2P98A

E. coli methionine aminopeptidase monometalated with inhibitor ye7
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p98A00
2EA2A 5CE6A 2GG0A 1B59A 1C22A 1XGMA 2V6CA 1A16A 3PKEA 1QXYA 2IW2A 1YW7A 2EVOA 5CLSA 2GGBA 2V3YA 4FUKA 4U6CA 4U76A 3L7GA 3PKBA 1R5GA 2GG7A 4U69A 1R58A 1YJ3A 4Z7MA 3FMQA 4PV4A 4RZZA 3MATA 1R5HA 4U71A 1WBQA 5FCHA 3CB5A 4B28A 2B3LA 2B3HA 2GGCA 2Q94A 4FLKA 2BHDA 3CTZA 1BN5A 2V3XA 3PKCA 4S2TP 3RVAA 1O0XA 4FLJA 2GG5A 2OAZA 2EVMA 2GU7A 2Q93A 2BWTA 4ZWUA 4U6EA 1JAWA 2ADUA 4S00A 4FLIA 2ZSGA 2GU4A 4IECA 3S6BA 2BHCA 1WL9A 3PKDA 2GG8A 2NQ7A 2HOWA 2Q92A 2G6PA 1XNZA 3MX6A 5CDEA 3PKAA 2BHBA 4ZWOA 2MATA 4U1BA 3IU9A 2BWUA 4OOKA 4PNCA 5JHUA 5D6EA 1W2MA 2Q8KA 3MR1A 2EVCA 4IKUA 4ZWPA 1XGNA 2NQ6A 2OKNA 1KP0A 1YW8A 3TB5A 3RORA 1XGSA 4FLLA 1YVMA 4KM3A 5CDVA 2P98A 3CB6A 4IKTA 4U6ZA 5JFRA 5D6FA 2GG3A 4MATA 1BOAA 1B6AA 4IU6A 5CIKA 2GG2A 2GA2A 4IPAA 1N51A 4HXXA 2BWWA 4U6JA 3FM3A 1W7VA 4S2RP 1QXWA 3L24A 4FO7A 2GTXA 1Y1NA 2BWXA 2BWVA 3BIPA 2V3ZA 4ZNGA 4JUQA 2GU5A 2BHAA 2P9AA 2BWYA 1CHMA 2DFIA 1WL6A 1C23A 3D27A 1KQ9A 4U6WA 5E5BA 2GZ5A 1MATA 1WLRA 3BIQA 2P99A 2BB7A 1WKMA 1WY2A 1C27A 3BITA 2Q95A 1PV9A 4R60A 2BWSA 3TAVA 4IDYA 4QR8A 2B3KA 1C21A 2Q96A 4FO8A 5CNXA 3IU7A 1C24A 1QXZA 1XGOA 2EA4A 1YW9A 4EGEA 2GG9A 5CDLA 4RGZ1 2BN7A 4IKSA 5JI6A 4U75A 3FMRA 4U70A 4A6WA 4U73A 3Q6DA 4IF7A 2GU6A 1KQ0A 1WN1A 3IG4A 1M35A 3IU8A 4FKCA 4RZYA 5FCFA 4A6VA 2BH3A 4S01A 4IKRA 1QZYA
chains in the Genus database with same CATH superfamily
2EA2A 5CE6A 2GG0A 1B59A 1C22A 1XGMA 2V6CA 1A16A 3PKEA 1QXYA 2IW2A 1YW7A 2EVOA 5CLSA 2GGBA 2V3YA 4FUKA 4U6CA 4U76A 3L7GA 3PKBA 1R5GA 2GG7A 4U69A 1R58A 1YJ3A 4Z7MA 3FMQA 4PV4A 4RZZA 3MATA 1R5HA 4U71A 1WBQA 5FCHA 3CB5A 4B28A 2B3LA 2B3HA 2GGCA 2Q94A 4FLKA 2BHDA 3CTZA 1BN5A 2V3XA 3PKCA 4S2TP 3RVAA 1O0XA 4FLJA 2GG5A 2OAZA 2EVMA 2GU7A 2Q93A 2BWTA 4ZWUA 4U6EA 1JAWA 2ADUA 4S00A 4FLIA 2ZSGA 2GU4A 4IECA 3S6BA 2BHCA 1WL9A 3PKDA 2GG8A 2NQ7A 2HOWA 2Q92A 2G6PA 1XNZA 3MX6A 5CDEA 3PKAA 2BHBA 4ZWOA 2MATA 4U1BA 3IU9A 2BWUA 4OOKA 4PNCA 