4U73A

Hsmetap(f309m) in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u73A00
2EVOA 3FMQA 2GA2A 2NQ7A 4FLKA 1QXWA 2GG2A 1YW8A 4U75A 1WL6A 1JAWA 4RZZA 2BWXA 2GG8A 4EGEA 3D27A 2V3XA 5FCHA 4IPAA 3Q6DA 4R60A 4ZWOA 2BWTA 2GG0A 4FLIA 1XNZA 3CB5A 4HXXA 3RORA 5CDLA 2HOWA 3FM3A 5CNXA 4RZYA 1M35A 2BB7A 2GU5A 4U1BA 4A6WA 4ZNGA 4IDYA 4FKCA 4IKRA 4U69A 2GG9A 4U70A 2GU4A 1Y1NA 4Z7MA 3L24A 1W7VA 1WBQA 2B3KA 2G6PA 2EA4A 4U73A 2P98A 2GG7A 2BN7A 4IKUA 1C24A 1W2MA 4S00A 1KP0A 3PKEA 3TAVA 1WKMA 2GGCA 5CLSA 2NQ6A 2GU6A 2GG3A 2GZ5A 4FLJA 2IW2A 3FMRA 3RVAA 3BIQA 1C22A 3CB6A 1YVMA 1C23A 1QZYA 1R5GA 2V3ZA 2BHDA 2EVMA 1CHMA 5JFRA 1XGOA 1KQ9A 1XGNA 4A6VA 2GU7A 2B3LA 2EVCA 4QR8A 1R5HA 4ZWPA 4RGZ1 4FO7A 1C27A 2BHCA 3PKBA 5CDVA 3MR1A 3PKAA 5CE6A 1QXZA 1QXYA 3MATA 3CTZA 4IKSA 2Q94A 1XGSA 2V3YA 2Q95A 4FUKA 4IECA 5CIKA 5D6EA 2Q8KA 1B59A 5D6FA 2ZSGA 3BITA 4ZWUA 4U6CA 4JUQA 3PKDA 2DFIA 4IF7A 4U76A 4S2RP 2BWUA 4U71A 4PV4A 5JHUA 2BHBA 1BN5A 5FCFA 5JI6A 2GTXA 4FLLA 1MATA 2OKNA 5E5BA 1WN1A 1YW7A 1KQ0A 2BHAA 2EA2A 4B28A 1N51A 4IU6A 1C21A 1O0XA 1WLRA 1R58A 2P99A 2BWYA 3L7GA 4OOKA 1B6AA 1XGMA 3TB5A 3S6BA 2MATA 2BWSA 4U6EA 3IG4A 1WL9A 2Q93A 5CDEA 1YW9A 2OAZA 2P9AA 3MX6A 4U6ZA 4IKTA 1YJ3A 2GGBA 1A16A 3PKCA 4KM3A 4PNCA 2BWVA 2BWWA 4S01A 1PV9A 4U6WA 4S2TP 2Q96A 3IU8A 2V6CA 4MATA 2Q92A 3BIPA 1BOAA 2BH3A 3IU9A 2GG5A 2ADUA 4FO8A 2B3HA 1WY2A 4U6JA 3IU7A
chains in the Genus database with same CATH superfamily
2EVOA 3FMQA 2GA2A 2NQ7A 4FLKA 1QXWA 2GG2A 1YW8A 4U75A 1WL6A 1JAWA 4RZZA 2BWXA 2GG8A 4EGEA 3D27A 2V3XA 5FCHA 4IPAA 3Q6DA 4R60A 4ZWOA 2BWTA 2GG0A 4FLIA 1XNZA 3CB5A 4HXXA 3RORA 5CDLA 2HOWA 3FM3A 5CNXA 4RZYA 1M35A 2BB7A 2GU5A 4U1BA 4A6WA 4ZNGA 4IDYA 4FKCA 4IKRA 4U69A 2GG9A 4U70A 2GU4A 1Y1NA 4Z7MA 3L24A 1W7VA 1WBQA 2B3KA 2G6PA 2EA4A 4U73A 2P98A 2GG7A 2BN7A 4IKUA 1C24A 1W2MA 4S00A 1KP0A 3PKEA 3TAVA 1WKMA 2GGCA 5CLSA 2NQ6A 2GU6A 2GG3A 2GZ5A 4FLJA 2IW2A 3FMRA 3RVAA 3BIQA 1C22A 3CB6A 1YVMA 1C23A 1QZYA 1R5GA 2V3ZA 2BHDA 2EVMA 1CHMA 5JFRA 1XGOA 1KQ9A 1XGNA 4A6VA 2GU7A 