2P98A

E. coli methionine aminopeptidase monometalated with inhibitor ye7
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p98A00
2ADUA 4A6VA 1M35A 2ZSGA 4U75A 2BWYA 2NQ6A 5CDEA 1B59A 1WLRA 4FLLA 1A16A 1QXZA 3D27A 3PKDA 4IU6A 1JAWA 2P9AA 3BITA 4ZWPA 2GTXA 2EA2A 2GU4A 2V6CA 4KM3A 4S2RP 4A6WA 4U1BA 2BHDA 4FUKA 1YW9A 5D6FA 1C27A 4EGEA 4FO7A 4FLKA 2B3KA 2BWXA 5FCFA 3IU9A 1KQ0A 4U70A 2V3XA 1W2MA 1XGOA 3CB5A 3MR1A 2GG3A 2Q93A 4IKTA 2GU7A 4U73A 3RVAA 2P99A 2Q94A 4U76A 4FKCA 4S01A 5E5BA 1XNZA 2BWWA 2EVMA 2GU5A 2GG8A 4OOKA 3TAVA 1PV9A 3BIQA 4IECA 3L24A 3L7GA 1C21A 2GG9A 1R58A 4PV4A 4U6ZA 2Q8KA 1XGMA 2BHCA 5JFRA 1MATA 2G6PA 1KP0A 4PNCA 3IG4A 4FO8A 2BH3A 3CTZA 1B6AA 2Q92A 2P98A 1BN5A 1WY2A 1YJ3A 4QR8A 1XGSA 1WL6A 4RZZA 2GG5A 2DFIA 3CB6A 3IU7A 2BHBA 1QXWA 4IKRA 1QZYA 3FM3A 4U71A 1BOAA 2OKNA 5CE6A 4U69A 3S6BA 5CIKA 4HXXA 4ZNGA 2IW2A 2OAZA 5FCHA 4IDYA 3MX6A 5CDVA 2BN7A 1R5GA 2BWTA 4JUQA 1KQ9A 1WN1A 2BB7A 4FLIA 3PKCA 2BWUA 3Q6DA 1YW7A 2GA2A 1QXYA 5JHUA 2B3LA 2V3ZA 3BIPA 5CDLA 2BHAA 1YVMA 2GGCA 2BWVA 2GG7A 4U6CA 3IU8A 1YW8A 3FMQA 1R5HA 2EVCA 3TB5A 4B28A 4ZWOA 1CHMA 2EA4A 1Y1NA 1N51A 1WBQA 4U6JA 1XGNA 2B3HA 4S00A 2BWSA 4IKUA 4U6WA 2Q95A 4IPAA 4IF7A 5JI6A 2HOWA 2GGBA 3PKBA 1WL9A 1C24A 1C22A 2EVOA 2V3YA 4Z7MA 5CLSA 5D6EA 1WKMA 2GG0A 4RGZ1 4RZYA 2Q96A 4FLJA 5CNXA 4S2TP 1O0XA 4MATA 4U6EA 4R60A 2GG2A 2GU6A 3MATA 2GZ5A 3PKAA 2NQ7A 3PKEA 2MATA 4ZWUA 1C23A 3FMRA 4IKSA 1W7VA 3RORA
chains in the Genus database with same CATH superfamily
2ADUA 4A6VA 1M35A 2ZSGA 4U75A 2BWYA 2NQ6A 5CDEA 1B59A 1WLRA 4FLLA 1A16A 1QXZA 3D27A 3PKDA 4IU6A 1JAWA 2P9AA 3BITA 4ZWPA 2GTXA 2EA2A 2GU4A 2V6CA 4KM3A 4S2RP 4A6WA 4U1BA 2BHDA 4FUKA 1YW9A 5D6FA 1C27A 4EGEA 4FO7A 4FLKA 2B3KA 2BWXA 5FCFA 3IU9A 1KQ0A 4U70A 2V3XA 1W2MA 1XGOA 3CB5A 3MR1A 2GG3A 2Q93A 4IKTA 2GU7A 4U73A 3RVAA 2P99A 2Q94A 4U76A 4FKCA 4S01A 5E5BA 1XNZA 2BWWA 2EVMA 2GU5A 2GG8A 4OOKA 3TAVA 1PV9A 3BIQA 4IECA 3L24A 3L7GA 1C21A 2GG9A 1R58A 4PV4A 4U6ZA 2Q8KA 1XGMA 2BHCA 5JFRA 1MATA 2G6PA 1KP0A 4PNCA 3IG4A 4FO8A 2BH3A 