5JHUA 5D6EA 1W2MA 2Q8KA 3MR1A 2EVCA 4IKUA 4ZWPA 1XGNA 2NQ6A 2OKNA 1KP0A 1YW8A 3TB5A 3RORA 1XGSA 4FLLA 1YVMA 4KM3A 5CDVA 2P98A 3CB6A 4IKTA 4U6ZA 5JFRA 5D6FA 2GG3A 4MATA 1BOAA 1B6AA 4IU6A 5CIKA 2GG2A 2GA2A 4IPAA 1N51A 4HXXA 2BWWA 4U6JA 3FM3A 1W7VA 4S2RP 1QXWA 3L24A 4FO7A 2GTXA 1Y1NA 2BWXA 2BWVA 3BIPA 2V3ZA 4ZNGA 4JUQA 2GU5A 2BHAA 2P9AA 2BWYA 1CHMA 2DFIA 1WL6A 1C23A 3D27A 1KQ9A 4U6WA 5E5BA 2GZ5A 1MATA 1WLRA 3BIQA 2P99A 2BB7A 1WKMA 1WY2A 1C27A 3BITA 2Q95A 1PV9A 4R60A 2BWSA 3TAVA 4IDYA 4QR8A 2B3KA 1C21A 2Q96A 4FO8A 5CNXA 3IU7A 1C24A 1QXZA 1XGOA 2EA4A 1YW9A 4EGEA 2GG9A 5CDLA 4RGZ1 2BN7A 4IKSA 5JI6A 4U75A 3FMRA 4U70A 4A6WA 4U73A 3Q6DA 4IF7A 2GU6A 1KQ0A 1WN1A 3IG4A 1M35A 3IU8A 4FKCA 4RZYA 5FCFA 4A6VA 2BH3A 4S01A 4IKRA 1QZYA
chains in the Genus database with same CATH topology
2EA2A 5CE6A 2GG0A 1B59A 1C22A 1XGMA 2V6CA 1A16A 3PKEA 1QXYA 2IW2A 1YW7A 2EVOA 5CLSA 2GGBA 2V3YA 4FUKA 4U6CA 4U76A 3L7GA 3PKBA 1R5GA 2GG7A 4U69A 1R58A 1YJ3A 4Z7MA 3FMQA 4PV4A 4RZZA 3MATA 1R5HA 4U71A 1WBQA 5FCHA 3CB5A 4B28A 2B3LA 2B3HA 2GGCA 2Q94A 4FLKA 2BHDA 3CTZA 1BN5A 2V3XA 3PKCA 4S2TP 3RVAA 1O0XA 4FLJA 2GG5A 2OAZA 2EVMA 2GU7A 2Q93A 2BWTA 4ZWUA 4U6EA 1JAWA 2ADUA 4S00A 4FLIA 2ZSGA 2GU4A 4IECA 3S6BA 2BHCA 1WL9A 3PKDA 2GG8A 2NQ7A 2HOWA 2Q92A 2G6PA 1XNZA 3MX6A 5CDEA 3PKAA 2BHBA 4ZWOA 2MATA 4U1BA 3IU9A 2BWUA 4OOKA 4PNCA 5JHUA 5D6EA 1W2MA 2Q8KA 3MR1A 2EVCA 4IKUA 4ZWPA 1XGNA 2NQ6A 2OKNA 1KP0A 1YW8A 3TB5A 3RORA 1XGSA 4FLLA 1YVMA 4KM3A 5CDVA 2P98A 3CB6A 4IKTA 4U6ZA 5JFRA 5D6FA 2GG3A 4MATA 1BOAA 1B6AA 4IU6A 5CIKA 2GG2A 2GA2A 4IPAA 1N51A 4HXXA 2BWWA 4U6JA 3FM3A 1W7VA 4S2RP 1QXWA 3L24A 4FO7A 2GTXA 1Y1NA 2BWXA 2BWVA 3BIPA 2V3ZA 4ZNGA 4JUQA 2GU5A 2BHAA 2P9AA 2BWYA 1CHMA 2DFIA 1WL6A 1C23A 3D27A 1KQ9A 4U6WA 5E5BA 2GZ5A 1MATA 1WLRA 3BIQA 2P99A 2BB7A 1WKMA 1WY2A 1C27A 3BITA 2Q95A 1PV9A 4R60A 2BWSA 3TAVA 4IDYA 4QR8A 2B3KA 1C21A 2Q96A 4FO8A 5CNXA 3IU7A 1C24A 1QXZA 1XGOA 2EA4A 1YW9A 4EGEA 2GG9A 5CDLA 4RGZ1 2BN7A 4IKSA 5JI6A 4U75A 3FMRA 4U70A 4A6WA 4U73A 3Q6DA 4IF7A 2GU6A 1KQ0A 1WN1A 3IG4A 