2B3LA 2EVCA 4QR8A 1R5HA 4ZWPA 4RGZ1 4FO7A 1C27A 2BHCA 3PKBA 5CDVA 3MR1A 3PKAA 5CE6A 1QXZA 1QXYA 3MATA 3CTZA 4IKSA 2Q94A 1XGSA 2V3YA 2Q95A 4FUKA 4IECA 5CIKA 5D6EA 2Q8KA 1B59A 5D6FA 2ZSGA 3BITA 4ZWUA 4U6CA 4JUQA 3PKDA 2DFIA 4IF7A 4U76A 4S2RP 2BWUA 4U71A 4PV4A 5JHUA 2BHBA 1BN5A 5FCFA 5JI6A 2GTXA 4FLLA 1MATA 2OKNA 5E5BA 1WN1A 1YW7A 1KQ0A 2BHAA 2EA2A 4B28A 1N51A 4IU6A 1C21A 1O0XA 1WLRA 1R58A 2P99A 2BWYA 3L7GA 4OOKA 1B6AA 1XGMA 3TB5A 3S6BA 2MATA 2BWSA 4U6EA 3IG4A 1WL9A 2Q93A 5CDEA 1YW9A 2OAZA 2P9AA 3MX6A 4U6ZA 4IKTA 1YJ3A 2GGBA 1A16A 3PKCA 4KM3A 4PNCA 2BWVA 2BWWA 4S01A 1PV9A 4U6WA 4S2TP 2Q96A 3IU8A 2V6CA 4MATA 2Q92A 3BIPA 1BOAA 2BH3A 3IU9A 2GG5A 2ADUA 4FO8A 2B3HA 1WY2A 4U6JA 3IU7A
chains in the Genus database with same CATH topology
2EVOA 3FMQA 2GA2A 2NQ7A 4FLKA 1QXWA 2GG2A 1YW8A 4U75A 1WL6A 1JAWA 4RZZA 2BWXA 2GG8A 4EGEA 3D27A 2V3XA 5FCHA 4IPAA 3Q6DA 4R60A 4ZWOA 2BWTA 2GG0A 4FLIA 1XNZA 3CB5A 4HXXA 3RORA 5CDLA 2HOWA 3FM3A 5CNXA 4RZYA 1M35A 2BB7A 2GU5A 4U1BA 4A6WA 4ZNGA 4IDYA 4FKCA 4IKRA 4U69A 2GG9A 4U70A 2GU4A 1Y1NA 4Z7MA 3L24A 1W7VA 1WBQA 2B3KA 2G6PA 2EA4A 4U73A 2P98A 2GG7A 2BN7A 4IKUA 1C24A 1W2MA 4S00A 1KP0A 3PKEA 3TAVA 1WKMA 2GGCA 5CLSA 2NQ6A 2GU6A 2GG3A 2GZ5A 4FLJA 2IW2A 3FMRA 3RVAA 3BIQA 1C22A 3CB6A 1YVMA 1C23A 1QZYA 1R5GA 2V3ZA 2BHDA 2EVMA 1CHMA 5JFRA 1XGOA 1KQ9A 1XGNA 4A6VA 2GU7A 2B3LA 2EVCA 4QR8A 1R5HA 4ZWPA 4RGZ1 4FO7A 1C27A 2BHCA 3PKBA 5CDVA 3MR1A 3PKAA 5CE6A 1QXZA 1QXYA 3MATA 3CTZA 4IKSA 2Q94A 1XGSA 2V3YA 2Q95A 4FUKA 4IECA 5CIKA 5D6EA 2Q8KA 1B59A 5D6FA 2ZSGA 3BITA 4ZWUA 4U6CA 4JUQA 3PKDA 2DFIA 4IF7A 4U76A 4S2RP 2BWUA 4U71A 4PV4A 5JHUA 2BHBA 1BN5A 5FCFA 5JI6A 2GTXA 4FLLA 1MATA 2OKNA 5E5BA 1WN1A 1YW7A 1KQ0A 2BHAA 2EA2A 4B28A 1N51A 4IU6A 1C21A 1O0XA 1WLRA 1R58A 2P99A 2BWYA 3L7GA 4OOKA 1B6AA 1XGMA 3TB5A 3S6BA 2MATA 2BWSA 4U6EA 3IG4A 1WL9A 2Q93A 5CDEA 1YW9A 2OAZA 2P9AA 3MX6A 4U6ZA 4IKTA 1YJ3A 2GGBA 1A16A 3PKCA 4KM3A 4PNCA 2BWVA 2BWWA 4S01A 1PV9A 4U6WA 4S2TP 2Q96A 3IU8A 2V6CA 4MATA 2Q92A 3BIPA 1BOAA 2BH3A 3IU9A 2GG5A 2ADUA 