4U73A

Hsmetap(f309m) in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u73A00
3PKDA 4PV4A 1C23A 3PKEA 4A6WA 2GG3A 2GA2A 4FKCA 1YW8A 1W2MA 3IG4A 2GG5A 2OAZA 3FM3A 4KM3A 3PKAA 1PV9A 4ZWUA 1KQ0A 4U1BA 1YW9A 4B28A 4Z7MA 1YW7A 4JUQA 2Q93A 1M35A 1MATA 2GG9A 2OKNA 4IKTA 4ZNGA 2EVOA 4ZWOA 2BB7A 2GG0A 4U70A 2GU6A 2GTXA 4FLIA 3L24A 2BHAA 1JAWA 2G6PA 5JFRA 4U76A 2GG2A 2HOWA 3RORA 2B3LA 1YJ3A 2GG8A 2DFIA 1B6AA 4A6VA 1QXZA 5FCFA 2B3HA 4U71A 1KQ9A 4RZZA 2Q92A 2ZSGA 5JHUA 3D27A 1W7VA 4FLKA 4EGEA 1KP0A 2GGBA 5CNXA 4S2RP 1BN5A 2EVMA 3MATA 5E5BA 4FLJA 2B3KA 4IKUA 5CDEA 2P99A 4RZYA 5CIKA 1QXYA 3MX6A 2EA4A 1C22A 4HXXA 2BWYA 2BWXA 4PNCA 5D6FA 2EVCA 2V3XA 4U69A 4IU6A 2BHBA 3CTZA 4IF7A 2BWWA 3CB5A 1XGOA 4IKRA 2GGCA 4IPAA 1O0XA 4FO7A 1QXWA 3BIPA 3MR1A 3RVAA 4U73A 2MATA 4QR8A 1WN1A 4U6CA 5FCHA 2P98A 4R60A 3Q6DA 1WLRA 4S00A 3FMRA 1WL6A 2P9AA 2Q94A 2BH3A 4IKSA 4U6JA 3TAVA 3L7GA 3FMQA 1XNZA 1YVMA 4IDYA 1B59A 3PKCA 1QZYA 1R5GA 4IECA 2Q96A 4FLLA 2BHCA 3IU7A 4S2TP 2IW2A 1Y1NA 2GU4A 4FO8A 5CE6A 1XGNA 2Q95A 1WY2A 2BWVA 2NQ6A 3BITA 2Q8KA 1A16A 2BWTA 2GG7A 4FUKA 5D6EA 4U6WA 1R58A 5CLSA 1C27A 4RGZ1 2ADUA 2BWSA 1XGSA 4OOKA 2EA2A 1BOAA 1R5HA 2GZ5A 3PKBA 1WL9A 3CB6A 5JI6A 5CDLA 1C24A 2V3YA 4U75A 2V6CA 1CHMA 1N51A 1XGMA 2NQ7A 3TB5A 4S01A 4U6ZA 3S6BA 3IU9A 2BWUA 2BN7A 4MATA 1C21A 2GU7A 4ZWPA 5CDVA 1WKMA 2BHDA 2V3ZA 3IU8A 4U6EA 2GU5A 3BIQA 1WBQA
chains in the Genus database with same CATH superfamily
3PKDA 4PV4A 1C23A 3PKEA 4A6WA 2GG3A 2GA2A 4FKCA 1YW8A 1W2MA 3IG4A 2GG5A 2OAZA 3FM3A 4KM3A 3PKAA 1PV9A 4ZWUA 1KQ0A 4U1BA 1YW9A 4B28A 4Z7MA 1YW7A 4JUQA 2Q93A 1M35A 1MATA 2GG9A 2OKNA 4IKTA 4ZNGA 2EVOA 4ZWOA 2BB7A 2GG0A 4U70A 2GU6A 2GTXA 4FLIA 3L24A 2BHAA 1JAWA 2G6PA 5JFRA 4U76A 2GG2A 2HOWA 3RORA 2B3LA 1YJ3A 2GG8A 2DFIA 1B6AA 4A6VA 1QXZA 5FCFA 2B3HA 4U71A 1KQ9A 4RZZA 2Q92A 2ZSGA 5JHUA 3D27A 1W7VA 4FLKA 4EGEA 1KP0A 2GGBA 5CNXA 4S2RP 1BN5A 2EVMA 3MATA 5E5BA 4FLJA 2B3KA 4IKUA 5CDEA 2P99A 4RZYA 5CIKA 1QXYA 3MX6A 2EA4A 1C22A 4HXXA 2BWYA 2BWXA 4PNCA 5D6FA 2EVCA 2V3XA 