1M35A 3IU8A 4FKCA 4RZYA 5FCFA 4A6VA 2BH3A 4S01A 4IKRA 1QZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA2 A;  5CE6 A;  2GG0 A;  1B59 A;  1C22 A;  1XGM A;  2V6C A;  1A16 A;  3PKE A;  1QXY A;  2IW2 A;  1YW7 A;  2EVO A;  5CLS A;  2GGB A;  2V3Y A;  4FUK A;  4U6C A;  4U76 A;  3L7G A;  3PKB A;  1R5G A;  2GG7 A;  4U69 A;  1R58 A;  1YJ3 A;  4Z7M A;  3FMQ A;  4PV4 A;  4RZZ A;  3MAT A;  1R5H A;  4U71 A;  1WBQ A;  5FCH A;  3CB5 A;  4B28 A;  2B3L A;  2B3H A;  2GGC A;  2Q94 A;  4FLK A;  2BHD A;  3CTZ A;  1BN5 A;  2V3X A;  3PKC A;  4S2T P;  3RVA A;  1O0X A;  4FLJ A;  2GG5 A;  2OAZ A;  2EVM A;  2GU7 A;  2Q93 A;  2BWT A;  4ZWU A;  4U6E A;  1JAW A;  2ADU A;  4S00 A;  4FLI A;  2ZSG A;  2GU4 A;  4IEC A;  3S6B A;  2BHC A;  1WL9 A;  3PKD A;  2GG8 A;  2NQ7 A;  2HOW A;  2Q92 A;  2G6P A;  1XNZ A;  3MX6 A;  5CDE A;  3PKA A;  2BHB A;  4ZWO A;  2MAT A;  4U1B A;  3IU9 A;  2BWU A;  4OOK A;  4PNC A;  5JHU A;  5D6E A;  1W2M A;  2Q8K A;  3MR1 A;  2EVC A;  4IKU A;  4ZWP A;  1XGN A;  2NQ6 A;  2OKN A;  1KP0 A;  1YW8 A;  3TB5 A;  3ROR A;  1XGS A;  4FLL A;  1YVM A;  4KM3 A;  5CDV A;  2P98 A;  3CB6 A;  4IKT A;  4U6Z A;  5JFR A;  5D6F A;  2GG3 A;  4MAT A;  1BOA A;  1B6A A;  4IU6 A;  5CIK A;  2GG2 A;  2GA2 A;  4IPA A;  1N51 A;  4HXX A;  2BWW A;  4U6J A;  3FM3 A;  1W7V A;  4S2R P;  1QXW A;  3L24 A;  4FO7 A;  2GTX A;  1Y1N A;  2BWX A;  2BWV A;  3BIP A;  2V3Z A;  4ZNG A;  4JUQ A;  2GU5 A;  2BHA A;  2P9A A;  2BWY A;  1CHM A;  2DFI A;  1WL6 A;  1C23 A;  3D27 A;  1KQ9 A;  4U6W A;  5E5B A;  2GZ5 A;  1MAT A;  1WLR A;  3BIQ A;  2P99 A;  2BB7 A;  1WKM A;  1WY2 A;  1C27 A;  3BIT A;  2Q95 A;  1PV9 A;  4R60 A;  2BWS A;  3TAV A;  4IDY A;  4QR8 A;  2B3K A;  1C21 A;  2Q96 A;  4FO8 A;  5CNX A;  3IU7 A;  1C24 A;  1QXZ A;  1XGO A;  2EA4 A;  1YW9 A;  4EGE A;  2GG9 A;  5CDL A;  4RGZ 1;  2BN7 A;  4IKS A;  5JI6 A;  4U75 A;  3FMR A;  4U70 A;  4A6W A;  4U73 A;  3Q6D A;  4IF7 A;  2GU6 A;  1KQ0 A;  1WN1 A;  3IG4 A;  1M35 A;  3IU8 A;  4FKC A;  4RZY A;  5FCF A;  4A6V A;  2BH3 A;  4S01 A;  4IKR A;  1QZY A; 
