2P98A

E. coli methionine aminopeptidase monometalated with inhibitor ye7
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p98A00
3S6BA 4IF7A 2BN7A 2Q92A 3CTZA 1XGMA 2GU4A 1XGSA 2V3ZA 3L24A 5FCHA 3PKAA 2ADUA 3L7GA 4S2TP 2NQ7A 3RVAA 1QXZA 4FLIA 1Y1NA 2GTXA 4U70A 1YW9A 1QZYA 1BOAA 1WL6A 1JAWA 1WBQA 2BHBA 4A6WA 3MATA 4OOKA 2BWVA 1R5GA 3BITA 2Q95A 1QXWA 4U6WA 2EVMA 4RZYA 4HXXA 4U73A 2BWXA 1KP0A 2GG5A 4U6CA 4IDYA 2BHCA 4MATA 4ZWUA 1XGNA 3D27A 1YW7A 3CB5A 4S01A 5E5BA 3TAVA 4FO8A 2OAZA 2GG0A 3IU9A 4IKSA 2B3HA 2Q93A 1A16A 5JI6A 2EA2A 1XNZA 3MR1A 3MX6A 2BWUA 2GU6A 1WL9A 4ZWOA 2EA4A 1C24A 2BWTA 2V3XA 4U76A 2GG2A 1MATA 1WKMA 4B28A 2GG7A 3PKDA 3PKCA 2GU7A 2GZ5A 4IU6A 1YVMA 1R58A 2IW2A 2BH3A 1W2MA 1W7VA 4R60A 4RGZ1 5FCFA 2P9AA 4FUKA 2OKNA 2BWWA 1CHMA 2P98A 1B59A 4FLLA 3IU8A 4U69A 1C27A 2Q94A 3CB6A 5CNXA 1C21A 1WN1A 1C22A 4FLJA 2Q8KA 2EVCA 2BHDA 2Q96A 2BB7A 3FM3A 2P99A 4U6ZA 3TB5A 4PV4A 5CDVA 1BN5A 2NQ6A 4FO7A 1R5HA 4IPAA 2GA2A 4IKRA 1B6AA 4JUQA 4ZWPA 3IU7A 4S00A 5CDEA 1QXYA 1WY2A 3IG4A 2GGCA 3BIPA 3PKEA 4A6VA 2HOWA 2V3YA 3FMRA 4U6EA 1KQ9A 1YJ3A 1M35A 2BWYA 2GG8A 4U75A 3Q6DA 5CIKA 2GG9A 2ZSGA 4Z7MA 1N51A 2V6CA 5JFRA 2DFIA 1KQ0A 2BHAA 4KM3A 4PNCA 5CDLA 4ZNGA 3BIQA 2BWSA 2MATA 2EVOA 2GGBA 2B3LA 2G6PA 5D6FA 4IKUA 3PKBA 4IECA 2GG3A 3RORA 5D6EA 3FMQA 1YW8A 5CLSA 4U6JA 4FKCA 4S2RP 4EGEA 5CE6A 5JHUA 1PV9A 4U71A 2GU5A 4FLKA 4RZZA 4IKTA 1XGOA 4QR8A 2B3KA 1O0XA 1WLRA 4U1BA 1C23A
chains in the Genus database with same CATH superfamily
3S6BA 4IF7A 2BN7A 2Q92A 3CTZA 1XGMA 2GU4A 1XGSA 2V3ZA 3L24A 5FCHA 3PKAA 2ADUA 3L7GA 4S2TP 2NQ7A 3RVAA 1QXZA 4FLIA 1Y1NA 2GTXA 4U70A 1YW9A 1QZYA 1BOAA 1WL6A 1JAWA 1WBQA 2BHBA 4A6WA 3MATA 4OOKA 2BWVA 1R5GA 3BITA 2Q95A 1QXWA 4U6WA 2EVMA 4RZYA 4HXXA 4U73A 2BWXA 1KP0A 2GG5A 4U6CA 4IDYA 2BHCA 4MATA 4ZWUA 1XGNA 3D27A 1YW7A 3CB5A 4S01A 5E5BA 3TAVA 4FO8A 2OAZA 2GG0A 3IU9A 4IKSA 2B3HA 2Q93A 1A16A 5JI6A 2EA2A 1XNZA 3MR1A 3MX6A 2BWUA 2GU6A 1WL9A 4ZWOA 2EA4A 1C24A 2BWTA 2V3XA 4U76A 2GG2A 1MATA 1WKMA 4B28A 2GG7A 3PKDA 3PKCA 2GU7A 