4FO8A 2B3HA 1WY2A 4U6JA 3IU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVO A;  3FMQ A;  2GA2 A;  2NQ7 A;  4FLK A;  1QXW A;  2GG2 A;  1YW8 A;  4U75 A;  1WL6 A;  1JAW A;  4RZZ A;  2BWX A;  2GG8 A;  4EGE A;  3D27 A;  2V3X A;  5FCH A;  4IPA A;  3Q6D A;  4R60 A;  4ZWO A;  2BWT A;  2GG0 A;  4FLI A;  1XNZ A;  3CB5 A;  4HXX A;  3ROR A;  5CDL A;  2HOW A;  3FM3 A;  5CNX A;  4RZY A;  1M35 A;  2BB7 A;  2GU5 A;  4U1B A;  4A6W A;  4ZNG A;  4IDY A;  4FKC A;  4IKR A;  4U69 A;  2GG9 A;  4U70 A;  2GU4 A;  1Y1N A;  4Z7M A;  3L24 A;  1W7V A;  1WBQ A;  2B3K A;  2G6P A;  2EA4 A;  4U73 A;  2P98 A;  2GG7 A;  2BN7 A;  4IKU A;  1C24 A;  1W2M A;  4S00 A;  1KP0 A;  3PKE A;  3TAV A;  1WKM A;  2GGC A;  5CLS A;  2NQ6 A;  2GU6 A;  2GG3 A;  2GZ5 A;  4FLJ A;  2IW2 A;  3FMR A;  3RVA A;  3BIQ A;  1C22 A;  3CB6 A;  1YVM A;  1C23 A;  1QZY A;  1R5G A;  2V3Z A;  2BHD A;  2EVM A;  1CHM A;  5JFR A;  1XGO A;  1KQ9 A;  1XGN A;  4A6V A;  2GU7 A;  2B3L A;  2EVC A;  4QR8 A;  1R5H A;  4ZWP A;  4RGZ 1;  4FO7 A;  1C27 A;  2BHC A;  3PKB A;  5CDV A;  3MR1 A;  3PKA A;  5CE6 A;  1QXZ A;  1QXY A;  3MAT A;  3CTZ A;  4IKS A;  2Q94 A;  1XGS A;  2V3Y A;  2Q95 A;  4FUK A;  4IEC A;  5CIK A;  5D6E A;  2Q8K A;  1B59 A;  5D6F A;  2ZSG A;  3BIT A;  4ZWU A;  4U6C A;  4JUQ A;  3PKD A;  2DFI A;  4IF7 A;  4U76 A;  4S2R P;  2BWU A;  4U71 A;  4PV4 A;  5JHU A;  2BHB A;  1BN5 A;  5FCF A;  5JI6 A;  2GTX A;  4FLL A;  1MAT A;  2OKN A;  5E5B A;  1WN1 A;  1YW7 A;  1KQ0 A;  2BHA A;  2EA2 A;  4B28 A;  1N51 A;  4IU6 A;  1C21 A;  1O0X A;  1WLR A;  1R58 A;  2P99 A;  2BWY A;  3L7G A;  4OOK A;  1B6A A;  1XGM A;  3TB5 A;  3S6B A;  2MAT A;  2BWS A;  4U6E A;  3IG4 A;  1WL9 A;  2Q93 A;  5CDE A;  1YW9 A;  2OAZ A;  2P9A A;  3MX6 A;  4U6Z A;  4IKT A;  1YJ3 A;  2GGB A;  1A16 A;  3PKC A;  4KM3 A;  4PNC A;  2BWV A;  2BWW A;  4S01 A;  1PV9 A;  4U6W A;  4S2T P;  2Q96 A;  3IU8 A;  2V6C A;  4MAT A;  2Q92 A;  3BIP A;  1BOA A;  2BH3 A;  3IU9 A;  2GG5 A;  2ADU A;  4FO8 A;  2B3H A;  1WY2 A;  4U6J A;  3IU7 A; 