#chains in the Genus database with same CATH topology
 2EA2 A;  5CE6 A;  2GG0 A;  1B59 A;  1C22 A;  1XGM A;  2V6C A;  1A16 A;  3PKE A;  1QXY A;  2IW2 A;  1YW7 A;  2EVO A;  5CLS A;  2GGB A;  2V3Y A;  4FUK A;  4U6C A;  4U76 A;  3L7G A;  3PKB A;  1R5G A;  2GG7 A;  4U69 A;  1R58 A;  1YJ3 A;  4Z7M A;  3FMQ A;  4PV4 A;  4RZZ A;  3MAT A;  1R5H A;  4U71 A;  1WBQ A;  5FCH A;  3CB5 A;  4B28 A;  2B3L A;  2B3H A;  2GGC A;  2Q94 A;  4FLK A;  2BHD A;  3CTZ A;  1BN5 A;  2V3X A;  3PKC A;  4S2T P;  3RVA A;  1O0X A;  4FLJ A;  2GG5 A;  2OAZ A;  2EVM A;  2GU7 A;  2Q93 A;  2BWT A;  4ZWU A;  4U6E A;  1JAW A;  2ADU A;  4S00 A;  4FLI A;  2ZSG A;  2GU4 A;  4IEC A;  3S6B A;  2BHC A;  1WL9 A;  3PKD A;  2GG8 A;  2NQ7 A;  2HOW A;  2Q92 A;  2G6P A;  1XNZ A;  3MX6 A;  5CDE A;  3PKA A;  2BHB A;  4ZWO A;  2MAT A;  4U1B A;  3IU9 A;  2BWU A;  4OOK A;  4PNC A;  5JHU A;  5D6E A;  1W2M A;  2Q8K A;  3MR1 A;  2EVC A;  4IKU A;  4ZWP A;  1XGN A;  2NQ6 A;  2OKN A;  1KP0 A;  1YW8 A;  3TB5 A;  3ROR A;  1XGS A;  4FLL A;  1YVM A;  4KM3 A;  5CDV A;  2P98 A;  3CB6 A;  4IKT A;  4U6Z A;  5JFR A;  5D6F A;  2GG3 A;  4MAT A;  1BOA A;  1B6A A;  4IU6 A;  5CIK A;  2GG2 A;  2GA2 A;  4IPA A;  1N51 A;  4HXX A;  2BWW A;  4U6J A;  3FM3 A;  1W7V A;  4S2R P;  1QXW A;  3L24 A;  4FO7 A;  2GTX A;  1Y1N A;  2BWX A;  2BWV A;  3BIP A;  2V3Z A;  4ZNG A;  4JUQ A;  2GU5 A;  2BHA A;  2P9A A;  2BWY A;  1CHM A;  2DFI A;  1WL6 A;  1C23 A;  3D27 A;  1KQ9 A;  4U6W A;  5E5B A;  2GZ5 A;  1MAT A;  1WLR A;  3BIQ A;  2P99 A;  2BB7 A;  1WKM A;  1WY2 A;  1C27 A;  3BIT A;  2Q95 A;  1PV9 A;  4R60 A;  2BWS A;  3TAV A;  4IDY A;  4QR8 A;  2B3K A;  1C21 A;  2Q96 A;  4FO8 A;  5CNX A;  3IU7 A;  1C24 A;  1QXZ A;  1XGO A;  2EA4 A;  1YW9 A;  4EGE A;  2GG9 A;  5CDL A;  4RGZ 1;  2BN7 A;  4IKS A;  5JI6 A;  4U75 A;  3FMR A;  4U70 A;  4A6W A;  4U73 A;  3Q6D A;  4IF7 A;  2GU6 A;  1KQ0 A;  1WN1 A;  3IG4 A;  1M35 A;  3IU8 A;  4FKC A;  4RZY A;  5FCF A;  4A6V A;  2BH3 A;  4S01 A;  4IKR A;  1QZY A; 