4U69A 4IU6A 2BHBA 3CTZA 4IF7A 2BWWA 3CB5A 1XGOA 4IKRA 2GGCA 4IPAA 1O0XA 4FO7A 1QXWA 3BIPA 3MR1A 3RVAA 4U73A 2MATA 4QR8A 1WN1A 4U6CA 5FCHA 2P98A 4R60A 3Q6DA 1WLRA 4S00A 3FMRA 1WL6A 2P9AA 2Q94A 2BH3A 4IKSA 4U6JA 3TAVA 3L7GA 3FMQA 1XNZA 1YVMA 4IDYA 1B59A 3PKCA 1QZYA 1R5GA 4IECA 2Q96A 4FLLA 2BHCA 3IU7A 4S2TP 2IW2A 1Y1NA 2GU4A 4FO8A 5CE6A 1XGNA 2Q95A 1WY2A 2BWVA 2NQ6A 3BITA 2Q8KA 1A16A 2BWTA 2GG7A 4FUKA 5D6EA 4U6WA 1R58A 5CLSA 1C27A 4RGZ1 2ADUA 2BWSA 1XGSA 4OOKA 2EA2A 1BOAA 1R5HA 2GZ5A 3PKBA 1WL9A 3CB6A 5JI6A 5CDLA 1C24A 2V3YA 4U75A 2V6CA 1CHMA 1N51A 1XGMA 2NQ7A 3TB5A 4S01A 4U6ZA 3S6BA 3IU9A 2BWUA 2BN7A 4MATA 1C21A 2GU7A 4ZWPA 5CDVA 1WKMA 2BHDA 2V3ZA 3IU8A 4U6EA 2GU5A 3BIQA 1WBQA
chains in the Genus database with same CATH topology
3PKDA 4PV4A 1C23A 3PKEA 4A6WA 2GG3A 2GA2A 4FKCA 1YW8A 1W2MA 3IG4A 2GG5A 2OAZA 3FM3A 4KM3A 3PKAA 1PV9A 4ZWUA 1KQ0A 4U1BA 1YW9A 4B28A 4Z7MA 1YW7A 4JUQA 2Q93A 1M35A 1MATA 2GG9A 2OKNA 4IKTA 4ZNGA 2EVOA 4ZWOA 2BB7A 2GG0A 4U70A 2GU6A 2GTXA 4FLIA 3L24A 2BHAA 1JAWA 2G6PA 5JFRA 4U76A 2GG2A 2HOWA 3RORA 2B3LA 1YJ3A 2GG8A 2DFIA 1B6AA 4A6VA 1QXZA 5FCFA 2B3HA 4U71A 1KQ9A 4RZZA 2Q92A 2ZSGA 5JHUA 3D27A 1W7VA 4FLKA 4EGEA 1KP0A 2GGBA 5CNXA 4S2RP 1BN5A 2EVMA 3MATA 5E5BA 4FLJA 2B3KA 4IKUA 5CDEA 2P99A 4RZYA 5CIKA 1QXYA 3MX6A 2EA4A 1C22A 4HXXA 2BWYA 2BWXA 4PNCA 5D6FA 2EVCA 2V3XA 4U69A 4IU6A 2BHBA 3CTZA 4IF7A 2BWWA 3CB5A 1XGOA 4IKRA 2GGCA 4IPAA 1O0XA 4FO7A 1QXWA 3BIPA 3MR1A 3RVAA 4U73A 2MATA 4QR8A 1WN1A 4U6CA 5FCHA 2P98A 4R60A 3Q6DA 1WLRA 4S00A 3FMRA 1WL6A 2P9AA 2Q94A 2BH3A 4IKSA 4U6JA 3TAVA 3L7GA 3FMQA 1XNZA 1YVMA 4IDYA 1B59A 3PKCA 1QZYA 1R5GA 4IECA 2Q96A 4FLLA 2BHCA 3IU7A 4S2TP 2IW2A 1Y1NA 2GU4A 4FO8A 5CE6A 1XGNA 2Q95A 1WY2A 2BWVA 2NQ6A 3BITA 2Q8KA 1A16A 2BWTA 2GG7A 4FUKA 5D6EA 4U6WA 1R58A 5CLSA 1C27A 4RGZ1 2ADUA 2BWSA 1XGSA 4OOKA 2EA2A 1BOAA 1R5HA 2GZ5A 3PKBA 1WL9A 3CB6A 5JI6A 5CDLA 1C24A 2V3YA 4U75A 2V6CA 1CHMA 1N51A 1XGMA 2NQ7A 3TB5A 4S01A 4U6ZA 3S6BA 3IU9A 2BWUA 2BN7A 4MATA 1C21A 2GU7A 4ZWPA 5CDVA 1WKMA 2BHDA 2V3ZA 