#chains in the Genus database with same CATH topology
 2EVO A;  3FMQ A;  2GA2 A;  2NQ7 A;  4FLK A;  1QXW A;  2GG2 A;  1YW8 A;  4U75 A;  1WL6 A;  1JAW A;  4RZZ A;  2BWX A;  2GG8 A;  4EGE A;  3D27 A;  2V3X A;  5FCH A;  4IPA A;  3Q6D A;  4R60 A;  4ZWO A;  2BWT A;  2GG0 A;  4FLI A;  1XNZ A;  3CB5 A;  4HXX A;  3ROR A;  5CDL A;  2HOW A;  3FM3 A;  5CNX A;  4RZY A;  1M35 A;  2BB7 A;  2GU5 A;  4U1B A;  4A6W A;  4ZNG A;  4IDY A;  4FKC A;  4IKR A;  4U69 A;  2GG9 A;  4U70 A;  2GU4 A;  1Y1N A;  4Z7M A;  3L24 A;  1W7V A;  1WBQ A;  2B3K A;  2G6P A;  2EA4 A;  4U73 A;  2P98 A;  2GG7 A;  2BN7 A;  4IKU A;  1C24 A;  1W2M A;  4S00 A;  1KP0 A;  3PKE A;  3TAV A;  1WKM A;  2GGC A;  5CLS A;  2NQ6 A;  2GU6 A;  2GG3 A;  2GZ5 A;  4FLJ A;  2IW2 A;  3FMR A;  3RVA A;  3BIQ A;  1C22 A;  3CB6 A;  1YVM A;  1C23 A;  1QZY A;  1R5G A;  2V3Z A;  2BHD A;  2EVM A;  1CHM A;  5JFR A;  1XGO A;  1KQ9 A;  1XGN A;  4A6V A;  2GU7 A;  2B3L A;  2EVC A;  4QR8 A;  1R5H A;  4ZWP A;  4RGZ 1;  4FO7 A;  1C27 A;  2BHC A;  3PKB A;  5CDV A;  3MR1 A;  3PKA A;  5CE6 A;  1QXZ A;  1QXY A;  3MAT A;  3CTZ A;  4IKS A;  2Q94 A;  1XGS A;  2V3Y A;  2Q95 A;  4FUK A;  4IEC A;  5CIK A;  5D6E A;  2Q8K A;  1B59 A;  5D6F A;  2ZSG A;  3BIT A;  4ZWU A;  4U6C A;  4JUQ A;  3PKD A;  2DFI A;  4IF7 A;  4U76 A;  4S2R P;  2BWU A;  4U71 A;  4PV4 A;  5JHU A;  2BHB A;  1BN5 A;  5FCF A;  5JI6 A;  2GTX A;  4FLL A;  1MAT A;  2OKN A;  5E5B A;  1WN1 A;  1YW7 A;  1KQ0 A;  2BHA A;  2EA2 A;  4B28 A;  1N51 A;  4IU6 A;  1C21 A;  1O0X A;  1WLR A;  1R58 A;  2P99 A;  2BWY A;  3L7G A;  4OOK A;  1B6A A;  1XGM A;  3TB5 A;  3S6B A;  2MAT A;  2BWS A;  4U6E A;  3IG4 A;  1WL9 A;  2Q93 A;  5CDE A;  1YW9 A;  2OAZ A;  2P9A A;  3MX6 A;  4U6Z A;  4IKT A;  1YJ3 A;  2GGB A;  1A16 A;  3PKC A;  4KM3 A;  4PNC A;  2BWV A;  2BWW A;  4S01 A;  1PV9 A;  4U6W A;  4S2T P;  2Q96 A;  3IU8 A;  2V6C A;  4MAT A;  2Q92 A;  3BIP A;  1BOA A;  2BH3 A;  3IU9 A;  2GG5 A;  2ADU A;  4FO8 A;  2B3H A;  1WY2 A;  4U6J A;  3IU7 A; 