3CTZA 1B6AA 2Q92A 2P98A 1BN5A 1WY2A 1YJ3A 4QR8A 1XGSA 1WL6A 4RZZA 2GG5A 2DFIA 3CB6A 3IU7A 2BHBA 1QXWA 4IKRA 1QZYA 3FM3A 4U71A 1BOAA 2OKNA 5CE6A 4U69A 3S6BA 5CIKA 4HXXA 4ZNGA 2IW2A 2OAZA 5FCHA 4IDYA 3MX6A 5CDVA 2BN7A 1R5GA 2BWTA 4JUQA 1KQ9A 1WN1A 2BB7A 4FLIA 3PKCA 2BWUA 3Q6DA 1YW7A 2GA2A 1QXYA 5JHUA 2B3LA 2V3ZA 3BIPA 5CDLA 2BHAA 1YVMA 2GGCA 2BWVA 2GG7A 4U6CA 3IU8A 1YW8A 3FMQA 1R5HA 2EVCA 3TB5A 4B28A 4ZWOA 1CHMA 2EA4A 1Y1NA 1N51A 1WBQA 4U6JA 1XGNA 2B3HA 4S00A 2BWSA 4IKUA 4U6WA 2Q95A 4IPAA 4IF7A 5JI6A 2HOWA 2GGBA 3PKBA 1WL9A 1C24A 1C22A 2EVOA 2V3YA 4Z7MA 5CLSA 5D6EA 1WKMA 2GG0A 4RGZ1 4RZYA 2Q96A 4FLJA 5CNXA 4S2TP 1O0XA 4MATA 4U6EA 4R60A 2GG2A 2GU6A 3MATA 2GZ5A 3PKAA 2NQ7A 3PKEA 2MATA 4ZWUA 1C23A 3FMRA 4IKSA 1W7VA 3RORA
chains in the Genus database with same CATH topology
2ADUA 4A6VA 1M35A 2ZSGA 4U75A 2BWYA 2NQ6A 5CDEA 1B59A 1WLRA 4FLLA 1A16A 1QXZA 3D27A 3PKDA 4IU6A 1JAWA 2P9AA 3BITA 4ZWPA 2GTXA 2EA2A 2GU4A 2V6CA 4KM3A 4S2RP 4A6WA 4U1BA 2BHDA 4FUKA 1YW9A 5D6FA 1C27A 4EGEA 4FO7A 4FLKA 2B3KA 2BWXA 5FCFA 3IU9A 1KQ0A 4U70A 2V3XA 1W2MA 1XGOA 3CB5A 3MR1A 2GG3A 2Q93A 4IKTA 2GU7A 4U73A 3RVAA 2P99A 2Q94A 4U76A 4FKCA 4S01A 5E5BA 1XNZA 2BWWA 2EVMA 2GU5A 2GG8A 4OOKA 3TAVA 1PV9A 3BIQA 4IECA 3L24A 3L7GA 1C21A 2GG9A 1R58A 4PV4A 4U6ZA 2Q8KA 1XGMA 2BHCA 5JFRA 1MATA 2G6PA 1KP0A 4PNCA 3IG4A 4FO8A 2BH3A 3CTZA 1B6AA 2Q92A 2P98A 1BN5A 1WY2A 1YJ3A 4QR8A 1XGSA 1WL6A 4RZZA 2GG5A 2DFIA 3CB6A 3IU7A 2BHBA 1QXWA 4IKRA 1QZYA 3FM3A 4U71A 1BOAA 2OKNA 5CE6A 4U69A 3S6BA 5CIKA 4HXXA 4ZNGA 2IW2A 2OAZA 5FCHA 4IDYA 3MX6A 5CDVA 2BN7A 1R5GA 2BWTA 4JUQA 1KQ9A 1WN1A 2BB7A 4FLIA 3PKCA 2BWUA 3Q6DA 1YW7A 2GA2A 1QXYA 5JHUA 2B3LA 2V3ZA 3BIPA 5CDLA 2BHAA 1YVMA 2GGCA 2BWVA 2GG7A 4U6CA 3IU8A 1YW8A 3FMQA 1R5HA 2EVCA 3TB5A 4B28A 4ZWOA 1CHMA 2EA4A 1Y1NA 1N51A 1WBQA 4U6JA 1XGNA 2B3HA 4S00A 2BWSA 4IKUA 4U6WA 2Q95A 4IPAA 4IF7A 5JI6A 2HOWA 2GGBA 3PKBA 1WL9A 1C24A 1C22A 2EVOA 2V3YA 4Z7MA 5CLSA 5D6EA 1WKMA 2GG0A 4RGZ1 4RZYA 2Q96A 4FLJA 5CNXA 4S2TP 1O0XA 4MATA 4U6EA 4R60A 2GG2A 2GU6A 3MATA 