2GZ5A 4IU6A 1YVMA 1R58A 2IW2A 2BH3A 1W2MA 1W7VA 4R60A 4RGZ1 5FCFA 2P9AA 4FUKA 2OKNA 2BWWA 1CHMA 2P98A 1B59A 4FLLA 3IU8A 4U69A 1C27A 2Q94A 3CB6A 5CNXA 1C21A 1WN1A 1C22A 4FLJA 2Q8KA 2EVCA 2BHDA 2Q96A 2BB7A 3FM3A 2P99A 4U6ZA 3TB5A 4PV4A 5CDVA 1BN5A 2NQ6A 4FO7A 1R5HA 4IPAA 2GA2A 4IKRA 1B6AA 4JUQA 4ZWPA 3IU7A 4S00A 5CDEA 1QXYA 1WY2A 3IG4A 2GGCA 3BIPA 3PKEA 4A6VA 2HOWA 2V3YA 3FMRA 4U6EA 1KQ9A 1YJ3A 1M35A 2BWYA 2GG8A 4U75A 3Q6DA 5CIKA 2GG9A 2ZSGA 4Z7MA 1N51A 2V6CA 5JFRA 2DFIA 1KQ0A 2BHAA 4KM3A 4PNCA 5CDLA 4ZNGA 3BIQA 2BWSA 2MATA 2EVOA 2GGBA 2B3LA 2G6PA 5D6FA 4IKUA 3PKBA 4IECA 2GG3A 3RORA 5D6EA 3FMQA 1YW8A 5CLSA 4U6JA 4FKCA 4S2RP 4EGEA 5CE6A 5JHUA 1PV9A 4U71A 2GU5A 4FLKA 4RZZA 4IKTA 1XGOA 4QR8A 2B3KA 1O0XA 1WLRA 4U1BA 1C23A
chains in the Genus database with same CATH topology
3S6BA 4IF7A 2BN7A 2Q92A 3CTZA 1XGMA 2GU4A 1XGSA 2V3ZA 3L24A 5FCHA 3PKAA 2ADUA 3L7GA 4S2TP 2NQ7A 3RVAA 1QXZA 4FLIA 1Y1NA 2GTXA 4U70A 1YW9A 1QZYA 1BOAA 1WL6A 1JAWA 1WBQA 2BHBA 4A6WA 3MATA 4OOKA 2BWVA 1R5GA 3BITA 2Q95A 1QXWA 4U6WA 2EVMA 4RZYA 4HXXA 4U73A 2BWXA 1KP0A 2GG5A 4U6CA 4IDYA 2BHCA 4MATA 4ZWUA 1XGNA 3D27A 1YW7A 3CB5A 4S01A 5E5BA 3TAVA 4FO8A 2OAZA 2GG0A 3IU9A 4IKSA 2B3HA 2Q93A 1A16A 5JI6A 2EA2A 1XNZA 3MR1A 3MX6A 2BWUA 2GU6A 1WL9A 4ZWOA 2EA4A 1C24A 2BWTA 2V3XA 4U76A 2GG2A 1MATA 1WKMA 4B28A 2GG7A 3PKDA 3PKCA 2GU7A 2GZ5A 4IU6A 1YVMA 1R58A 2IW2A 2BH3A 1W2MA 1W7VA 4R60A 4RGZ1 5FCFA 2P9AA 4FUKA 2OKNA 2BWWA 1CHMA 2P98A 1B59A 4FLLA 3IU8A 4U69A 1C27A 2Q94A 3CB6A 5CNXA 1C21A 1WN1A 1C22A 4FLJA 2Q8KA 2EVCA 2BHDA 2Q96A 2BB7A 3FM3A 2P99A 4U6ZA 3TB5A 4PV4A 5CDVA 1BN5A 2NQ6A 4FO7A 1R5HA 4IPAA 2GA2A 4IKRA 1B6AA 4JUQA 4ZWPA 3IU7A 4S00A 5CDEA 1QXYA 1WY2A 3IG4A 2GGCA 3BIPA 3PKEA 4A6VA 2HOWA 2V3YA 3FMRA 4U6EA 1KQ9A 1YJ3A 1M35A 2BWYA 2GG8A 4U75A 3Q6DA 5CIKA 2GG9A 2ZSGA 4Z7MA 1N51A 2V6CA 5JFRA 2DFIA 1KQ0A 2BHAA 4KM3A 4PNCA 5CDLA 4ZNGA 3BIQA 2BWSA 2MATA 2EVOA 2GGBA 2B3LA 2G6PA 5D6FA 4IKUA 3PKBA 4IECA 2GG3A 3RORA 5D6EA 3FMQA 1YW8A 5CLSA 4U6JA 4FKCA 4S2RP 4EGEA 5CE6A 5JHUA 1PV9A 4U71A 2GU5A 