#chains in the Genus database with same CATH homology
 2EVO A;  3FMQ A;  2GA2 A;  2NQ7 A;  4FLK A;  1QXW A;  2GG2 A;  1YW8 A;  4U75 A;  1WL6 A;  1JAW A;  4RZZ A;  2BWX A;  2GG8 A;  4EGE A;  3D27 A;  2V3X A;  5FCH A;  4IPA A;  3Q6D A;  4R60 A;  4ZWO A;  2BWT A;  2GG0 A;  4FLI A;  1XNZ A;  3CB5 A;  4HXX A;  3ROR A;  5CDL A;  2HOW A;  3FM3 A;  5CNX A;  4RZY A;  1M35 A;  2BB7 A;  2GU5 A;  4U1B A;  4A6W A;  4ZNG A;  4IDY A;  4FKC A;  4IKR A;  4U69 A;  2GG9 A;  4U70 A;  2GU4 A;  1Y1N A;  4Z7M A;  3L24 A;  1W7V A;  1WBQ A;  2B3K A;  2G6P A;  2EA4 A;  4U73 A;  2P98 A;  2GG7 A;  2BN7 A;  4IKU A;  1C24 A;  1W2M A;  4S00 A;  1KP0 A;  3PKE A;  3TAV A;  1WKM A;  2GGC A;  5CLS A;  2NQ6 A;  2GU6 A;  2GG3 A;  2GZ5 A;  4FLJ A;  2IW2 A;  3FMR A;  3RVA A;  3BIQ A;  1C22 A;  3CB6 A;  1YVM A;  1C23 A;  1QZY A;  1R5G A;  2V3Z A;  2BHD A;  2EVM A;  1CHM A;  5JFR A;  1XGO A;  1KQ9 A;  1XGN A;  4A6V A;  2GU7 A;  2B3L A;  2EVC A;  4QR8 A;  1R5H A;  4ZWP A;  4RGZ 1;  4FO7 A;  1C27 A;  2BHC A;  3PKB A;  5CDV A;  3MR1 A;  3PKA A;  5CE6 A;  1QXZ A;  1QXY A;  3MAT A;  3CTZ A;  4IKS A;  2Q94 A;  1XGS A;  2V3Y A;  2Q95 A;  4FUK A;  4IEC A;  5CIK A;  5D6E A;  2Q8K A;  1B59 A;  5D6F A;  2ZSG A;  3BIT A;  4ZWU A;  4U6C A;  4JUQ A;  3PKD A;  2DFI A;  4IF7 A;  4U76 A;  4S2R P;  2BWU A;  4U71 A;  4PV4 A;  5JHU A;  2BHB A;  1BN5 A;  5FCF A;  5JI6 A;  2GTX A;  4FLL A;  1MAT A;  2OKN A;  5E5B A;  1WN1 A;  1YW7 A;  1KQ0 A;  2BHA A;  2EA2 A;  4B28 A;  1N51 A;  4IU6 A;  1C21 A;  1O0X A;  1WLR A;  1R58 A;  2P99 A;  2BWY A;  3L7G A;  4OOK A;  1B6A A;  1XGM A;  3TB5 A;  3S6B A;  2MAT A;  2BWS A;  4U6E A;  3IG4 A;  1WL9 A;  2Q93 A;  5CDE A;  1YW9 A;  2OAZ A;  2P9A A;  3MX6 A;  4U6Z A;  4IKT A;  1YJ3 A;  2GGB A;  1A16 A;  3PKC A;  4KM3 A;  4PNC A;  2BWV A;  2BWW A;  4S01 A;  1PV9 A;  4U6W A;  4S2T P;  2Q96 A;  3IU8 A;  2V6C A;  4MAT A;  2Q92 A;  3BIP A;  1BOA A;  2BH3 A;  3IU9 A;  2GG5 A;  2ADU A;  4FO8 A;  2B3H A;  1WY2 A;  4U6J A;  3IU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...