2GZ5A 3PKAA 2NQ7A 3PKEA 2MATA 4ZWUA 1C23A 3FMRA 4IKSA 1W7VA 3RORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  4A6V A;  1M35 A;  2ZSG A;  4U75 A;  2BWY A;  2NQ6 A;  5CDE A;  1B59 A;  1WLR A;  4FLL A;  1A16 A;  1QXZ A;  3D27 A;  3PKD A;  4IU6 A;  1JAW A;  2P9A A;  3BIT A;  4ZWP A;  2GTX A;  2EA2 A;  2GU4 A;  2V6C A;  4KM3 A;  4S2R P;  4A6W A;  4U1B A;  2BHD A;  4FUK A;  1YW9 A;  5D6F A;  1C27 A;  4EGE A;  4FO7 A;  4FLK A;  2B3K A;  2BWX A;  5FCF A;  3IU9 A;  1KQ0 A;  4U70 A;  2V3X A;  1W2M A;  1XGO A;  3CB5 A;  3MR1 A;  2GG3 A;  2Q93 A;  4IKT A;  2GU7 A;  4U73 A;  3RVA A;  2P99 A;  2Q94 A;  4U76 A;  4FKC A;  4S01 A;  5E5B A;  1XNZ A;  2BWW A;  2EVM A;  2GU5 A;  2GG8 A;  4OOK A;  3TAV A;  1PV9 A;  3BIQ A;  4IEC A;  3L24 A;  3L7G A;  1C21 A;  2GG9 A;  1R58 A;  4PV4 A;  4U6Z A;  2Q8K A;  1XGM A;  2BHC A;  5JFR A;  1MAT A;  2G6P A;  1KP0 A;  4PNC A;  3IG4 A;  4FO8 A;  2BH3 A;  3CTZ A;  1B6A A;  2Q92 A;  2P98 A;  1BN5 A;  1WY2 A;  1YJ3 A;  4QR8 A;  1XGS A;  1WL6 A;  4RZZ A;  2GG5 A;  2DFI A;  3CB6 A;  3IU7 A;  2BHB A;  1QXW A;  4IKR A;  1QZY A;  3FM3 A;  4U71 A;  1BOA A;  2OKN A;  5CE6 A;  4U69 A;  3S6B A;  5CIK A;  4HXX A;  4ZNG A;  2IW2 A;  2OAZ A;  5FCH A;  4IDY A;  3MX6 A;  5CDV A;  2BN7 A;  1R5G A;  2BWT A;  4JUQ A;  1KQ9 A;  1WN1 A;  2BB7 A;  4FLI A;  3PKC A;  2BWU A;  3Q6D A;  1YW7 A;  2GA2 A;  1QXY A;  5JHU A;  2B3L A;  2V3Z A;  3BIP A;  5CDL A;  2BHA A;  1YVM A;  2GGC A;  2BWV A;  2GG7 A;  4U6C A;  3IU8 A;  1YW8 A;  3FMQ A;  1R5H A;  2EVC A;  3TB5 A;  4B28 A;  4ZWO A;  1CHM A;  2EA4 A;  1Y1N A;  1N51 A;  1WBQ A;  4U6J A;  1XGN A;  2B3H A;  4S00 A;  2BWS A;  4IKU A;  4U6W A;  2Q95 A;  4IPA A;  4IF7 A;  5JI6 A;  2HOW A;  2GGB A;  3PKB A;  1WL9 A;  1C24 A;  1C22 A;  2EVO A;  2V3Y A;  4Z7M A;  5CLS A;  5D6E A;  1WKM A;  2GG0 A;  4RGZ 1;  4RZY A;  2Q96 A;  4FLJ A;  5CNX A;  4S2T P;  1O0X A;  4MAT A;  4U6E A;  4R60 A;  2GG2 A;  2GU6 A;  3MAT A;  2GZ5 A;  3PKA A;  2NQ7 A;  3PKE A;  2MAT A;  4ZWU A;  1C23 A;  3FMR A;  4IKS A;  1W7V A;  3ROR A; 