3IU8A 4U6EA 2GU5A 3BIQA 1WBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKD A;  4PV4 A;  1C23 A;  3PKE A;  4A6W A;  2GG3 A;  2GA2 A;  4FKC A;  1YW8 A;  1W2M A;  3IG4 A;  2GG5 A;  2OAZ A;  3FM3 A;  4KM3 A;  3PKA A;  1PV9 A;  4ZWU A;  1KQ0 A;  4U1B A;  1YW9 A;  4B28 A;  4Z7M A;  1YW7 A;  4JUQ A;  2Q93 A;  1M35 A;  1MAT A;  2GG9 A;  2OKN A;  4IKT A;  4ZNG A;  2EVO A;  4ZWO A;  2BB7 A;  2GG0 A;  4U70 A;  2GU6 A;  2GTX A;  4FLI A;  3L24 A;  2BHA A;  1JAW A;  2G6P A;  5JFR A;  4U76 A;  2GG2 A;  2HOW A;  3ROR A;  2B3L A;  1YJ3 A;  2GG8 A;  2DFI A;  1B6A A;  4A6V A;  1QXZ A;  5FCF A;  2B3H A;  4U71 A;  1KQ9 A;  4RZZ A;  2Q92 A;  2ZSG A;  5JHU A;  3D27 A;  1W7V A;  4FLK A;  4EGE A;  1KP0 A;  2GGB A;  5CNX A;  4S2R P;  1BN5 A;  2EVM A;  3MAT A;  5E5B A;  4FLJ A;  2B3K A;  4IKU A;  5CDE A;  2P99 A;  4RZY A;  5CIK A;  1QXY A;  3MX6 A;  2EA4 A;  1C22 A;  4HXX A;  2BWY A;  2BWX A;  4PNC A;  5D6F A;  2EVC A;  2V3X A;  4U69 A;  4IU6 A;  2BHB A;  3CTZ A;  4IF7 A;  2BWW A;  3CB5 A;  1XGO A;  4IKR A;  2GGC A;  4IPA A;  1O0X A;  4FO7 A;  1QXW A;  3BIP A;  3MR1 A;  3RVA A;  4U73 A;  2MAT A;  4QR8 A;  1WN1 A;  4U6C A;  5FCH A;  2P98 A;  4R60 A;  3Q6D A;  1WLR A;  4S00 A;  3FMR A;  1WL6 A;  2P9A A;  2Q94 A;  2BH3 A;  4IKS A;  4U6J A;  3TAV A;  3L7G A;  3FMQ A;  1XNZ A;  1YVM A;  4IDY A;  1B59 A;  3PKC A;  1QZY A;  1R5G A;  4IEC A;  2Q96 A;  4FLL A;  2BHC A;  3IU7 A;  4S2T P;  2IW2 A;  1Y1N A;  2GU4 A;  4FO8 A;  5CE6 A;  1XGN A;  2Q95 A;  1WY2 A;  2BWV A;  2NQ6 A;  3BIT A;  2Q8K A;  1A16 A;  2BWT A;  2GG7 A;  4FUK A;  5D6E A;  4U6W A;  1R58 A;  5CLS A;  1C27 A;  4RGZ 1;  2ADU A;  2BWS A;  1XGS A;  4OOK A;  2EA2 A;  1BOA A;  1R5H A;  2GZ5 A;  3PKB A;  1WL9 A;  3CB6 A;  5JI6 A;  5CDL A;  1C24 A;  2V3Y A;  4U75 A;  2V6C A;  1CHM A;  1N51 A;  1XGM A;  2NQ7 A;  3TB5 A;  4S01 A;  4U6Z A;  3S6B A;  3IU9 A;  2BWU A;  2BN7 A;  4MAT A;  1C21 A;  2GU7 A;  4ZWP A;  5CDV A;  1WKM A;  2BHD A;  2V3Z A;  3IU8 A;  4U6E A;  2GU5 A;  3BIQ A;  1WBQ A; 