4FLKA 4RZZA 4IKTA 1XGOA 4QR8A 2B3KA 1O0XA 1WLRA 4U1BA 1C23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6B A;  4IF7 A;  2BN7 A;  2Q92 A;  3CTZ A;  1XGM A;  2GU4 A;  1XGS A;  2V3Z A;  3L24 A;  5FCH A;  3PKA A;  2ADU A;  3L7G A;  4S2T P;  2NQ7 A;  3RVA A;  1QXZ A;  4FLI A;  1Y1N A;  2GTX A;  4U70 A;  1YW9 A;  1QZY A;  1BOA A;  1WL6 A;  1JAW A;  1WBQ A;  2BHB A;  4A6W A;  3MAT A;  4OOK A;  2BWV A;  1R5G A;  3BIT A;  2Q95 A;  1QXW A;  4U6W A;  2EVM A;  4RZY A;  4HXX A;  4U73 A;  2BWX A;  1KP0 A;  2GG5 A;  4U6C A;  4IDY A;  2BHC A;  4MAT A;  4ZWU A;  1XGN A;  3D27 A;  1YW7 A;  3CB5 A;  4S01 A;  5E5B A;  3TAV A;  4FO8 A;  2OAZ A;  2GG0 A;  3IU9 A;  4IKS A;  2B3H A;  2Q93 A;  1A16 A;  5JI6 A;  2EA2 A;  1XNZ A;  3MR1 A;  3MX6 A;  2BWU A;  2GU6 A;  1WL9 A;  4ZWO A;  2EA4 A;  1C24 A;  2BWT A;  2V3X A;  4U76 A;  2GG2 A;  1MAT A;  1WKM A;  4B28 A;  2GG7 A;  3PKD A;  3PKC A;  2GU7 A;  2GZ5 A;  4IU6 A;  1YVM A;  1R58 A;  2IW2 A;  2BH3 A;  1W2M A;  1W7V A;  4R60 A;  4RGZ 1;  5FCF A;  2P9A A;  4FUK A;  2OKN A;  2BWW A;  1CHM A;  2P98 A;  1B59 A;  4FLL A;  3IU8 A;  4U69 A;  1C27 A;  2Q94 A;  3CB6 A;  5CNX A;  1C21 A;  1WN1 A;  1C22 A;  4FLJ A;  2Q8K A;  2EVC A;  2BHD A;  2Q96 A;  2BB7 A;  3FM3 A;  2P99 A;  4U6Z A;  3TB5 A;  4PV4 A;  5CDV A;  1BN5 A;  2NQ6 A;  4FO7 A;  1R5H A;  4IPA A;  2GA2 A;  4IKR A;  1B6A A;  4JUQ A;  4ZWP A;  3IU7 A;  4S00 A;  5CDE A;  1QXY A;  1WY2 A;  3IG4 A;  2GGC A;  3BIP A;  3PKE A;  4A6V A;  2HOW A;  2V3Y A;  3FMR A;  4U6E A;  1KQ9 A;  1YJ3 A;  1M35 A;  2BWY A;  2GG8 A;  4U75 A;  3Q6D A;  5CIK A;  2GG9 A;  2ZSG A;  4Z7M A;  1N51 A;  2V6C A;  5JFR A;  2DFI A;  1KQ0 A;  2BHA A;  4KM3 A;  4PNC A;  5CDL A;  4ZNG A;  3BIQ A;  2BWS A;  2MAT A;  2EVO A;  2GGB A;  2B3L A;  2G6P A;  5D6F A;  4IKU A;  3PKB A;  4IEC A;  2GG3 A;  3ROR A;  5D6E A;  3FMQ A;  1YW8 A;  5CLS A;  4U6J A;  4FKC A;  4S2R P;  4EGE A;  5CE6 A;  5JHU A;  1PV9 A;  4U71 A;  2GU5 A;  4FLK A;  4RZZ A;  4IKT A;  1XGO A;  4QR8 A;  2B3K A;  1O0X A;  1WLR A;  4U1B A;  1C23 A; 