#chains in the Genus database with same CATH topology
 2ADU A;  4A6V A;  1M35 A;  2ZSG A;  4U75 A;  2BWY A;  2NQ6 A;  5CDE A;  1B59 A;  1WLR A;  4FLL A;  1A16 A;  1QXZ A;  3D27 A;  3PKD A;  4IU6 A;  1JAW A;  2P9A A;  3BIT A;  4ZWP A;  2GTX A;  2EA2 A;  2GU4 A;  2V6C A;  4KM3 A;  4S2R P;  4A6W A;  4U1B A;  2BHD A;  4FUK A;  1YW9 A;  5D6F A;  1C27 A;  4EGE A;  4FO7 A;  4FLK A;  2B3K A;  2BWX A;  5FCF A;  3IU9 A;  1KQ0 A;  4U70 A;  2V3X A;  1W2M A;  1XGO A;  3CB5 A;  3MR1 A;  2GG3 A;  2Q93 A;  4IKT A;  2GU7 A;  4U73 A;  3RVA A;  2P99 A;  2Q94 A;  4U76 A;  4FKC A;  4S01 A;  5E5B A;  1XNZ A;  2BWW A;  2EVM A;  2GU5 A;  2GG8 A;  4OOK A;  3TAV A;  1PV9 A;  3BIQ A;  4IEC A;  3L24 A;  3L7G A;  1C21 A;  2GG9 A;  1R58 A;  4PV4 A;  4U6Z A;  2Q8K A;  1XGM A;  2BHC A;  5JFR A;  1MAT A;  2G6P A;  1KP0 A;  4PNC A;  3IG4 A;  4FO8 A;  2BH3 A;  3CTZ A;  1B6A A;  2Q92 A;  2P98 A;  1BN5 A;  1WY2 A;  1YJ3 A;  4QR8 A;  1XGS A;  1WL6 A;  4RZZ A;  2GG5 A;  2DFI A;  3CB6 A;  3IU7 A;  2BHB A;  1QXW A;  4IKR A;  1QZY A;  3FM3 A;  4U71 A;  1BOA A;  2OKN A;  5CE6 A;  4U69 A;  3S6B A;  5CIK A;  4HXX A;  4ZNG A;  2IW2 A;  2OAZ A;  5FCH A;  4IDY A;  3MX6 A;  5CDV A;  2BN7 A;  1R5G A;  2BWT A;  4JUQ A;  1KQ9 A;  1WN1 A;  2BB7 A;  4FLI A;  3PKC A;  2BWU A;  3Q6D A;  1YW7 A;  2GA2 A;  1QXY A;  5JHU A;  2B3L A;  2V3Z A;  3BIP A;  5CDL A;  2BHA A;  1YVM A;  2GGC A;  2BWV A;  2GG7 A;  4U6C A;  3IU8 A;  1YW8 A;  3FMQ A;  1R5H A;  2EVC A;  3TB5 A;  4B28 A;  4ZWO A;  1CHM A;  2EA4 A;  1Y1N A;  1N51 A;  1WBQ A;  4U6J A;  1XGN A;  2B3H A;  4S00 A;  2BWS A;  4IKU A;  4U6W A;  2Q95 A;  4IPA A;  4IF7 A;  5JI6 A;  2HOW A;  2GGB A;  3PKB A;  1WL9 A;  1C24 A;  1C22 A;  2EVO A;  2V3Y A;  4Z7M A;  5CLS A;  5D6E A;  1WKM A;  2GG0 A;  4RGZ 1;  4RZY A;  2Q96 A;  4FLJ A;  5CNX A;  4S2T P;  1O0X A;  4MAT A;  4U6E A;  4R60 A;  2GG2 A;  2GU6 A;  3MAT A;  2GZ5 A;  3PKA A;  2NQ7 A;  3PKE A;  2MAT A;  4ZWU A;  1C23 A;  3FMR A;  4IKS A;  1W7V A;  3ROR A; 