#chains in the Genus database with same CATH homology
 2EA2 A;  5CE6 A;  2GG0 A;  1B59 A;  1C22 A;  1XGM A;  2V6C A;  1A16 A;  3PKE A;  1QXY A;  2IW2 A;  1YW7 A;  2EVO A;  5CLS A;  2GGB A;  2V3Y A;  4FUK A;  4U6C A;  4U76 A;  3L7G A;  3PKB A;  1R5G A;  2GG7 A;  4U69 A;  1R58 A;  1YJ3 A;  4Z7M A;  3FMQ A;  4PV4 A;  4RZZ A;  3MAT A;  1R5H A;  4U71 A;  1WBQ A;  5FCH A;  3CB5 A;  4B28 A;  2B3L A;  2B3H A;  2GGC A;  2Q94 A;  4FLK A;  2BHD A;  3CTZ A;  1BN5 A;  2V3X A;  3PKC A;  4S2T P;  3RVA A;  1O0X A;  4FLJ A;  2GG5 A;  2OAZ A;  2EVM A;  2GU7 A;  2Q93 A;  2BWT A;  4ZWU A;  4U6E A;  1JAW A;  2ADU A;  4S00 A;  4FLI A;  2ZSG A;  2GU4 A;  4IEC A;  3S6B A;  2BHC A;  1WL9 A;  3PKD A;  2GG8 A;  2NQ7 A;  2HOW A;  2Q92 A;  2G6P A;  1XNZ A;  3MX6 A;  5CDE A;  3PKA A;  2BHB A;  4ZWO A;  2MAT A;  4U1B A;  3IU9 A;  2BWU A;  4OOK A;  4PNC A;  5JHU A;  5D6E A;  1W2M A;  2Q8K A;  3MR1 A;  2EVC A;  4IKU A;  4ZWP A;  1XGN A;  2NQ6 A;  2OKN A;  1KP0 A;  1YW8 A;  3TB5 A;  3ROR A;  1XGS A;  4FLL A;  1YVM A;  4KM3 A;  5CDV A;  2P98 A;  3CB6 A;  4IKT A;  4U6Z A;  5JFR A;  5D6F A;  2GG3 A;  4MAT A;  1BOA A;  1B6A A;  4IU6 A;  5CIK A;  2GG2 A;  2GA2 A;  4IPA A;  1N51 A;  4HXX A;  2BWW A;  4U6J A;  3FM3 A;  1W7V A;  4S2R P;  1QXW A;  3L24 A;  4FO7 A;  2GTX A;  1Y1N A;  2BWX A;  2BWV A;  3BIP A;  2V3Z A;  4ZNG A;  4JUQ A;  2GU5 A;  2BHA A;  2P9A A;  2BWY A;  1CHM A;  2DFI A;  1WL6 A;  1C23 A;  3D27 A;  1KQ9 A;  4U6W A;  5E5B A;  2GZ5 A;  1MAT A;  1WLR A;  3BIQ A;  2P99 A;  2BB7 A;  1WKM A;  1WY2 A;  1C27 A;  3BIT A;  2Q95 A;  1PV9 A;  4R60 A;  2BWS A;  3TAV A;  4IDY A;  4QR8 A;  2B3K A;  1C21 A;  2Q96 A;  4FO8 A;  5CNX A;  3IU7 A;  1C24 A;  1QXZ A;  1XGO A;  2EA4 A;  1YW9 A;  4EGE A;  2GG9 A;  5CDL A;  4RGZ 1;  2BN7 A;  4IKS A;  5JI6 A;  4U75 A;  3FMR A;  4U70 A;  4A6W A;  4U73 A;  3Q6D A;  4IF7 A;  2GU6 A;  1KQ0 A;  1WN1 A;  3IG4 A;  1M35 A;  3IU8 A;  4FKC A;  4RZY A;  5FCF A;  4A6V A;  2BH3 A;  4S01 A;  4IKR A;  1QZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...