BA 5CLSA 4U6ZA 4FKCA 1BOAA 4R60A 2GG8A 5FCFA 2G6PA 2BHCA 4FLIA 4S01A 2V6CA 4RZZA 3IU7A 4RGZ1 5JI6A 1WL9A 2NQ6A 4FO7A 2GU5A 5CIKA 4A6VA 1W2MA 2GTXA 3BIPA 2OAZA 4IECA 5CDVA 1QXYA 1XNZA 1C22A 2Q96A 2HOWA 2IW2A 1KQ0A 4IKUA 4KM3A 2BHBA 5FCHA 2B3KA 1B59A 4U70A 1BN5A 1PV9A 1XGSA 2B3HA 2V3ZA 4IKTA 3RVAA 3TAVA 3Q6DA 3FMRA 2GG9A 3CB6A 1R5HA 2BWSA 2P9AA 5CNXA 3L24A 4PNCA 3PKBA 4U76A 3S6BA 2ADUA 4U1BA 2GG3A 4S2RP 3PKEA 5JFRA 3BITA 2V3XA 3IU9A 1Y1NA 4FUKA 4FLKA 2GG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIQ A;  1WL6 A;  1YJ3 A;  4ZWP A;  1C21 A;  4IPA A;  2BWV A;  2GGC A;  2V3Y A;  4Z7M A;  1QZY A;  4IKS A;  2NQ7 A;  4RZY A;  2BWT A;  1YW9 A;  5JHU A;  2EA4 A;  1JAW A;  3IG4 A;  1XGN A;  1QXZ A;  2BHD A;  2BWU A;  2EVC A;  4FLL A;  1XGO A;  1C24 A;  4JUQ A;  1B6A A;  3FM3 A;  4IU6 A;  5CDL A;  4IDY A;  4A6W A;  1O0X A;  1MAT A;  2GU4 A;  2DFI A;  3CB5 A;  4EGE A;  2Q8K A;  3D27 A;  2EA2 A;  4OOK A;  1R58 A;  3L7G A;  2Q95 A;  1WBQ A;  1QXW A;  2BWW A;  3IU8 A;  4ZWU A;  5CDE A;  2BN7 A;  4FO8 A;  2GU7 A;  4PV4 A;  3TB5 A;  2GU6 A;  3MX6 A;  5D6E A;  2BWX A;  2BB7 A;  4U69 A;  1KP0 A;  1YVM A;  4HXX A;  1W7V A;  2OKN A;  2GGB A;  4U75 A;  1C27 A;  2Q94 A;  4U6W A;  2EVM A;  2MAT A;  2GA2 A;  3MAT A;  4IF7 A;  2BWY A;  4MAT A;  1YW7 A;  1WY2 A;  3PKA A;  2EVO A;  1M35 A;  1WLR A;  4U71 A;  1A16 A;  2GG2 A;  1WKM A;  2P99 A;  1C23 A;  3PKD A;  2BHA A;  4QR8 A;  4U73 A;  3MR1 A;  1KQ9 A;  4U6J A;  1N51 A;  1WN1 A;  3ROR A;  2P98 A;  2BH3 A;  2GG0 A;  4FLJ A;  4B28 A;  3FMQ A;  1CHM A;  2GZ5 A;  2GG5 A;  5D6F A;  3CTZ A;  2Q93 A;  2Q92 A;  1R5G A;  1XGM A;  2ZSG A;  4S00 A;  4ZWO A;  4IKR A;  5CE6 A;  1YW8 A;  4U6C A;  3PKC A;  2B3L A;  4S2T P;  4U6E A;  4ZNG A;  5E5B A;  5CLS A;  4U6Z A;  4FKC A;  1BOA A;  4R60 A;  2GG8 A;  5FCF A;  2G6P A;  2BHC A;  4FLI A;  4S01 A;  2V6C A;  4RZZ A;  3IU7 A;  4RGZ 1;  5JI6 A;  1WL9 A;  2NQ6 A;  4FO7 A;  2GU5 A;  5CIK A;  4A6V A;  1W2M A;  2GTX A;  3BIP A;  2OAZ A;  4IEC A;  5CDV A;  1QXY A;  1XNZ A;  1C22 A;  2Q96 A;  2HOW A;  2IW2 A;  1KQ0 A;  4IKU A;  4KM3 A;  2BHB A;  5FCH A;  2B3K A;  1B59 A;  4U70 A;  1BN5 A;  1PV9 A;  1XGS A;  2B3H A;  2V3Z A;  4IKT A;  3RVA A;  3TAV A;  3Q6D A;  3FMR A;  2GG9 A;  3CB6 A;  1R5H A;  2BWS A;  2P9A A;  5CNX A;  3L24 A;  4PNC A;  3PKB A;  4U76 A;  3S6B A;  2ADU A;  4U1B A;  2GG3 A;  4S2R P;  3PKE A;  5JFR A;  3BIT A;  2V3X A;  3IU9 A;  1Y1N A;  4FUK A;  4FLK A;  2GG7 A; 