#chains in the Genus database with same CATH topology
 3S6B A;  4IF7 A;  2BN7 A;  2Q92 A;  3CTZ A;  1XGM A;  2GU4 A;  1XGS A;  2V3Z A;  3L24 A;  5FCH A;  3PKA A;  2ADU A;  3L7G A;  4S2T P;  2NQ7 A;  3RVA A;  1QXZ A;  4FLI A;  1Y1N A;  2GTX A;  4U70 A;  1YW9 A;  1QZY A;  1BOA A;  1WL6 A;  1JAW A;  1WBQ A;  2BHB A;  4A6W A;  3MAT A;  4OOK A;  2BWV A;  1R5G A;  3BIT A;  2Q95 A;  1QXW A;  4U6W A;  2EVM A;  4RZY A;  4HXX A;  4U73 A;  2BWX A;  1KP0 A;  2GG5 A;  4U6C A;  4IDY A;  2BHC A;  4MAT A;  4ZWU A;  1XGN A;  3D27 A;  1YW7 A;  3CB5 A;  4S01 A;  5E5B A;  3TAV A;  4FO8 A;  2OAZ A;  2GG0 A;  3IU9 A;  4IKS A;  2B3H A;  2Q93 A;  1A16 A;  5JI6 A;  2EA2 A;  1XNZ A;  3MR1 A;  3MX6 A;  2BWU A;  2GU6 A;  1WL9 A;  4ZWO A;  2EA4 A;  1C24 A;  2BWT A;  2V3X A;  4U76 A;  2GG2 A;  1MAT A;  1WKM A;  4B28 A;  2GG7 A;  3PKD A;  3PKC A;  2GU7 A;  2GZ5 A;  4IU6 A;  1YVM A;  1R58 A;  2IW2 A;  2BH3 A;  1W2M A;  1W7V A;  4R60 A;  4RGZ 1;  5FCF A;  2P9A A;  4FUK A;  2OKN A;  2BWW A;  1CHM A;  2P98 A;  1B59 A;  4FLL A;  3IU8 A;  4U69 A;  1C27 A;  2Q94 A;  3CB6 A;  5CNX A;  1C21 A;  1WN1 A;  1C22 A;  4FLJ A;  2Q8K A;  2EVC A;  2BHD A;  2Q96 A;  2BB7 A;  3FM3 A;  2P99 A;  4U6Z A;  3TB5 A;  4PV4 A;  5CDV A;  1BN5 A;  2NQ6 A;  4FO7 A;  1R5H A;  4IPA A;  2GA2 A;  4IKR A;  1B6A A;  4JUQ A;  4ZWP A;  3IU7 A;  4S00 A;  5CDE A;  1QXY A;  1WY2 A;  3IG4 A;  2GGC A;  3BIP A;  3PKE A;  4A6V A;  2HOW A;  2V3Y A;  3FMR A;  4U6E A;  1KQ9 A;  1YJ3 A;  1M35 A;  2BWY A;  2GG8 A;  4U75 A;  3Q6D A;  5CIK A;  2GG9 A;  2ZSG A;  4Z7M A;  1N51 A;  2V6C A;  5JFR A;  2DFI A;  1KQ0 A;  2BHA A;  4KM3 A;  4PNC A;  5CDL A;  4ZNG A;  3BIQ A;  2BWS A;  2MAT A;  2EVO A;  2GGB A;  2B3L A;  2G6P A;  5D6F A;  4IKU A;  3PKB A;  4IEC A;  2GG3 A;  3ROR A;  5D6E A;  3FMQ A;  1YW8 A;  5CLS A;  4U6J A;  4FKC A;  4S2R P;  4EGE A;  5CE6 A;  5JHU A;  1PV9 A;  4U71 A;  2GU5 A;  4FLK A;  4RZZ A;  4IKT A;  1XGO A;  4QR8 A;  2B3K A;  1O0X A;  1WLR A;  4U1B A;  1C23 A; 