#chains in the Genus database with same CATH topology
 3PKD A;  4PV4 A;  1C23 A;  3PKE A;  4A6W A;  2GG3 A;  2GA2 A;  4FKC A;  1YW8 A;  1W2M A;  3IG4 A;  2GG5 A;  2OAZ A;  3FM3 A;  4KM3 A;  3PKA A;  1PV9 A;  4ZWU A;  1KQ0 A;  4U1B A;  1YW9 A;  4B28 A;  4Z7M A;  1YW7 A;  4JUQ A;  2Q93 A;  1M35 A;  1MAT A;  2GG9 A;  2OKN A;  4IKT A;  4ZNG A;  2EVO A;  4ZWO A;  2BB7 A;  2GG0 A;  4U70 A;  2GU6 A;  2GTX A;  4FLI A;  3L24 A;  2BHA A;  1JAW A;  2G6P A;  5JFR A;  4U76 A;  2GG2 A;  2HOW A;  3ROR A;  2B3L A;  1YJ3 A;  2GG8 A;  2DFI A;  1B6A A;  4A6V A;  1QXZ A;  5FCF A;  2B3H A;  4U71 A;  1KQ9 A;  4RZZ A;  2Q92 A;  2ZSG A;  5JHU A;  3D27 A;  1W7V A;  4FLK A;  4EGE A;  1KP0 A;  2GGB A;  5CNX A;  4S2R P;  1BN5 A;  2EVM A;  3MAT A;  5E5B A;  4FLJ A;  2B3K A;  4IKU A;  5CDE A;  2P99 A;  4RZY A;  5CIK A;  1QXY A;  3MX6 A;  2EA4 A;  1C22 A;  4HXX A;  2BWY A;  2BWX A;  4PNC A;  5D6F A;  2EVC A;  2V3X A;  4U69 A;  4IU6 A;  2BHB A;  3CTZ A;  4IF7 A;  2BWW A;  3CB5 A;  1XGO A;  4IKR A;  2GGC A;  4IPA A;  1O0X A;  4FO7 A;  1QXW A;  3BIP A;  3MR1 A;  3RVA A;  4U73 A;  2MAT A;  4QR8 A;  1WN1 A;  4U6C A;  5FCH A;  2P98 A;  4R60 A;  3Q6D A;  1WLR A;  4S00 A;  3FMR A;  1WL6 A;  2P9A A;  2Q94 A;  2BH3 A;  4IKS A;  4U6J A;  3TAV A;  3L7G A;  3FMQ A;  1XNZ A;  1YVM A;  4IDY A;  1B59 A;  3PKC A;  1QZY A;  1R5G A;  4IEC A;  2Q96 A;  4FLL A;  2BHC A;  3IU7 A;  4S2T P;  2IW2 A;  1Y1N A;  2GU4 A;  4FO8 A;  5CE6 A;  1XGN A;  2Q95 A;  1WY2 A;  2BWV A;  2NQ6 A;  3BIT A;  2Q8K A;  1A16 A;  2BWT A;  2GG7 A;  4FUK A;  5D6E A;  4U6W A;  1R58 A;  5CLS A;  1C27 A;  4RGZ 1;  2ADU A;  2BWS A;  1XGS A;  4OOK A;  2EA2 A;  1BOA A;  1R5H A;  2GZ5 A;  3PKB A;  1WL9 A;  3CB6 A;  5JI6 A;  5CDL A;  1C24 A;  2V3Y A;  4U75 A;  2V6C A;  1CHM A;  1N51 A;  1XGM A;  2NQ7 A;  3TB5 A;  4S01 A;  4U6Z A;  3S6B A;  3IU9 A;  2BWU A;  2BN7 A;  4MAT A;  1C21 A;  2GU7 A;  4ZWP A;  5CDV A;  1WKM A;  2BHD A;  2V3Z A;  3IU8 A;  4U6E A;  2GU5 A;  3BIQ A;  1WBQ A; 