#chains in the Genus database with same CATH topology
 3BIQ A;  1WL6 A;  1YJ3 A;  4ZWP A;  1C21 A;  4IPA A;  2BWV A;  2GGC A;  2V3Y A;  4Z7M A;  1QZY A;  4IKS A;  2NQ7 A;  4RZY A;  2BWT A;  1YW9 A;  5JHU A;  2EA4 A;  1JAW A;  3IG4 A;  1XGN A;  1QXZ A;  2BHD A;  2BWU A;  2EVC A;  4FLL A;  1XGO A;  1C24 A;  4JUQ A;  1B6A A;  3FM3 A;  4IU6 A;  5CDL A;  4IDY A;  4A6W A;  1O0X A;  1MAT A;  2GU4 A;  2DFI A;  3CB5 A;  4EGE A;  2Q8K A;  3D27 A;  2EA2 A;  4OOK A;  1R58 A;  3L7G A;  2Q95 A;  1WBQ A;  1QXW A;  2BWW A;  3IU8 A;  4ZWU A;  5CDE A;  2BN7 A;  4FO8 A;  2GU7 A;  4PV4 A;  3TB5 A;  2GU6 A;  3MX6 A;  5D6E A;  2BWX A;  2BB7 A;  4U69 A;  1KP0 A;  1YVM A;  4HXX A;  1W7V A;  2OKN A;  2GGB A;  4U75 A;  1C27 A;  2Q94 A;  4U6W A;  2EVM A;  2MAT A;  2GA2 A;  3MAT A;  4IF7 A;  2BWY A;  4MAT A;  1YW7 A;  1WY2 A;  3PKA A;  2EVO A;  1M35 A;  1WLR A;  4U71 A;  1A16 A;  2GG2 A;  1WKM A;  2P99 A;  1C23 A;  3PKD A;  2BHA A;  4QR8 A;  4U73 A;  3MR1 A;  1KQ9 A;  4U6J A;  1N51 A;  1WN1 A;  3ROR A;  2P98 A;  2BH3 A;  2GG0 A;  4FLJ A;  4B28 A;  3FMQ A;  1CHM A;  2GZ5 A;  2GG5 A;  5D6F A;  3CTZ A;  2Q93 A;  2Q92 A;  1R5G A;  1XGM A;  2ZSG A;  4S00 A;  4ZWO A;  4IKR A;  5CE6 A;  1YW8 A;  4U6C A;  3PKC A;  2B3L A;  4S2T P;  4U6E A;  4ZNG A;  5E5B A;  5CLS A;  4U6Z A;  4FKC A;  1BOA A;  4R60 A;  2GG8 A;  5FCF A;  2G6P A;  2BHC A;  4FLI A;  4S01 A;  2V6C A;  4RZZ A;  3IU7 A;  4RGZ 1;  5JI6 A;  1WL9 A;  2NQ6 A;  4FO7 A;  2GU5 A;  5CIK A;  4A6V A;  1W2M A;  2GTX A;  3BIP A;  2OAZ A;  4IEC A;  5CDV A;  1QXY A;  1XNZ A;  1C22 A;  2Q96 A;  2HOW A;  2IW2 A;  1KQ0 A;  4IKU A;  4KM3 A;  2BHB A;  5FCH A;  2B3K A;  1B59 A;  4U70 A;  1BN5 A;  1PV9 A;  1XGS A;  2B3H A;  2V3Z A;  4IKT A;  3RVA A;  3TAV A;  3Q6D A;  3FMR A;  2GG9 A;  3CB6 A;  1R5H A;  2BWS A;  2P9A A;  5CNX A;  3L24 A;  4PNC A;  3PKB A;  4U76 A;  3S6B A;  2ADU A;  4U1B A;  2GG3 A;  4S2R P;  3PKE A;  5JFR A;  3BIT A;  2V3X A;  3IU9 A;  1Y1N A;  4FUK A;  4FLK A;  2GG7 A; 