#chains in the Genus database with same CATH homology
 2ADU A;  4A6V A;  1M35 A;  2ZSG A;  4U75 A;  2BWY A;  2NQ6 A;  5CDE A;  1B59 A;  1WLR A;  4FLL A;  1A16 A;  1QXZ A;  3D27 A;  3PKD A;  4IU6 A;  1JAW A;  2P9A A;  3BIT A;  4ZWP A;  2GTX A;  2EA2 A;  2GU4 A;  2V6C A;  4KM3 A;  4S2R P;  4A6W A;  4U1B A;  2BHD A;  4FUK A;  1YW9 A;  5D6F A;  1C27 A;  4EGE A;  4FO7 A;  4FLK A;  2B3K A;  2BWX A;  5FCF A;  3IU9 A;  1KQ0 A;  4U70 A;  2V3X A;  1W2M A;  1XGO A;  3CB5 A;  3MR1 A;  2GG3 A;  2Q93 A;  4IKT A;  2GU7 A;  4U73 A;  3RVA A;  2P99 A;  2Q94 A;  4U76 A;  4FKC A;  4S01 A;  5E5B A;  1XNZ A;  2BWW A;  2EVM A;  2GU5 A;  2GG8 A;  4OOK A;  3TAV A;  1PV9 A;  3BIQ A;  4IEC A;  3L24 A;  3L7G A;  1C21 A;  2GG9 A;  1R58 A;  4PV4 A;  4U6Z A;  2Q8K A;  1XGM A;  2BHC A;  5JFR A;  1MAT A;  2G6P A;  1KP0 A;  4PNC A;  3IG4 A;  4FO8 A;  2BH3 A;  3CTZ A;  1B6A A;  2Q92 A;  2P98 A;  1BN5 A;  1WY2 A;  1YJ3 A;  4QR8 A;  1XGS A;  1WL6 A;  4RZZ A;  2GG5 A;  2DFI A;  3CB6 A;  3IU7 A;  2BHB A;  1QXW A;  4IKR A;  1QZY A;  3FM3 A;  4U71 A;  1BOA A;  2OKN A;  5CE6 A;  4U69 A;  3S6B A;  5CIK A;  4HXX A;  4ZNG A;  2IW2 A;  2OAZ A;  5FCH A;  4IDY A;  3MX6 A;  5CDV A;  2BN7 A;  1R5G A;  2BWT A;  4JUQ A;  1KQ9 A;  1WN1 A;  2BB7 A;  4FLI A;  3PKC A;  2BWU A;  3Q6D A;  1YW7 A;  2GA2 A;  1QXY A;  5JHU A;  2B3L A;  2V3Z A;  3BIP A;  5CDL A;  2BHA A;  1YVM A;  2GGC A;  2BWV A;  2GG7 A;  4U6C A;  3IU8 A;  1YW8 A;  3FMQ A;  1R5H A;  2EVC A;  3TB5 A;  4B28 A;  4ZWO A;  1CHM A;  2EA4 A;  1Y1N A;  1N51 A;  1WBQ A;  4U6J A;  1XGN A;  2B3H A;  4S00 A;  2BWS A;  4IKU A;  4U6W A;  2Q95 A;  4IPA A;  4IF7 A;  5JI6 A;  2HOW A;  2GGB A;  3PKB A;  1WL9 A;  1C24 A;  1C22 A;  2EVO A;  2V3Y A;  4Z7M A;  5CLS A;  5D6E A;  1WKM A;  2GG0 A;  4RGZ 1;  4RZY A;  2Q96 A;  4FLJ A;  5CNX A;  4S2T P;  1O0X A;  4MAT A;  4U6E A;  4R60 A;  2GG2 A;  2GU6 A;  3MAT A;  2GZ5 A;  3PKA A;  2NQ7 A;  3PKE A;  2MAT A;  4ZWU A;  1C23 A;  3FMR A;  4IKS A;  1W7V A;  3ROR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...