#chains in the Genus database with same CATH homology
 3S6B A;  4IF7 A;  2BN7 A;  2Q92 A;  3CTZ A;  1XGM A;  2GU4 A;  1XGS A;  2V3Z A;  3L24 A;  5FCH A;  3PKA A;  2ADU A;  3L7G A;  4S2T P;  2NQ7 A;  3RVA A;  1QXZ A;  4FLI A;  1Y1N A;  2GTX A;  4U70 A;  1YW9 A;  1QZY A;  1BOA A;  1WL6 A;  1JAW A;  1WBQ A;  2BHB A;  4A6W A;  3MAT A;  4OOK A;  2BWV A;  1R5G A;  3BIT A;  2Q95 A;  1QXW A;  4U6W A;  2EVM A;  4RZY A;  4HXX A;  4U73 A;  2BWX A;  1KP0 A;  2GG5 A;  4U6C A;  4IDY A;  2BHC A;  4MAT A;  4ZWU A;  1XGN A;  3D27 A;  1YW7 A;  3CB5 A;  4S01 A;  5E5B A;  3TAV A;  4FO8 A;  2OAZ A;  2GG0 A;  3IU9 A;  4IKS A;  2B3H A;  2Q93 A;  1A16 A;  5JI6 A;  2EA2 A;  1XNZ A;  3MR1 A;  3MX6 A;  2BWU A;  2GU6 A;  1WL9 A;  4ZWO A;  2EA4 A;  1C24 A;  2BWT A;  2V3X A;  4U76 A;  2GG2 A;  1MAT A;  1WKM A;  4B28 A;  2GG7 A;  3PKD A;  3PKC A;  2GU7 A;  2GZ5 A;  4IU6 A;  1YVM A;  1R58 A;  2IW2 A;  2BH3 A;  1W2M A;  1W7V A;  4R60 A;  4RGZ 1;  5FCF A;  2P9A A;  4FUK A;  2OKN A;  2BWW A;  1CHM A;  2P98 A;  1B59 A;  4FLL A;  3IU8 A;  4U69 A;  1C27 A;  2Q94 A;  3CB6 A;  5CNX A;  1C21 A;  1WN1 A;  1C22 A;  4FLJ A;  2Q8K A;  2EVC A;  2BHD A;  2Q96 A;  2BB7 A;  3FM3 A;  2P99 A;  4U6Z A;  3TB5 A;  4PV4 A;  5CDV A;  1BN5 A;  2NQ6 A;  4FO7 A;  1R5H A;  4IPA A;  2GA2 A;  4IKR A;  1B6A A;  4JUQ A;  4ZWP A;  3IU7 A;  4S00 A;  5CDE A;  1QXY A;  1WY2 A;  3IG4 A;  2GGC A;  3BIP A;  3PKE A;  4A6V A;  2HOW A;  2V3Y A;  3FMR A;  4U6E A;  1KQ9 A;  1YJ3 A;  1M35 A;  2BWY A;  2GG8 A;  4U75 A;  3Q6D A;  5CIK A;  2GG9 A;  2ZSG A;  4Z7M A;  1N51 A;  2V6C A;  5JFR A;  2DFI A;  1KQ0 A;  2BHA A;  4KM3 A;  4PNC A;  5CDL A;  4ZNG A;  3BIQ A;  2BWS A;  2MAT A;  2EVO A;  2GGB A;  2B3L A;  2G6P A;  5D6F A;  4IKU A;  3PKB A;  4IEC A;  2GG3 A;  3ROR A;  5D6E A;  3FMQ A;  1YW8 A;  5CLS A;  4U6J A;  4FKC A;  4S2R P;  4EGE A;  5CE6 A;  5JHU A;  1PV9 A;  4U71 A;  2GU5 A;  4FLK A;  4RZZ A;  4IKT A;  1XGO A;  4QR8 A;  2B3K A;  1O0X A;  1WLR A;  4U1B A;  1C23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...