#chains in the Genus database with same CATH homology
 3BIQ A;  1WL6 A;  1YJ3 A;  4ZWP A;  1C21 A;  4IPA A;  2BWV A;  2GGC A;  2V3Y A;  4Z7M A;  1QZY A;  4IKS A;  2NQ7 A;  4RZY A;  2BWT A;  1YW9 A;  5JHU A;  2EA4 A;  1JAW A;  3IG4 A;  1XGN A;  1QXZ A;  2BHD A;  2BWU A;  2EVC A;  4FLL A;  1XGO A;  1C24 A;  4JUQ A;  1B6A A;  3FM3 A;  4IU6 A;  5CDL A;  4IDY A;  4A6W A;  1O0X A;  1MAT A;  2GU4 A;  2DFI A;  3CB5 A;  4EGE A;  2Q8K A;  3D27 A;  2EA2 A;  4OOK A;  1R58 A;  3L7G A;  2Q95 A;  1WBQ A;  1QXW A;  2BWW A;  3IU8 A;  4ZWU A;  5CDE A;  2BN7 A;  4FO8 A;  2GU7 A;  4PV4 A;  3TB5 A;  2GU6 A;  3MX6 A;  5D6E A;  2BWX A;  2BB7 A;  4U69 A;  1KP0 A;  1YVM A;  4HXX A;  1W7V A;  2OKN A;  2GGB A;  4U75 A;  1C27 A;  2Q94 A;  4U6W A;  2EVM A;  2MAT A;  2GA2 A;  3MAT A;  4IF7 A;  2BWY A;  4MAT A;  1YW7 A;  1WY2 A;  3PKA A;  2EVO A;  1M35 A;  1WLR A;  4U71 A;  1A16 A;  2GG2 A;  1WKM A;  2P99 A;  1C23 A;  3PKD A;  2BHA A;  4QR8 A;  4U73 A;  3MR1 A;  1KQ9 A;  4U6J A;  1N51 A;  1WN1 A;  3ROR A;  2P98 A;  2BH3 A;  2GG0 A;  4FLJ A;  4B28 A;  3FMQ A;  1CHM A;  2GZ5 A;  2GG5 A;  5D6F A;  3CTZ A;  2Q93 A;  2Q92 A;  1R5G A;  1XGM A;  2ZSG A;  4S00 A;  4ZWO A;  4IKR A;  5CE6 A;  1YW8 A;  4U6C A;  3PKC A;  2B3L A;  4S2T P;  4U6E A;  4ZNG A;  5E5B A;  5CLS A;  4U6Z A;  4FKC A;  1BOA A;  4R60 A;  2GG8 A;  5FCF A;  2G6P A;  2BHC A;  4FLI A;  4S01 A;  2V6C A;  4RZZ A;  3IU7 A;  4RGZ 1;  5JI6 A;  1WL9 A;  2NQ6 A;  4FO7 A;  2GU5 A;  5CIK A;  4A6V A;  1W2M A;  2GTX A;  3BIP A;  2OAZ A;  4IEC A;  5CDV A;  1QXY A;  1XNZ A;  1C22 A;  2Q96 A;  2HOW A;  2IW2 A;  1KQ0 A;  4IKU A;  4KM3 A;  2BHB A;  5FCH A;  2B3K A;  1B59 A;  4U70 A;  1BN5 A;  1PV9 A;  1XGS A;  2B3H A;  2V3Z A;  4IKT A;  3RVA A;  3TAV A;  3Q6D A;  3FMR A;  2GG9 A;  3CB6 A;  1R5H A;  2BWS A;  2P9A A;  5CNX A;  3L24 A;  4PNC A;  3PKB A;  4U76 A;  3S6B A;  2ADU A;  4U1B A;  2GG3 A;  4S2R P;  3PKE A;  5JFR A;  3BIT A;  2V3X A;  3IU9 A;  1Y1N A;  4FUK A;  4FLK A;  2GG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...