#chains in the Genus database with same CATH homology
 3PKD A;  4PV4 A;  1C23 A;  3PKE A;  4A6W A;  2GG3 A;  2GA2 A;  4FKC A;  1YW8 A;  1W2M A;  3IG4 A;  2GG5 A;  2OAZ A;  3FM3 A;  4KM3 A;  3PKA A;  1PV9 A;  4ZWU A;  1KQ0 A;  4U1B A;  1YW9 A;  4B28 A;  4Z7M A;  1YW7 A;  4JUQ A;  2Q93 A;  1M35 A;  1MAT A;  2GG9 A;  2OKN A;  4IKT A;  4ZNG A;  2EVO A;  4ZWO A;  2BB7 A;  2GG0 A;  4U70 A;  2GU6 A;  2GTX A;  4FLI A;  3L24 A;  2BHA A;  1JAW A;  2G6P A;  5JFR A;  4U76 A;  2GG2 A;  2HOW A;  3ROR A;  2B3L A;  1YJ3 A;  2GG8 A;  2DFI A;  1B6A A;  4A6V A;  1QXZ A;  5FCF A;  2B3H A;  4U71 A;  1KQ9 A;  4RZZ A;  2Q92 A;  2ZSG A;  5JHU A;  3D27 A;  1W7V A;  4FLK A;  4EGE A;  1KP0 A;  2GGB A;  5CNX A;  4S2R P;  1BN5 A;  2EVM A;  3MAT A;  5E5B A;  4FLJ A;  2B3K A;  4IKU A;  5CDE A;  2P99 A;  4RZY A;  5CIK A;  1QXY A;  3MX6 A;  2EA4 A;  1C22 A;  4HXX A;  2BWY A;  2BWX A;  4PNC A;  5D6F A;  2EVC A;  2V3X A;  4U69 A;  4IU6 A;  2BHB A;  3CTZ A;  4IF7 A;  2BWW A;  3CB5 A;  1XGO A;  4IKR A;  2GGC A;  4IPA A;  1O0X A;  4FO7 A;  1QXW A;  3BIP A;  3MR1 A;  3RVA A;  4U73 A;  2MAT A;  4QR8 A;  1WN1 A;  4U6C A;  5FCH A;  2P98 A;  4R60 A;  3Q6D A;  1WLR A;  4S00 A;  3FMR A;  1WL6 A;  2P9A A;  2Q94 A;  2BH3 A;  4IKS A;  4U6J A;  3TAV A;  3L7G A;  3FMQ A;  1XNZ A;  1YVM A;  4IDY A;  1B59 A;  3PKC A;  1QZY A;  1R5G A;  4IEC A;  2Q96 A;  4FLL A;  2BHC A;  3IU7 A;  4S2T P;  2IW2 A;  1Y1N A;  2GU4 A;  4FO8 A;  5CE6 A;  1XGN A;  2Q95 A;  1WY2 A;  2BWV A;  2NQ6 A;  3BIT A;  2Q8K A;  1A16 A;  2BWT A;  2GG7 A;  4FUK A;  5D6E A;  4U6W A;  1R58 A;  5CLS A;  1C27 A;  4RGZ 1;  2ADU A;  2BWS A;  1XGS A;  4OOK A;  2EA2 A;  1BOA A;  1R5H A;  2GZ5 A;  3PKB A;  1WL9 A;  3CB6 A;  5JI6 A;  5CDL A;  1C24 A;  2V3Y A;  4U75 A;  2V6C A;  1CHM A;  1N51 A;  1XGM A;  2NQ7 A;  3TB5 A;  4S01 A;  4U6Z A;  3S6B A;  3IU9 A;  2BWU A;  2BN7 A;  4MAT A;  1C21 A;  2GU7 A;  4ZWP A;  5CDV A;  1WKM A;  2BHD A;  2V3Z A;  3IU8 A;  4U6E A;  2GU5 A;  3BIQ A;  1WBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...